F410690

General Info

Members Datasets Scaffolds Average Seq Length
331 143 662 152

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0502905|Ga0501047_0502905_329_820
Length 163
Sequence MDMVTDRPTIALSVLAGRAGGLVGRSEWLTIDQAQIDAFAAVTHDHQYIHVDPVAAKSVFGGTIAHGFLTLSMISLMAVQALPAIAGGVMEVNYGFNRIRFLTPVRSGSRVRGSFVLMGLEERNPGEWLARYDVTIEIGGEPKPALVAEWMMLTVLGTQGEGQ

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 4.53
Rhizosphere 95.17
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0502905 3300049581 Bacteria 1039
2 JGI24735J21928_10025691 3300002067 Bacteria 1776
3 JGI24735J21928_10123406 3300002067 Bacteria 746
4 Ga0070658_10099605 3300005327 Bacteria 2401
5 Ga0070658_10107189 3300005327 Bacteria 2312
6 Ga0070676_10086150 3300005328 Bacteria 1916
7 Ga0070683_100049549 3300005329 Bacteria 3885
8 Ga0070683_100081732 3300005329 Bacteria 3025
9 Ga0070683_100287648 3300005329 Bacteria 1563
10 Ga0070670_100038412 3300005331 Bacteria 4117
11 Ga0070670_101680995 3300005331 Bacteria 584
12 Ga0070677_10068247 3300005333 Bacteria 1488
13 Ga0070680_100089401 3300005336 Bacteria 2548
14 Ga0070680_100161415 3300005336 Bacteria 1883
15 Ga0070680_100392482 3300005336 Bacteria 1182
16 Ga0070682_100127243 3300005337 Bacteria 1719
17 Ga0070660_100015278 3300005339 Bacteria 5539
18 Ga0070660_100066632 3300005339 Bacteria 2804
19 Ga0070660_100109477 3300005339 Bacteria 2196
20 Ga0070660_100245721 3300005339 Bacteria 1458
21 Ga0070660_100743391 3300005339 Bacteria 823
22 Ga0070660_101822016 3300005339 Bacteria 518
23 Ga0070661_100102868 3300005344 Bacteria 2127
24 Ga0070661_100162952 3300005344 Bacteria 1689
25 Ga0070661_100367047 3300005344 Bacteria 1132
26 Ga0070661_100439578 3300005344 Bacteria 1036
27 Ga0070661_100532485 3300005344 Bacteria 943
28 Ga0070661_100665818 3300005344 Bacteria 846
29 Ga0070661_100773142 3300005344 Bacteria 786
30 Ga0070692_10091543 3300005345 Bacteria 1654
31 Ga0070668_100316417 3300005347 Bacteria 1313
32 Ga0070668_100653395 3300005347 Bacteria 924
33 Ga0070668_101297790 3300005347 Bacteria 662
34 Ga0070669_100096622 3300005353 Bacteria 2223
35 Ga0070675_100060868 3300005354 Bacteria 3117
36 Ga0070671_100154920 3300005355 Bacteria 1936
37 Ga0070671_100328976 3300005355 Bacteria 1302
38 Ga0070671_100398931 3300005355 Bacteria 1176
39 Ga0070671_100777454 3300005355 Bacteria 833
40 Ga0070673_100962590 3300005364 Bacteria 793
41 Ga0070659_100170905 3300005366 Bacteria 1780
42 Ga0070659_100213406 3300005366 Bacteria 1591
43 Ga0070659_100545785 3300005366 Bacteria 992
44 Ga0070659_100551401 3300005366 Bacteria 987
45 Ga0070659_100624665 3300005366 Bacteria 927
46 Ga0070659_100879501 3300005366 Bacteria 782
47 Ga0070659_101004261 3300005366 Bacteria 732
48 Ga0070667_100001257 3300005367 Bacteria 23000
49 Ga0070667_100665133 3300005367 Bacteria 962
50 Ga0070667_100925862 3300005367 Bacteria 812
51 Ga0070714_100248576 3300005435 Bacteria 1644
52 Ga0070663_100189869 3300005455 Bacteria 1598
53 Ga0070663_100465145 3300005455 Bacteria 1045
54 Ga0070663_100478550 3300005455 Bacteria 1030
55 Ga0070663_100644226 3300005455 Bacteria 895
56 Ga0070662_100089130 3300005457 Bacteria 2313
57 Ga0070681_10002173 3300005458 Bacteria 17844
58 Ga0070681_10360150 3300005458 Bacteria 1365
59 Ga0068867_100393189 3300005459 Bacteria 1167
60 Ga0068867_100559783 3300005459 Bacteria 991
61 Ga0070679_100032099 3300005530 Bacteria 5193
62 Ga0070679_100204911 3300005530 Bacteria 1937
63 Ga0070679_100470294 3300005530 Bacteria 1201
64 Ga0070679_100510002 3300005530 Bacteria 1147
65 Ga0070684_100068122 3300005535 Bacteria 3128
66 Ga0068853_100117663 3300005539 Bacteria 2367
67 Ga0068853_100149974 3300005539 Bacteria 2098
68 Ga0068853_100371365 3300005539 Bacteria 1334
69 Ga0070672_100386616 3300005543 Bacteria 1198
70 Ga0070672_100615302 3300005543 Bacteria 947
71 Ga0070686_100000280 3300005544 Bacteria 34516
72 Ga0070665_100115945 3300005548 Bacteria 2681
73 Ga0068855_100019691 3300005563 Bacteria 8103
74 Ga0068855_100086177 3300005563 Bacteria 3632
75 Ga0068855_100212394 3300005563 Bacteria 2174
76 Ga0068855_100493835 3300005563 Bacteria 1331
77 Ga0068855_100523049 3300005563 Bacteria 1287
78 Ga0068855_100636883 3300005563 Bacteria 1146
79 Ga0068855_101056979 3300005563 Bacteria 851
80 Ga0070664_100002924 3300005564 Bacteria 13832
81 Ga0070664_100066421 3300005564 Bacteria 3080
82 Ga0070664_100082732 3300005564 Bacteria 2769
83 Ga0070664_100160050 3300005564 Bacteria 1992
84 Ga0070664_101238806 3300005564 Bacteria 704
85 Ga0068857_100033733 3300005577 Bacteria 4527
86 Ga0068857_100064561 3300005577 Bacteria 3255
87 Ga0068857_101060677 3300005577 Bacteria 781
88 Ga0068854_100324489 3300005578 Bacteria 1252
89 Ga0068854_100815043 3300005578 Bacteria 815
90 Ga0068854_100819597 3300005578 Bacteria 812
91 Ga0068856_100162626 3300005614 Bacteria 2243
92 Ga0068856_100370804 3300005614 Bacteria 1450
93 Ga0068852_100236311 3300005616 Bacteria 1744
94 Ga0068852_100385081 3300005616 Bacteria 1376
95 Ga0068852_100556806 3300005616 Bacteria 1147
96 Ga0068852_100656316 3300005616 Bacteria 1057
97 Ga0068852_101620003 3300005616 Bacteria 670
98 Ga0068859_100240756 3300005617 Bacteria 1898
99 Ga0068864_100419423 3300005618 Bacteria 1275
100 Ga0068866_10214232 3300005718 Bacteria 1158
101 Ga0068861_100319862 3300005719 Bacteria 1351
102 Ga0068861_101205876 3300005719 Bacteria 732
103 Ga0068851_10082830 3300005834 Bacteria 1678
104 Ga0068851_10270058 3300005834 Bacteria 969
105 Ga0068863_100010214 3300005841 Bacteria 9127
106 Ga0068863_100078486 3300005841 Bacteria 3126
107 Ga0068858_101163830 3300005842 Bacteria 758
108 Ga0068860_100232228 3300005843 Bacteria 1793
109 Ga0068860_100254474 3300005843 Bacteria 1711
110 Ga0081455_10045616 3300005937 Bacteria 3812
111 Ga0081455_10473631 3300005937 Bacteria 849
112 Ga0070717_10627543 3300006028 Bacteria 975
113 Ga0097621_100064225 3300006237 Bacteria 3019
114 Ga0097621_101827240 3300006237 Bacteria 579
115 Ga0075433_11778420 3300006852 Bacteria 530
116 Ga0097620_100240773 3300006931 Bacteria 1898
117 Ga0105245_10843024 3300009098 Bacteria 956
118 Ga0105243_10174843 3300009148 Bacteria 1863
119 Ga0105241_10704175 3300009174 Bacteria 922
120 Ga0105248_10016745 3300009177 Bacteria 8071
121 Ga0105248_10020737 3300009177 Bacteria 7281
122 Ga0105248_10122644 3300009177 Bacteria 2932
123 Ga0105248_10451549 3300009177 Bacteria 1448
124 Ga0105238_10839995 3300009551 Bacteria 935
125 Ga0105249_10975386 3300009553 Bacteria 916
126 Ga0157373_10124145 3300013100 Bacteria 1815
127 Ga0157373_10180600 3300013100 Bacteria 1486
128 Ga0157373_10281455 3300013100 Bacteria 1179
129 Ga0157373_10450365 3300013100 Bacteria 926
130 Ga0157371_10005614 3300013102 Bacteria 10548
131 Ga0157371_10126550 3300013102 Bacteria 1817
132 Ga0157371_10299406 3300013102 Bacteria 1164
133 Ga0157371_10607493 3300013102 Bacteria 814
134 Ga0157370_10018620 3300013104 Bacteria 6982
135 Ga0157370_10075851 3300013104 Bacteria 3169
136 Ga0157370_10523412 3300013104 Bacteria 1088
137 Ga0157370_11115237 3300013104 Bacteria 713
138 Ga0157369_10202782 3300013105 Bacteria 2081
139 Ga0157369_10700501 3300013105 Bacteria 1043
140 Ga0157369_10886922 3300013105 Bacteria 915
141 Ga0157369_11447364 3300013105 Bacteria 699
142 Ga0157374_11360748 3300013296 Bacteria 732
143 Ga0157374_11799650 3300013296 Bacteria 638
144 Ga0157374_11975702 3300013296 Bacteria 609
145 Ga0157372_10081303 3300013307 Bacteria 3667
146 Ga0157375_10052161 3300013308 Bacteria 4020
147 Ga0163163_10020352 3300014325 Bacteria 6247
148 Ga0207656_10039173 3300025321 Bacteria 2003
149 Ga0207656_10119854 3300025321 Bacteria 1224
150 Ga0207656_10355774 3300025321 Bacteria 731
151 Ga0207680_10148727 3300025903 Bacteria 1560
152 Ga0207647_10015520 3300025904 Bacteria 5218
153 Ga0207647_10074499 3300025904 Bacteria 2044
154 Ga0207645_10025028 3300025907 Bacteria 3865
155 Ga0207705_10008099 3300025909 Bacteria 7699
156 Ga0207705_10045610 3300025909 Bacteria 3150
157 Ga0207705_10086948 3300025909 Bacteria 2285
158 Ga0207654_10555207 3300025911 Bacteria 816
159 Ga0207707_10092633 3300025912 Bacteria 2640
160 Ga0207707_10188700 3300025912 Bacteria 1799
161 Ga0207660_10000491 3300025917 Bacteria 26376
162 Ga0207660_10071509 3300025917 Bacteria 2524
163 Ga0207657_10003514 3300025919 Bacteria 16739
164 Ga0207657_10040261 3300025919 Bacteria 4143
165 Ga0207657_10057096 3300025919 Bacteria 3366
166 Ga0207657_10078170 3300025919 Bacteria 2787
167 Ga0207657_10297923 3300025919 Bacteria 1278
168 Ga0207657_10643332 3300025919 Bacteria 826
169 Ga0207657_10891674 3300025919 Bacteria 685
170 Ga0207649_10003550 3300025920 Bacteria 8526
171 Ga0207649_10112904 3300025920 Bacteria 1819
172 Ga0207649_10339744 3300025920 Bacteria 1108
173 Ga0207649_10547076 3300025920 Bacteria 885
174 Ga0207652_10004701 3300025921 Bacteria 11073
175 Ga0207652_10154425 3300025921 Bacteria 2056
176 Ga0207652_10300631 3300025921 Bacteria 1448
177 Ga0207652_10505857 3300025921 Bacteria 1087
178 Ga0207681_10098066 3300025923 Bacteria 2108
179 Ga0207681_10687862 3300025923 Bacteria 850
180 Ga0207694_11519865 3300025924 Bacteria 565
181 Ga0207650_10018760 3300025925 Bacteria 4858
182 Ga0207650_10057501 3300025925 Bacteria 2892
183 Ga0207650_10165171 3300025925 Bacteria 1756
184 Ga0207659_10033421 3300025926 Bacteria 3540
185 Ga0207659_11633081 3300025926 Bacteria 550
186 Ga0207700_10068303 3300025928 Bacteria 2724
187 Ga0207664_10220753 3300025929 Bacteria 1644
188 Ga0207644_10065773 3300025931 Bacteria 2637
189 Ga0207644_10143475 3300025931 Bacteria 1841
190 Ga0207644_10250840 3300025931 Bacteria 1412
191 Ga0207690_10186574 3300025932 Bacteria 1565
192 Ga0207690_10486951 3300025932 Bacteria 996
193 Ga0207690_10669263 3300025932 Bacteria 852
194 Ga0207706_10027548 3300025933 Bacteria 5080
195 Ga0207709_10139454 3300025935 Bacteria 1665
196 Ga0207665_11035754 3300025939 Bacteria 653
197 Ga0207691_10014901 3300025940 Bacteria 7408
198 Ga0207711_10001979 3300025941 Bacteria 18559
199 Ga0207711_10006305 3300025941 Bacteria 10002
200 Ga0207711_10007069 3300025941 Bacteria 9406
201 Ga0207661_10405045 3300025944 Bacteria 1237
202 Ga0207661_10451302 3300025944 Bacteria 1171
203 Ga0207679_10006432 3300025945 Bacteria 7421
204 Ga0207679_10128946 3300025945 Bacteria 2026
205 Ga0207679_10564717 3300025945 Bacteria 1022
206 Ga0207679_10638696 3300025945 Bacteria 962
207 Ga0207667_10157542 3300025949 Bacteria 2336
208 Ga0207667_10413792 3300025949 Bacteria 1372
209 Ga0207667_10527919 3300025949 Bacteria 1195
210 Ga0207667_10551529 3300025949 Bacteria 1166
211 Ga0207667_10639276 3300025949 Bacteria 1070
212 Ga0207668_10964160 3300025972 Bacteria 761
213 Ga0207668_11235316 3300025972 Bacteria 672
214 Ga0207640_10105597 3300025981 Bacteria 1985
215 Ga0207640_10189450 3300025981 Bacteria 1549
216 Ga0207640_10788679 3300025981 Bacteria 822
217 Ga0207658_10002801 3300025986 Bacteria 12540
218 Ga0207658_10016366 3300025986 Bacteria 5101
219 Ga0207678_10016627 3300026067 Bacteria 6463
220 Ga0207678_10020609 3300026067 Bacteria 5780
221 Ga0207678_10035490 3300026067 Bacteria 4341
222 Ga0207678_10270128 3300026067 Bacteria 1458
223 Ga0207702_10012501 3300026078 Bacteria 7061
224 Ga0207702_10020635 3300026078 Bacteria 5453
225 Ga0207702_10312779 3300026078 Bacteria 1494
226 Ga0207702_10704384 3300026078 Bacteria 995
227 Ga0207702_11807154 3300026078 Bacteria 603
228 Ga0207641_10024378 3300026088 Bacteria 4986
229 Ga0207641_10037703 3300026088 Bacteria 4038
230 Ga0207641_10156756 3300026088 Bacteria 2066
231 Ga0207674_10000758 3300026116 Bacteria 42236
232 Ga0207674_10003388 3300026116 Bacteria 19553
233 Ga0207674_10289111 3300026116 Bacteria 1588
234 Ga0207675_100026650 3300026118 Bacteria 5381
235 Ga0207675_100204004 3300026118 Bacteria 1899
236 Ga0207698_10123341 3300026142 Bacteria 2197
237 Ga0207698_10761697 3300026142 Bacteria 968
238 Ga0268264_10116234 3300028381 Bacteria 2351
239 Ga0268264_10370674 3300028381 Bacteria 1368
240 Ga0307405_10108517 3300031731 Bacteria 1876
241 Ga0307413_10001541 3300031824 Bacteria 8852
242 Ga0307413_10005812 3300031824 Bacteria 5556
243 Ga0307413_10283589 3300031824 Bacteria 1247
244 Ga0307410_10032970 3300031852 Bacteria 3340
245 Ga0307410_10036966 3300031852 Bacteria 3185
246 Ga0307410_10044492 3300031852 Bacteria 2950
247 Ga0307407_10001565 3300031903 Bacteria 8413
248 Ga0307407_10025115 3300031903 Bacteria 3136
249 Ga0307407_10102181 3300031903 Bacteria 1782
250 Ga0307407_10417388 3300031903 Bacteria 966
251 Ga0307412_10176001 3300031911 Bacteria 1604
252 Ga0307412_11145024 3300031911 Bacteria 694
253 Ga0307409_100017541 3300031995 Bacteria 4777
254 Ga0307409_100246543 3300031995 Bacteria 1630
255 Ga0307409_100412523 3300031995 Bacteria 1293
256 Ga0307409_101594864 3300031995 Bacteria 681
257 Ga0307416_100691825 3300032002 Bacteria 1108
258 Ga0307414_10045375 3300032004 Bacteria 3009
259 Ga0307414_10049495 3300032004 Bacteria 2906
260 Ga0307414_10152698 3300032004 Bacteria 1824
261 Ga0307414_10152801 3300032004 Bacteria 1823
262 Ga0307414_10191260 3300032004 Bacteria 1656
263 Ga0307414_10924024 3300032004 Bacteria 801
264 Ga0307411_10001425 3300032005 Bacteria 9752
265 Ga0307411_10007581 3300032005 Bacteria 5546
266 Ga0307411_10034666 3300032005 Bacteria 3143
267 Ga0307411_10200311 3300032005 Bacteria 1532
268 Ga0307411_10643244 3300032005 Bacteria 917
269 Ga0307415_100030045 3300032126 Bacteria 3481
270 Ga0307415_100996672 3300032126 Bacteria 778
271 Ga0373931_0507007 3300035691 Bacteria 779
272 Ga0395899_0018367 3300037312 Bacteria 5315
273 Ga0395899_0281540 3300037312 Bacteria 1131
274 Ga0395899_0451773 3300037312 Bacteria 841
275 Ga0395900_0002988 3300037418 Bacteria 18402
276 Ga0395900_0014876 3300037418 Bacteria 7929
277 Ga0395900_1042345 3300037418 Bacteria 737
278 Ga0395900_1392460 3300037418 Bacteria 614
279 Ga0395900_1464064 3300037418 Bacteria 595
280 Ga0395900_1471857 3300037418 Bacteria 593
281 Ga0395900_1806524 3300037418 Bacteria 522
282 Ga0395898_0016609 3300037466 Bacteria 7524
283 Ga0395898_0708347 3300037466 Bacteria 948
284 Ga0395898_1690433 3300037466 Bacteria 556
285 Ga0395905_0010835 3300037471 Bacteria 8831
286 Ga0395905_0020282 3300037471 Bacteria 6298
287 Ga0395905_0020581 3300037471 Bacteria 6246
288 Ga0395905_0194635 3300037471 Bacteria 1901
289 Ga0395905_0336608 3300037471 Bacteria 1400
290 Ga0395905_1129135 3300037471 Bacteria 687
291 Ga0395901_0025224 3300038443 Bacteria 6103
292 Ga0395901_0033353 3300038443 Bacteria 5315
293 Ga0395901_0078176 3300038443 Bacteria 3454
294 Ga0395901_0221649 3300038443 Bacteria 1977
295 Ga0395901_0613160 3300038443 Bacteria 1096
296 Ga0466971_0490777 3300044719 Bacteria 605
297 Ga0466957_0077435 3300044842 Bacteria 2066
298 Ga0466957_0088582 3300044842 Bacteria 1937
299 Ga0466958_0119082 3300045836 Bacteria 1652
300 Ga0466967_0090121 3300045976 Bacteria 2785
301 Ga0466967_0119702 3300045976 Bacteria 2431
302 Ga0466967_0127477 3300045976 Bacteria 2359
303 Ga0495629_0881628 3300046459 Bacteria 587
304 Ga0495643_0107522 3300046522 Bacteria 1422
305 Ga0495668_0096311 3300046616 Bacteria 1619
306 Ga0495647_0216656 3300046681 Bacteria 844
307 Ga0495669_0086520 3300046684 Bacteria 1443
308 Ga0495669_0384560 3300046684 Bacteria 679
309 Ga0495670_0097387 3300046691 Bacteria 1512
310 Ga0496101_0022133 3300048904 Bacteria 4373
311 Ga0496102_0920903 3300048905 Bacteria 796
312 Ga0496107_0023269 3300048910 Bacteria 4380
313 Ga0496109_0260016 3300048912 Bacteria 1635
314 Ga0496109_1449636 3300048912 Bacteria 622
315 Ga0496110_0250848 3300048913 Bacteria 1611
316 Ga0496111_0166159 3300048914 Bacteria 1639
317 Ga0496111_0360226 3300048914 Bacteria 1076
318 Ga0496111_0644178 3300048914 Bacteria 773
319 Ga0496112_0057386 3300048915 Bacteria 3833
320 Ga0496112_0173854 3300048915 Bacteria 2119
321 Ga0496113_0216745 3300048916 Bacteria 1525
322 Ga0496114_0549274 3300048917 Unclassified 1021
323 Ga0496114_0765891 3300048917 Bacteria 843
324 Ga0496115_0028852 3300048918 Bacteria 4352
325 Ga0501068_0407517 3300049584 Bacteria 877
326 Ga0501069_0352165 3300049585 Bacteria 868
327 Ga0501074_0092713 3300049590 Bacteria 2163
328 Ga0501076_1551118 3300049592 Bacteria 544
329 Ga0495655_0233442 3300053083 Bacteria 613
330 Ga0500559_0013996 3300053136 Bacteria 3391
331 Ga0466962_0049882 3300061719 Bacteria 2001
332 Ga0501047_0502905
333 JGI24735J21928_10025691
334 JGI24735J21928_10123406
335 Ga0070658_10099605
336 Ga0070658_10107189
337 Ga0070676_10086150
338 Ga0070683_100049549
339 Ga0070683_100081732
340 Ga0070683_100287648
341 Ga0070670_100038412
342 Ga0070670_101680995
343 Ga0070677_10068247
344 Ga0070680_100089401
345 Ga0070680_100161415
346 Ga0070680_100392482
347 Ga0070682_100127243
348 Ga0070660_100015278
349 Ga0070660_100066632
350 Ga0070660_100109477
351 Ga0070660_100245721
352 Ga0070660_100743391
353 Ga0070660_101822016
354 Ga0070661_100102868
355 Ga0070661_100162952
356 Ga0070661_100367047
357 Ga0070661_100439578
358 Ga0070661_100532485
359 Ga0070661_100665818
360 Ga0070661_100773142
361 Ga0070692_10091543
362 Ga0070668_100316417
363 Ga0070668_100653395
364 Ga0070668_101297790
365 Ga0070669_100096622
366 Ga0070675_100060868
367 Ga0070671_100154920
368 Ga0070671_100328976
369 Ga0070671_100398931
370 Ga0070671_100777454
371 Ga0070673_100962590
372 Ga0070659_100170905
373 Ga0070659_100213406
374 Ga0070659_100545785
375 Ga0070659_100551401
376 Ga0070659_100624665
377 Ga0070659_100879501
378 Ga0070659_101004261
379 Ga0070667_100001257
380 Ga0070667_100665133
381 Ga0070667_100925862
382 Ga0070714_100248576
383 Ga0070663_100189869
384 Ga0070663_100465145
385 Ga0070663_100478550
386 Ga0070663_100644226
387 Ga0070662_100089130
388 Ga0070681_10002173
389 Ga0070681_10360150
390 Ga0068867_100393189
391 Ga0068867_100559783
392 Ga0070679_100032099
393 Ga0070679_100204911
394 Ga0070679_100470294
395 Ga0070679_100510002
396 Ga0070684_100068122
397 Ga0068853_100117663
398 Ga0068853_100149974
399 Ga0068853_100371365
400 Ga0070672_100386616
401 Ga0070672_100615302
402 Ga0070686_100000280
403 Ga0070665_100115945
404 Ga0068855_100019691
405 Ga0068855_100086177
406 Ga0068855_100212394
407 Ga0068855_100493835
408 Ga0068855_100523049
409 Ga0068855_100636883
410 Ga0068855_101056979
411 Ga0070664_100002924
412 Ga0070664_100066421
413 Ga0070664_100082732
414 Ga0070664_100160050
415 Ga0070664_101238806
416 Ga0068857_100033733
417 Ga0068857_100064561
418 Ga0068857_101060677
419 Ga0068854_100324489
420 Ga0068854_100815043
421 Ga0068854_100819597
422 Ga0068856_100162626
423 Ga0068856_100370804
424 Ga0068852_100236311
425 Ga0068852_100385081
426 Ga0068852_100556806
427 Ga0068852_100656316
428 Ga0068852_101620003
429 Ga0068859_100240756
430 Ga0068864_100419423
431 Ga0068866_10214232
432 Ga0068861_100319862
433 Ga0068861_101205876
434 Ga0068851_10082830
435 Ga0068851_10270058
436 Ga0068863_100010214
437 Ga0068863_100078486
438 Ga0068858_101163830
439 Ga0068860_100232228
440 Ga0068860_100254474
441 Ga0081455_10045616
442 Ga0081455_10473631
443 Ga0070717_10627543
444 Ga0097621_100064225
445 Ga0097621_101827240
446 Ga0075433_11778420
447 Ga0097620_100240773
448 Ga0105245_10843024
449 Ga0105243_10174843
450 Ga0105241_10704175
451 Ga0105248_10016745
452 Ga0105248_10020737
453 Ga0105248_10122644
454 Ga0105248_10451549
455 Ga0105238_10839995
456 Ga0105249_10975386
457 Ga0157373_10124145
458 Ga0157373_10180600
459 Ga0157373_10281455
460 Ga0157373_10450365
461 Ga0157371_10005614
462 Ga0157371_10126550
463 Ga0157371_10299406
464 Ga0157371_10607493
465 Ga0157370_10018620
466 Ga0157370_10075851
467 Ga0157370_10523412
468 Ga0157370_11115237
469 Ga0157369_10202782
470 Ga0157369_10700501
471 Ga0157369_10886922
472 Ga0157369_11447364
473 Ga0157374_11360748
474 Ga0157374_11799650
475 Ga0157374_11975702
476 Ga0157372_10081303
477 Ga0157375_10052161
478 Ga0163163_10020352
479 Ga0207656_10039173
480 Ga0207656_10119854
481 Ga0207656_10355774
482 Ga0207680_10148727
483 Ga0207647_10015520
484 Ga0207647_10074499
485 Ga0207645_10025028
486 Ga0207705_10008099
487 Ga0207705_10045610
488 Ga0207705_10086948
489 Ga0207654_10555207
490 Ga0207707_10092633
491 Ga0207707_10188700
492 Ga0207660_10000491
493 Ga0207660_10071509
494 Ga0207657_10003514
495 Ga0207657_10040261
496 Ga0207657_10057096
497 Ga0207657_10078170
498 Ga0207657_10297923
499 Ga0207657_10643332
500 Ga0207657_10891674
501 Ga0207649_10003550
502 Ga0207649_10112904
503 Ga0207649_10339744
504 Ga0207649_10547076
505 Ga0207652_10004701
506 Ga0207652_10154425
507 Ga0207652_10300631
508 Ga0207652_10505857
509 Ga0207681_10098066
510 Ga0207681_10687862
511 Ga0207694_11519865
512 Ga0207650_10018760
513 Ga0207650_10057501
514 Ga0207650_10165171
515 Ga0207659_10033421
516 Ga0207659_11633081
517 Ga0207700_10068303
518 Ga0207664_10220753
519 Ga0207644_10065773
520 Ga0207644_10143475
521 Ga0207644_10250840
522 Ga0207690_10186574
523 Ga0207690_10486951
524 Ga0207690_10669263
525 Ga0207706_10027548
526 Ga0207709_10139454
527 Ga0207665_11035754
528 Ga0207691_10014901
529 Ga0207711_10001979
530 Ga0207711_10006305
531 Ga0207711_10007069
532 Ga0207661_10405045
533 Ga0207661_10451302
534 Ga0207679_10006432
535 Ga0207679_10128946
536 Ga0207679_10564717
537 Ga0207679_10638696
538 Ga0207667_10157542
539 Ga0207667_10413792
540 Ga0207667_10527919
541 Ga0207667_10551529
542 Ga0207667_10639276
543 Ga0207668_10964160
544 Ga0207668_11235316
545 Ga0207640_10105597
546 Ga0207640_10189450
547 Ga0207640_10788679
548 Ga0207658_10002801
549 Ga0207658_10016366
550 Ga0207678_10016627
551 Ga0207678_10020609
552 Ga0207678_10035490
553 Ga0207678_10270128
554 Ga0207702_10012501
555 Ga0207702_10020635
556 Ga0207702_10312779
557 Ga0207702_10704384
558 Ga0207702_11807154
559 Ga0207641_10024378
560 Ga0207641_10037703
561 Ga0207641_10156756
562 Ga0207674_10000758
563 Ga0207674_10003388
564 Ga0207674_10289111
565 Ga0207675_100026650
566 Ga0207675_100204004
567 Ga0207698_10123341
568 Ga0207698_10761697
569 Ga0268264_10116234
570 Ga0268264_10370674
571 Ga0307405_10108517
572 Ga0307413_10001541
573 Ga0307413_10005812
574 Ga0307413_10283589
575 Ga0307410_10032970
576 Ga0307410_10036966
577 Ga0307410_10044492
578 Ga0307407_10001565
579 Ga0307407_10025115
580 Ga0307407_10102181
581 Ga0307407_10417388
582 Ga0307412_10176001
583 Ga0307412_11145024
584 Ga0307409_100017541
585 Ga0307409_100246543
586 Ga0307409_100412523
587 Ga0307409_101594864
588 Ga0307416_100691825
589 Ga0307414_10045375
590 Ga0307414_10049495
591 Ga0307414_10152698
592 Ga0307414_10152801
593 Ga0307414_10191260
594 Ga0307414_10924024
595 Ga0307411_10001425
596 Ga0307411_10007581
597 Ga0307411_10034666
598 Ga0307411_10200311
599 Ga0307411_10643244
600 Ga0307415_100030045
601 Ga0307415_100996672
602 Ga0373931_0507007
603 Ga0395899_0018367
604 Ga0395899_0281540
605 Ga0395899_0451773
606 Ga0395900_0002988
607 Ga0395900_0014876
608 Ga0395900_1042345
609 Ga0395900_1392460
610 Ga0395900_1464064
611 Ga0395900_1471857
612 Ga0395900_1806524
613 Ga0395898_0016609
614 Ga0395898_0708347
615 Ga0395898_1690433
616 Ga0395905_0010835
617 Ga0395905_0020282
618 Ga0395905_0020581
619 Ga0395905_0194635
620 Ga0395905_0336608
621 Ga0395905_1129135
622 Ga0395901_0025224
623 Ga0395901_0033353
624 Ga0395901_0078176
625 Ga0395901_0221649
626 Ga0395901_0613160
627 Ga0466971_0490777
628 Ga0466957_0077435
629 Ga0466957_0088582
630 Ga0466958_0119082
631 Ga0466967_0090121
632 Ga0466967_0119702
633 Ga0466967_0127477
634 Ga0495629_0881628
635 Ga0495643_0107522
636 Ga0495668_0096311
637 Ga0495647_0216656
638 Ga0495669_0086520
639 Ga0495669_0384560
640 Ga0495670_0097387
641 Ga0496101_0022133
642 Ga0496102_0920903
643 Ga0496107_0023269
644 Ga0496109_0260016
645 Ga0496109_1449636
646 Ga0496110_0250848
647 Ga0496111_0166159
648 Ga0496111_0360226
649 Ga0496111_0644178
650 Ga0496112_0057386
651 Ga0496112_0173854
652 Ga0496113_0216745
653 Ga0496114_0549274
654 Ga0496114_0765891
655 Ga0496115_0028852
656 Ga0501068_0407517
657 Ga0501069_0352165
658 Ga0501074_0092713
659 Ga0501076_1551118
660 Ga0495655_0233442
661 Ga0500559_0013996
662 Ga0466962_0049882

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

15

136

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2i-assembly1.cif.gz_B structure and function of rv0130, a conserved hypothetical protein from m.tuberculosis 0.8719 1 149
4mei-assembly1.cif.gz_A-2 crystal structure of a virb8 type iv secretion system machinery soluble domain from bartonella tribocorum 0.8248 106 148
2bhm-assembly1.cif.gz_A-2 crystal structure of virb8 from brucella suis 0.8094 106 132
4akz-assembly1.cif.gz_A crystal structure of virb8 from brucella suis 0.8086 106 148
4kz1-assembly1.cif.gz_A-2 crystal structure of the soluble domain of virb8 from bartonella grahamii 0.808 106 146
ID Description Score Start End Superfamily
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9047 2 147 3.10.129.10
af_B0G197_51_201_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8819 2 147 3.10.129.10
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8722 1 149 3.10.129.10
2c2iB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8667 1 149 3.10.129.10
4kz1A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;VirB8 protein 0.808 106 146 3.10.450.230
ID Description Score Start End GO Terms
AF-A0A2K8K3L7-F1-model_v4 deleted 0.9759 81 149
AF-A0A657B5W3-F1-model_v4 MaoC-like domain-containing protein 0.9652 85 149
AF-A0A356HPE8-F1-model_v4 deleted 0.9624 81 149
AF-A0A436LVK8-F1-model_v4 deleted 0.9609 79 148
AF-A0A3M4AX57-F1-model_v4 Uncharacterized protein 0.9592 77 149

Map