F410683

General Info

Members Datasets Scaffolds Average Seq Length
331 169 662 62

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0363540|Ga0501036_0363540_868_1098
Length 76
Sequence VSTPATVRPERRPPKRRGWLRLVISLLVIVGVFAAGLALGEALNDNPSGGTQTLVRTLKPLEVPPARETVTVTRPG

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
85 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
86 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
89 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
90 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
91 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.37
Metatranscriptomes 3.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.08
Rhizosphere 87.61
Stem 0
Stem Tuber 0
Unclassified 19.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0363540 3300049572 Bacteria 1208
2 Ga0070658_10064963 3300005327 Bacteria 2977
3 Ga0070683_100007115 3300005329 Bacteria 9431
4 Ga0070683_100597002 3300005329 Unclassified 1056
5 Ga0070683_101551573 3300005329 Bacteria 637
6 Ga0070680_100107680 3300005336 Bacteria 2318
7 Ga0070680_100127148 3300005336 Bacteria 2130
8 Ga0070680_100586305 3300005336 Unclassified 957
9 Ga0070682_100671525 3300005337 Bacteria 827
10 Ga0070660_100000651 3300005339 Bacteria 23008
11 Ga0070660_100370460 3300005339 Bacteria 1181
12 Ga0070660_100516109 3300005339 Unclassified 995
13 Ga0070660_100722842 3300005339 Unclassified 835
14 Ga0070691_11049348 3300005341 Unclassified 511
15 Ga0070661_100019453 3300005344 Bacteria 4840
16 Ga0070661_100446898 3300005344 Bacteria 1028
17 Ga0070661_100795785 3300005344 Unclassified 776
18 Ga0070673_100358227 3300005364 Bacteria 1296
19 Ga0070659_100056786 3300005366 Bacteria 3087
20 Ga0070709_10630816 3300005434 Bacteria 828
21 Ga0070709_11785266 3300005434 Bacteria 503
22 Ga0070714_100136588 3300005435 Bacteria 2197
23 Ga0070714_100419575 3300005435 Unclassified 1267
24 Ga0070714_101342496 3300005435 Bacteria 698
25 Ga0070713_100116822 3300005436 Bacteria 2334
26 Ga0070713_100559134 3300005436 Unclassified 1084
27 Ga0070710_10046163 3300005437 Bacteria 2425
28 Ga0070711_100033103 3300005439 Bacteria 3441
29 Ga0070711_100653317 3300005439 Unclassified 882
30 Ga0070681_10000870 3300005458 Bacteria 25432
31 Ga0070681_10051627 3300005458 Bacteria 4101
32 Ga0070681_10116500 3300005458 Bacteria 2608
33 Ga0070681_10237923 3300005458 Bacteria 1735
34 Ga0070681_10240848 3300005458 Unclassified 1722
35 Ga0070699_102203227 3300005518 Unclassified 503
36 Ga0070679_100007208 3300005530 Bacteria 10385
37 Ga0070679_100096359 3300005530 Bacteria 2946
38 Ga0070679_100113142 3300005530 Bacteria 2700
39 Ga0070679_100745784 3300005530 Bacteria 922
40 Ga0070679_101082989 3300005530 Unclassified 746
41 Ga0070684_100009888 3300005535 Bacteria 7537
42 Ga0070684_100890578 3300005535 Unclassified 834
43 Ga0068853_100358659 3300005539 Bacteria 1357
44 Ga0070672_101301316 3300005543 Unclassified 649
45 Ga0070696_100103707 3300005546 Bacteria 2041
46 Ga0068855_100007053 3300005563 Bacteria 13629
47 Ga0068855_100105167 3300005563 Bacteria 3246
48 Ga0068855_100597373 3300005563 Unclassified 1190
49 Ga0068857_100256159 3300005577 Bacteria 1605
50 Ga0068854_102247513 3300005578 Bacteria 505
51 Ga0068856_100220518 3300005614 Bacteria 1912
52 Ga0068856_102502593 3300005614 Unclassified 523
53 Ga0068852_100374508 3300005616 Bacteria 1395
54 Ga0068852_100563082 3300005616 Bacteria 1141
55 Ga0068852_102328413 3300005616 Bacteria 557
56 Ga0068863_102536513 3300005841 Unclassified 522
57 Ga0070717_10117706 3300006028 Bacteria 2273
58 Ga0070717_10225935 3300006028 Unclassified 1647
59 Ga0070717_10374697 3300006028 Bacteria 1276
60 Ga0070717_10993963 3300006028 Unclassified 764
61 Ga0070716_101070426 3300006173 Bacteria 641
62 Ga0070716_101561733 3300006173 Bacteria 541
63 Ga0070712_100014628 3300006175 Bacteria 5037
64 Ga0070712_101415562 3300006175 Bacteria 607
65 Ga0097621_100132323 3300006237 Bacteria 2124
66 Ga0097621_100148039 3300006237 Bacteria 2012
67 Ga0068871_100160124 3300006358 Bacteria 1925
68 Ga0075433_10163653 3300006852 Bacteria 1980
69 Ga0075434_100012841 3300006871 Bacteria 7953
70 Ga0075436_100035197 3300006914 Bacteria 3455
71 Ga0075435_100003270 3300007076 Bacteria 10981
72 Ga0105240_10011152 3300009093 Bacteria 12557
73 Ga0105240_10159394 3300009093 Bacteria 2682
74 Ga0105240_10584530 3300009093 Bacteria 1231
75 Ga0105240_12221050 3300009093 Unclassified 569
76 Ga0105245_10882980 3300009098 Bacteria 935
77 Ga0105245_11172069 3300009098 Bacteria 816
78 Ga0105245_12676953 3300009098 Unclassified 552
79 Ga0114129_11311676 3300009147 Unclassified 897
80 Ga0105241_10334871 3300009174 Unclassified 1309
81 Ga0105237_10011065 3300009545 Bacteria 9564
82 Ga0105238_10040039 3300009551 Bacteria 4750
83 Ga0105238_10507223 3300009551 Bacteria 1208
84 Ga0105239_11308620 3300010375 Unclassified 836
85 Ga0157373_10125949 3300013100 Bacteria 1801
86 Ga0157370_10010042 3300013104 Bacteria 10014
87 Ga0157370_10114781 3300013104 Bacteria 2516
88 Ga0157369_10048688 3300013105 Bacteria 4598
89 Ga0157369_10514801 3300013105 Bacteria 1238
90 Ga0157369_11179576 3300013105 Bacteria 782
91 Ga0157369_12497168 3300013105 Bacteria 523
92 Ga0157374_12218168 3300013296 Bacteria 576
93 Ga0157372_10015402 3300013307 Bacteria 8195
94 Ga0157372_11059844 3300013307 Bacteria 938
95 Ga0157372_12688480 3300013307 Unclassified 571
96 Ga0157375_10058838 3300013308 Bacteria 3804
97 Ga0157375_11281526 3300013308 Bacteria 861
98 Ga0182008_10215689 3300014497 Bacteria 981
99 Ga0157376_10463410 3300014969 Bacteria 1239
100 Ga0182006_1325236 3300015261 Bacteria 505
101 Ga0206356_10032574 3300020070 Bacteria 2490
102 Ga0206356_10076663 3300020070 Unclassified 540
103 Ga0206356_10457910 3300020070 Bacteria 2477
104 Ga0206356_11398518 3300020070 Bacteria 1038
105 Ga0206354_10141892 3300020081 Bacteria 3440
106 Ga0206354_10414339 3300020081 Bacteria 1230
107 Ga0206354_10561604 3300020081 Bacteria 1229
108 Ga0206354_11381065 3300020081 Bacteria 2261
109 Ga0206353_10221864 3300020082 Bacteria 1165
110 Ga0206353_10301567 3300020082 Bacteria 4123
111 Ga0206353_10522647 3300020082 Bacteria 3724
112 Ga0206353_10921223 3300020082 Bacteria 935
113 Ga0207699_10338236 3300025906 Unclassified 1060
114 Ga0207699_10552345 3300025906 Bacteria 835
115 Ga0207699_10836744 3300025906 Bacteria 677
116 Ga0207705_10196558 3300025909 Bacteria 1527
117 Ga0207707_10018863 3300025912 Bacteria 6016
118 Ga0207707_10496364 3300025912 Bacteria 1041
119 Ga0207695_10171104 3300025913 Bacteria 2098
120 Ga0207695_10205502 3300025913 Bacteria 1882
121 Ga0207695_10423469 3300025913 Bacteria 1215
122 Ga0207671_11544415 3300025914 Bacteria 512
123 Ga0207693_10131069 3300025915 Bacteria 1971
124 Ga0207693_10196681 3300025915 Unclassified 1586
125 Ga0207663_11502649 3300025916 Bacteria 542
126 Ga0207660_10011061 3300025917 Bacteria 5869
127 Ga0207660_10028521 3300025917 Bacteria 3819
128 Ga0207660_10166588 3300025917 Bacteria 1703
129 Ga0207657_10002974 3300025919 Bacteria 18179
130 Ga0207657_10008819 3300025919 Bacteria 10201
131 Ga0207657_10094573 3300025919 Bacteria 2488
132 Ga0207657_10414549 3300025919 Unclassified 1059
133 Ga0207649_10033137 3300025920 Bacteria 3085
134 Ga0207649_10175620 3300025920 Bacteria 1496
135 Ga0207649_10334068 3300025920 Bacteria 1117
136 Ga0207649_11419593 3300025920 Bacteria 549
137 Ga0207649_11684509 3300025920 Unclassified 502
138 Ga0207652_10021222 3300025921 Bacteria 5359
139 Ga0207652_10302901 3300025921 Bacteria 1443
140 Ga0207652_10371392 3300025921 Bacteria 1291
141 Ga0207652_11088330 3300025921 Bacteria 700
142 Ga0207694_11485958 3300025924 Bacteria 572
143 Ga0207694_11643280 3300025924 Bacteria 541
144 Ga0207687_11097978 3300025927 Unclassified 683
145 Ga0207700_10116619 3300025928 Unclassified 2158
146 Ga0207700_10386452 3300025928 Unclassified 1225
147 Ga0207664_10326299 3300025929 Unclassified 1355
148 Ga0207664_10368162 3300025929 Bacteria 1274
149 Ga0207664_10730119 3300025929 Bacteria 891
150 Ga0207690_10284656 3300025932 Unclassified 1288
151 Ga0207690_10424885 3300025932 Bacteria 1064
152 Ga0207665_10218895 3300025939 Bacteria 1394
153 Ga0207689_10574231 3300025942 Unclassified 948
154 Ga0207661_10063132 3300025944 Bacteria 2999
155 Ga0207661_10233618 3300025944 Bacteria 1629
156 Ga0207661_10242838 3300025944 Bacteria 1599
157 Ga0207661_10995943 3300025944 Unclassified 772
158 Ga0207667_10036089 3300025949 Bacteria 5301
159 Ga0207667_10222610 3300025949 Bacteria 1933
160 Ga0207651_10331846 3300025960 Bacteria 1275
161 Ga0207640_10976100 3300025981 Unclassified 744
162 Ga0207702_10102720 3300026078 Bacteria 2527
163 Ga0207702_10858702 3300026078 Bacteria 898
164 Ga0207674_10610711 3300026116 Bacteria 1053
165 Ga0207683_11362453 3300026121 Unclassified 656
166 Ga0265334_10350832 3300028573 Bacteria 504
167 Ga0265318_10020615 3300028577 Bacteria 2659
168 Ga0265318_10334712 3300028577 Unclassified 552
169 Ga0265323_10046624 3300028653 Unclassified 1553
170 Ga0265322_10152585 3300028654 Unclassified 660
171 Ga0265336_10039534 3300028666 Bacteria 1446
172 Ga0265338_10093817 3300028800 Bacteria 2471
173 Ga0265338_10162563 3300028800 Bacteria 1722
174 Ga0265338_10547801 3300028800 Bacteria 810
175 Ga0265330_10028883 3300031235 Bacteria 2496
176 Ga0265332_10157619 3300031238 Bacteria 949
177 Ga0265328_10089461 3300031239 Bacteria 1137
178 Ga0265320_10387782 3300031240 Unclassified 617
179 Ga0265325_10040367 3300031241 Unclassified 2451
180 Ga0265329_10026714 3300031242 Bacteria 1900
181 Ga0265339_10061960 3300031249 Bacteria 2012
182 Ga0265331_10103295 3300031250 Bacteria 1310
183 Ga0265327_10021309 3300031251 Bacteria 3914
184 Ga0265327_10070171 3300031251 Bacteria 1756
185 Ga0265316_10022315 3300031344 Bacteria 5339
186 Ga0265313_10023593 3300031595 Bacteria 3311
187 Ga0265314_10024769 3300031711 Bacteria 4541
188 Ga0265342_10108308 3300031712 Unclassified 1575
189 Ga0265342_10531261 3300031712 Bacteria 598
190 Ga0373943_0622880 3300035170 Unclassified 637
191 Ga0373943_0960004 3300035170 Bacteria 512
192 Ga0395899_0039939 3300037312 Bacteria 3510
193 Ga0395899_0135865 3300037312 Bacteria 1753
194 Ga0395899_0403375 3300037312 Bacteria 904
195 Ga0395900_0133834 3300037418 Bacteria 2539
196 Ga0395900_0699414 3300037418 Bacteria 947
197 Ga0395898_0008258 3300037466 Bacteria 11011
198 Ga0395898_0180255 3300037466 Bacteria 2019
199 Ga0395898_0527060 3300037466 Bacteria 1123
200 Ga0395898_0633886 3300037466 Unclassified 1011
201 Ga0395898_1636208 3300037466 Bacteria 568
202 Ga0395905_0073301 3300037471 Bacteria 3209
203 Ga0395905_0309792 3300037471 Bacteria 1467
204 Ga0395905_1145215 3300037471 Bacteria 681
205 Ga0395901_0023001 3300038443 Bacteria 6388
206 Ga0395901_0080909 3300038443 Bacteria 3393
207 Ga0395901_1005293 3300038443 Bacteria 810
208 Ga0395901_1187378 3300038443 Bacteria 729
209 Ga0451853_3932818 3300041512 Unclassified 673
210 Ga0439448_0034818 3300042005 Unclassified 1611
211 Ga0466965_0088911 3300044683 Bacteria 1569
212 Ga0466966_0227689 3300044684 Bacteria 1125
213 Ga0466966_0259590 3300044684 Bacteria 1046
214 Ga0466966_0269714 3300044684 Unclassified 1024
215 Ga0466961_0023024 3300044693 Bacteria 4007
216 Ga0466961_0078887 3300044693 Bacteria 2085
217 Ga0466963_0005340 3300044694 Bacteria 7514
218 Ga0466963_0123405 3300044694 Bacteria 1784
219 Ga0466963_0609711 3300044694 Bacteria 771
220 Ga0466964_0002445 3300044706 Bacteria 6606
221 Ga0466964_0004027 3300044706 Bacteria 5400
222 Ga0466964_0070438 3300044706 Bacteria 1477
223 Ga0466971_0000481 3300044719 Bacteria 15690
224 Ga0466971_0010227 3300044719 Bacteria 4098
225 Ga0466968_0036768 3300044735 Bacteria 2053
226 Ga0466968_0088490 3300044735 Bacteria 1369
227 Ga0466970_0329284 3300044765 Bacteria 864
228 Ga0466957_0004494 3300044842 Bacteria 7780
229 Ga0466957_1057762 3300044842 Bacteria 584
230 Ga0466960_0055177 3300044901 Bacteria 1932
231 Ga0466960_0305752 3300044901 Bacteria 897
232 Ga0466959_0005782 3300045049 Bacteria 8518
233 Ga0466959_0030826 3300045049 Bacteria 3971
234 Ga0466959_1166140 3300045049 Bacteria 512
235 Ga0466958_0024743 3300045836 Bacteria 3533
236 Ga0466958_0438396 3300045836 Bacteria 845
237 Ga0466967_0019309 3300045976 Bacteria 5476
238 Ga0466967_0019313 3300045976 Bacteria 5476
239 Ga0466967_0022591 3300045976 Bacteria 5136
240 Ga0466967_0023983 3300045976 Bacteria 5008
241 Ga0466967_0033888 3300045976 Bacteria 4328
242 Ga0466967_0037037 3300045976 Bacteria 4170
243 Ga0466967_0101864 3300045976 Bacteria 2625
244 Ga0466967_0136873 3300045976 Bacteria 2278
245 Ga0466967_0178937 3300045976 Bacteria 1999
246 Ga0466967_0587685 3300045976 Bacteria 1098
247 Ga0466967_1437974 3300045976 Bacteria 687
248 Ga0466967_2167439 3300045976 Bacteria 552
249 Ga0495603_0106410 3300046455 Bacteria 1637
250 Ga0495629_0160853 3300046459 Bacteria 1560
251 Ga0495629_0697546 3300046459 Bacteria 674
252 Ga0495651_0894314 3300046462 Unclassified 543
253 Ga0495580_0317046 3300046472 Bacteria 1060
254 Ga0495580_0918017 3300046472 Bacteria 562
255 Ga0495582_0174337 3300046473 Bacteria 1225
256 Ga0495582_0549321 3300046473 Unclassified 668
257 Ga0495594_0418711 3300046499 Unclassified 762
258 Ga0495594_0503304 3300046499 Bacteria 688
259 Ga0495630_0058055 3300046517 Bacteria 2901
260 Ga0495666_0269950 3300046526 Bacteria 772
261 Ga0495588_0354911 3300046674 Unclassified 770
262 Ga0495588_0736785 3300046674 Bacteria 515
263 Ga0495599_0070084 3300046678 Bacteria 2188
264 Ga0495599_0362307 3300046678 Bacteria 868
265 Ga0495647_0640539 3300046681 Bacteria 500
266 Ga0495658_0358354 3300046683 Bacteria 927
267 Ga0495658_0500762 3300046683 Unclassified 777
268 Ga0495675_0407494 3300047444 Unclassified 792
269 Ga0496100_0003965 3300048903 Bacteria 7780
270 Ga0496100_0028494 3300048903 Bacteria 3445
271 Ga0496100_0047427 3300048903 Bacteria 2768
272 Ga0496100_0737011 3300048903 Bacteria 770
273 Ga0496101_0006368 3300048904 Bacteria 7598
274 Ga0496101_0009340 3300048904 Bacteria 6444
275 Ga0496101_0039665 3300048904 Bacteria 3351
276 Ga0496101_1099749 3300048904 Bacteria 624
277 Ga0496102_0247858 3300048905 Unclassified 1679
278 Ga0496102_0250926 3300048905 Bacteria 1668
279 Ga0496103_0015122 3300048906 Bacteria 4588
280 Ga0496104_0011375 3300048907 Bacteria 7965
281 Ga0496104_0218480 3300048907 Bacteria 1818
282 Ga0496105_0008236 3300048908 Bacteria 8105
283 Ga0496105_0011786 3300048908 Bacteria 6921
284 Ga0496105_0413879 3300048908 Bacteria 1068
285 Ga0496105_0973627 3300048908 Bacteria 636
286 Ga0496106_0012373 3300048909 Bacteria 6299
287 Ga0496106_0308623 3300048909 Unclassified 1269
288 Ga0496107_0029154 3300048910 Bacteria 3925
289 Ga0496107_0030365 3300048910 Bacteria 3851
290 Ga0496107_0071394 3300048910 Bacteria 2523
291 Ga0496108_0057723 3300048911 Bacteria 3261
292 Ga0496109_0008365 3300048912 Bacteria 8791
293 Ga0496109_0362020 3300048912 Unclassified 1370
294 Ga0496110_0002690 3300048913 Bacteria 13429
295 Ga0496110_0029862 3300048913 Bacteria 4697
296 Ga0496111_0030940 3300048914 Bacteria 3809
297 Ga0496111_0066949 3300048914 Bacteria 2609
298 Ga0496112_0181585 3300048915 Bacteria 2068
299 Ga0496112_1246568 3300048915 Bacteria 660
300 Ga0496113_0048875 3300048916 Bacteria 3148
301 Ga0496113_0147593 3300048916 Bacteria 1854
302 Ga0496114_0002086 3300048917 Bacteria 15206
303 Ga0496114_0060948 3300048917 Bacteria 3154
304 Ga0496114_0123573 3300048917 Bacteria 2228
305 Ga0496114_0158817 3300048917 Bacteria 1964
306 Ga0496115_0001353 3300048918 Bacteria 17501
307 Ga0496115_0004453 3300048918 Bacteria 10154
308 Ga0496115_0626336 3300048918 Bacteria 853
309 Ga0501040_0186201 3300049576 Bacteria 1472
310 Ga0501043_0401860 3300049579 Unclassified 1035
311 Ga0501067_0060725 3300049583 Bacteria 2092
312 Ga0501067_0551346 3300049583 Unclassified 646
313 Ga0501069_0293118 3300049585 Bacteria 953
314 Ga0501071_1380038 3300049587 Bacteria 544
315 Ga0501074_0123116 3300049590 Bacteria 1855
316 Ga0501076_0362166 3300049592 Bacteria 1191
317 Ga0501080_1007666 3300049742 Bacteria 722
318 Ga0501081_0007025 3300049743 Bacteria 7320
319 nmdc:mga05p37_1208791_c1 3300050507 Unclassified 780
320 nmdc:mga0n895_24043_c1 3300050512 Bacteria 5736
321 nmdc:mga0rr50_84938_c1 3300050513 Bacteria 2452
322 nmdc:mga08x19_33379_c1 3300050514 Bacteria 3248
323 nmdc:mga0a205_178375_c1 3300050515 Bacteria 2019
324 Ga0495619_0093014 3300053085 Bacteria 2043
325 Ga0495619_1067618 3300053085 Unclassified 538
326 Ga0501084_0036017 3300054114 Bacteria 4135
327 Ga0501082_0074946 3300060353 Bacteria 2915
328 Ga0466962_0004258 3300061719 Bacteria 6854
329 Ga0466962_0094842 3300061719 Bacteria 1430
330 Ga0530510_0486487 3300061734 Bacteria 935
331 Ga0530510_1092530 3300061734 Bacteria 611
332 Ga0501036_0363540
333 Ga0070658_10064963
334 Ga0070683_100007115
335 Ga0070683_100597002
336 Ga0070683_101551573
337 Ga0070680_100107680
338 Ga0070680_100127148
339 Ga0070680_100586305
340 Ga0070682_100671525
341 Ga0070660_100000651
342 Ga0070660_100370460
343 Ga0070660_100516109
344 Ga0070660_100722842
345 Ga0070691_11049348
346 Ga0070661_100019453
347 Ga0070661_100446898
348 Ga0070661_100795785
349 Ga0070673_100358227
350 Ga0070659_100056786
351 Ga0070709_10630816
352 Ga0070709_11785266
353 Ga0070714_100136588
354 Ga0070714_100419575
355 Ga0070714_101342496
356 Ga0070713_100116822
357 Ga0070713_100559134
358 Ga0070710_10046163
359 Ga0070711_100033103
360 Ga0070711_100653317
361 Ga0070681_10000870
362 Ga0070681_10051627
363 Ga0070681_10116500
364 Ga0070681_10237923
365 Ga0070681_10240848
366 Ga0070699_102203227
367 Ga0070679_100007208
368 Ga0070679_100096359
369 Ga0070679_100113142
370 Ga0070679_100745784
371 Ga0070679_101082989
372 Ga0070684_100009888
373 Ga0070684_100890578
374 Ga0068853_100358659
375 Ga0070672_101301316
376 Ga0070696_100103707
377 Ga0068855_100007053
378 Ga0068855_100105167
379 Ga0068855_100597373
380 Ga0068857_100256159
381 Ga0068854_102247513
382 Ga0068856_100220518
383 Ga0068856_102502593
384 Ga0068852_100374508
385 Ga0068852_100563082
386 Ga0068852_102328413
387 Ga0068863_102536513
388 Ga0070717_10117706
389 Ga0070717_10225935
390 Ga0070717_10374697
391 Ga0070717_10993963
392 Ga0070716_101070426
393 Ga0070716_101561733
394 Ga0070712_100014628
395 Ga0070712_101415562
396 Ga0097621_100132323
397 Ga0097621_100148039
398 Ga0068871_100160124
399 Ga0075433_10163653
400 Ga0075434_100012841
401 Ga0075436_100035197
402 Ga0075435_100003270
403 Ga0105240_10011152
404 Ga0105240_10159394
405 Ga0105240_10584530
406 Ga0105240_12221050
407 Ga0105245_10882980
408 Ga0105245_11172069
409 Ga0105245_12676953
410 Ga0114129_11311676
411 Ga0105241_10334871
412 Ga0105237_10011065
413 Ga0105238_10040039
414 Ga0105238_10507223
415 Ga0105239_11308620
416 Ga0157373_10125949
417 Ga0157370_10010042
418 Ga0157370_10114781
419 Ga0157369_10048688
420 Ga0157369_10514801
421 Ga0157369_11179576
422 Ga0157369_12497168
423 Ga0157374_12218168
424 Ga0157372_10015402
425 Ga0157372_11059844
426 Ga0157372_12688480
427 Ga0157375_10058838
428 Ga0157375_11281526
429 Ga0182008_10215689
430 Ga0157376_10463410
431 Ga0182006_1325236
432 Ga0206356_10032574
433 Ga0206356_10076663
434 Ga0206356_10457910
435 Ga0206356_11398518
436 Ga0206354_10141892
437 Ga0206354_10414339
438 Ga0206354_10561604
439 Ga0206354_11381065
440 Ga0206353_10221864
441 Ga0206353_10301567
442 Ga0206353_10522647
443 Ga0206353_10921223
444 Ga0207699_10338236
445 Ga0207699_10552345
446 Ga0207699_10836744
447 Ga0207705_10196558
448 Ga0207707_10018863
449 Ga0207707_10496364
450 Ga0207695_10171104
451 Ga0207695_10205502
452 Ga0207695_10423469
453 Ga0207671_11544415
454 Ga0207693_10131069
455 Ga0207693_10196681
456 Ga0207663_11502649
457 Ga0207660_10011061
458 Ga0207660_10028521
459 Ga0207660_10166588
460 Ga0207657_10002974
461 Ga0207657_10008819
462 Ga0207657_10094573
463 Ga0207657_10414549
464 Ga0207649_10033137
465 Ga0207649_10175620
466 Ga0207649_10334068
467 Ga0207649_11419593
468 Ga0207649_11684509
469 Ga0207652_10021222
470 Ga0207652_10302901
471 Ga0207652_10371392
472 Ga0207652_11088330
473 Ga0207694_11485958
474 Ga0207694_11643280
475 Ga0207687_11097978
476 Ga0207700_10116619
477 Ga0207700_10386452
478 Ga0207664_10326299
479 Ga0207664_10368162
480 Ga0207664_10730119
481 Ga0207690_10284656
482 Ga0207690_10424885
483 Ga0207665_10218895
484 Ga0207689_10574231
485 Ga0207661_10063132
486 Ga0207661_10233618
487 Ga0207661_10242838
488 Ga0207661_10995943
489 Ga0207667_10036089
490 Ga0207667_10222610
491 Ga0207651_10331846
492 Ga0207640_10976100
493 Ga0207702_10102720
494 Ga0207702_10858702
495 Ga0207674_10610711
496 Ga0207683_11362453
497 Ga0265334_10350832
498 Ga0265318_10020615
499 Ga0265318_10334712
500 Ga0265323_10046624
501 Ga0265322_10152585
502 Ga0265336_10039534
503 Ga0265338_10093817
504 Ga0265338_10162563
505 Ga0265338_10547801
506 Ga0265330_10028883
507 Ga0265332_10157619
508 Ga0265328_10089461
509 Ga0265320_10387782
510 Ga0265325_10040367
511 Ga0265329_10026714
512 Ga0265339_10061960
513 Ga0265331_10103295
514 Ga0265327_10021309
515 Ga0265327_10070171
516 Ga0265316_10022315
517 Ga0265313_10023593
518 Ga0265314_10024769
519 Ga0265342_10108308
520 Ga0265342_10531261
521 Ga0373943_0622880
522 Ga0373943_0960004
523 Ga0395899_0039939
524 Ga0395899_0135865
525 Ga0395899_0403375
526 Ga0395900_0133834
527 Ga0395900_0699414
528 Ga0395898_0008258
529 Ga0395898_0180255
530 Ga0395898_0527060
531 Ga0395898_0633886
532 Ga0395898_1636208
533 Ga0395905_0073301
534 Ga0395905_0309792
535 Ga0395905_1145215
536 Ga0395901_0023001
537 Ga0395901_0080909
538 Ga0395901_1005293
539 Ga0395901_1187378
540 Ga0451853_3932818
541 Ga0439448_0034818
542 Ga0466965_0088911
543 Ga0466966_0227689
544 Ga0466966_0259590
545 Ga0466966_0269714
546 Ga0466961_0023024
547 Ga0466961_0078887
548 Ga0466963_0005340
549 Ga0466963_0123405
550 Ga0466963_0609711
551 Ga0466964_0002445
552 Ga0466964_0004027
553 Ga0466964_0070438
554 Ga0466971_0000481
555 Ga0466971_0010227
556 Ga0466968_0036768
557 Ga0466968_0088490
558 Ga0466970_0329284
559 Ga0466957_0004494
560 Ga0466957_1057762
561 Ga0466960_0055177
562 Ga0466960_0305752
563 Ga0466959_0005782
564 Ga0466959_0030826
565 Ga0466959_1166140
566 Ga0466958_0024743
567 Ga0466958_0438396
568 Ga0466967_0019309
569 Ga0466967_0019313
570 Ga0466967_0022591
571 Ga0466967_0023983
572 Ga0466967_0033888
573 Ga0466967_0037037
574 Ga0466967_0101864
575 Ga0466967_0136873
576 Ga0466967_0178937
577 Ga0466967_0587685
578 Ga0466967_1437974
579 Ga0466967_2167439
580 Ga0495603_0106410
581 Ga0495629_0160853
582 Ga0495629_0697546
583 Ga0495651_0894314
584 Ga0495580_0317046
585 Ga0495580_0918017
586 Ga0495582_0174337
587 Ga0495582_0549321
588 Ga0495594_0418711
589 Ga0495594_0503304
590 Ga0495630_0058055
591 Ga0495666_0269950
592 Ga0495588_0354911
593 Ga0495588_0736785
594 Ga0495599_0070084
595 Ga0495599_0362307
596 Ga0495647_0640539
597 Ga0495658_0358354
598 Ga0495658_0500762
599 Ga0495675_0407494
600 Ga0496100_0003965
601 Ga0496100_0028494
602 Ga0496100_0047427
603 Ga0496100_0737011
604 Ga0496101_0006368
605 Ga0496101_0009340
606 Ga0496101_0039665
607 Ga0496101_1099749
608 Ga0496102_0247858
609 Ga0496102_0250926
610 Ga0496103_0015122
611 Ga0496104_0011375
612 Ga0496104_0218480
613 Ga0496105_0008236
614 Ga0496105_0011786
615 Ga0496105_0413879
616 Ga0496105_0973627
617 Ga0496106_0012373
618 Ga0496106_0308623
619 Ga0496107_0029154
620 Ga0496107_0030365
621 Ga0496107_0071394
622 Ga0496108_0057723
623 Ga0496109_0008365
624 Ga0496109_0362020
625 Ga0496110_0002690
626 Ga0496110_0029862
627 Ga0496111_0030940
628 Ga0496111_0066949
629 Ga0496112_0181585
630 Ga0496112_1246568
631 Ga0496113_0048875
632 Ga0496113_0147593
633 Ga0496114_0002086
634 Ga0496114_0060948
635 Ga0496114_0123573
636 Ga0496114_0158817
637 Ga0496115_0001353
638 Ga0496115_0004453
639 Ga0496115_0626336
640 Ga0501040_0186201
641 Ga0501043_0401860
642 Ga0501067_0060725
643 Ga0501067_0551346
644 Ga0501069_0293118
645 Ga0501071_1380038
646 Ga0501074_0123116
647 Ga0501076_0362166
648 Ga0501080_1007666
649 Ga0501081_0007025
650 nmdc:mga05p37_1208791_c1
651 nmdc:mga0n895_24043_c1
652 nmdc:mga0rr50_84938_c1
653 nmdc:mga08x19_33379_c1
654 nmdc:mga0a205_178375_c1
655 Ga0495619_0093014
656 Ga0495619_1067618
657 Ga0501084_0036017
658 Ga0501082_0074946
659 Ga0466962_0004258
660 Ga0466962_0094842
661 Ga0530510_0486487
662 Ga0530510_1092530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map