F410648
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 331 | 193 | 329 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300046524|Ga0495648_0000533|Ga0495648_0000533_20647_21315 |
| Length | 222 |
| Sequence | VTCNATASGLTALVFHGGDCSHSTDSLGKNVDHQYLMLEKVMNVVPTDLPGVLILEPKVFGDERGFFYESFNARAFEQATGLTTQFVQDNHSRSQKGVLRGLHYQLENTQGKLVRVTAGEVLDVAVDIRRSSPHFGKWAAVRLSADNHRQLWVPEGFAHGFVVLSEFAEFLYKTTDYYTPAAERSIRWDDPDLAIDWQMDQAPRLSAKDEAASFLKDAEVFP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 3 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 16 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 18 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 19 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 20 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 21 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 22 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 23 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 35 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 36 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 37 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 38 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 40 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 65 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 66 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 67 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 68 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 69 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 70 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 71 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 72 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 73 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 74 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 75 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 76 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 77 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 78 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 79 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 80 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 81 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 82 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 83 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 84 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 85 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 86 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 87 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 88 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 89 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 90 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 91 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 92 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 93 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 94 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 95 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 96 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 97 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 98 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 99 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 100 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 101 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 102 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 103 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 104 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 105 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 106 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 107 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 108 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 109 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 110 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 111 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 112 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 113 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 114 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 115 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 174 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 175 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 176 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 177 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 178 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 181 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 182 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 183 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 184 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 185 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 186 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 187 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 190 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 191 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 192 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 193 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0 |
| Isolates | 0.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.53 |
| Nodule | 0.3 |
| Rhizoplane | 1.21 |
| Rhizosphere | 84.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_8525056 | 2162886011 | Bacteria | 2022 |
| 2 | JGI24741J21665_1004783 | 3300001915 | Bacteria | 2940 |
| 3 | Ga0055536_1000855 | 3300003781 | Bacteria | 19989 |
| 4 | Ga0055530_10001036 | 3300003791 | Bacteria | 22153 |
| 5 | Ga0055540_1000064 | 3300003792 | Bacteria | 127318 |
| 6 | Ga0055531_10000039 | 3300003794 | Bacteria | 141103 |
| 7 | Ga0065714_10000193 | 3300005288 | Bacteria | 8109 |
| 8 | Ga0065714_10032763 | 3300005288 | Bacteria | 933 |
| 9 | Ga0065714_10045568 | 3300005288 | Bacteria | 770 |
| 10 | Ga0065714_10080104 | 3300005288 | Bacteria | 2437 |
| 11 | Ga0065714_10290330 | 3300005288 | Bacteria | 709 |
| 12 | Ga0065704_10021238 | 3300005289 | Bacteria | 1276 |
| 13 | Ga0065712_10067962 | 3300005290 | Bacteria | 18983 |
| 14 | Ga0070670_100001383 | 3300005331 | Bacteria | 19441 |
| 15 | Ga0070669_100000090 | 3300005353 | Bacteria | 88133 |
| 16 | Ga0070662_100007352 | 3300005457 | Bacteria | 7136 |
| 17 | Ga0068853_100000218 | 3300005539 | Bacteria | 40498 |
| 18 | Ga0070664_100027302 | 3300005564 | Bacteria | 4743 |
| 19 | Ga0068854_100018615 | 3300005578 | Bacteria | 4666 |
| 20 | Ga0068851_10000118 | 3300005834 | Bacteria | 42408 |
| 21 | Ga0075432_10002925 | 3300006058 | Bacteria | 5746 |
| 22 | Ga0075432_10013157 | 3300006058 | Bacteria | 2811 |
| 23 | Ga0075432_10014017 | 3300006058 | Bacteria | 2729 |
| 24 | Ga0075366_10000239 | 3300006195 | Bacteria | 24396 |
| 25 | Ga0075366_10114300 | 3300006195 | Bacteria | 1625 |
| 26 | Ga0075436_100015194 | 3300006914 | Bacteria | 5275 |
| 27 | Ga0079104_1033648 | 3300006946 | Bacteria | 1252 |
| 28 | Ga0105251_10000009 | 3300009011 | Bacteria | 192384 |
| 29 | Ga0105251_10000423 | 3300009011 | Bacteria | 41081 |
| 30 | Ga0105251_10017015 | 3300009011 | Bacteria | 3907 |
| 31 | Ga0105244_10000110 | 3300009036 | Bacteria | 85793 |
| 32 | Ga0105244_10003730 | 3300009036 | Bacteria | 10750 |
| 33 | Ga0105244_10168605 | 3300009036 | Bacteria | 1043 |
| 34 | Ga0105244_10265740 | 3300009036 | Bacteria | 798 |
| 35 | Ga0105250_10000107 | 3300009092 | Bacteria | 75197 |
| 36 | Ga0105250_10013528 | 3300009092 | Bacteria | 3362 |
| 37 | Ga0105250_10022697 | 3300009092 | Bacteria | 2529 |
| 38 | Ga0105250_10030102 | 3300009092 | Bacteria | 2183 |
| 39 | Ga0105243_10005026 | 3300009148 | Bacteria | 10372 |
| 40 | Ga0105243_10039741 | 3300009148 | Bacteria | 3670 |
| 41 | Ga0105243_10040122 | 3300009148 | Bacteria | 3654 |
| 42 | Ga0105237_10009591 | 3300009545 | Bacteria | 10366 |
| 43 | Ga0105246_10009506 | 3300011119 | Bacteria | 5989 |
| 44 | Ga0105246_10021307 | 3300011119 | Bacteria | 4169 |
| 45 | Ga0157373_10019869 | 3300013100 | Bacteria | 4887 |
| 46 | Ga0157373_10027148 | 3300013100 | Bacteria | 4131 |
| 47 | Ga0157373_10090681 | 3300013100 | Bacteria | 2153 |
| 48 | Ga0157373_10275456 | 3300013100 | Bacteria | 1192 |
| 49 | Ga0157371_10008494 | 3300013102 | Bacteria | 8174 |
| 50 | Ga0157371_10442774 | 3300013102 | Bacteria | 954 |
| 51 | Ga0157370_10060291 | 3300013104 | Bacteria | 3603 |
| 52 | Ga0157370_10159051 | 3300013104 | Bacteria | 2102 |
| 53 | Ga0157370_10432630 | 3300013104 | Bacteria | 1210 |
| 54 | Ga0157370_10569212 | 3300013104 | Bacteria | 1038 |
| 55 | Ga0157370_10721852 | 3300013104 | Bacteria | 909 |
| 56 | Ga0157369_10036306 | 3300013105 | Bacteria | 5400 |
| 57 | Ga0157369_10647321 | 3300013105 | Bacteria | 1090 |
| 58 | Ga0163162_10401095 | 3300013306 | Bacteria | 1504 |
| 59 | Ga0182008_10002273 | 3300014497 | Bacteria | 12125 |
| 60 | Ga0182008_10214267 | 3300014497 | Bacteria | 984 |
| 61 | Ga0182006_1014804 | 3300015261 | Bacteria | 3356 |
| 62 | Ga0182007_10102366 | 3300015262 | Bacteria | 949 |
| 63 | Ga0182005_1005744 | 3300015265 | Bacteria | 3850 |
| 64 | Ga0182005_1075029 | 3300015265 | Bacteria | 931 |
| 65 | Ga0163161_10002513 | 3300017792 | Bacteria | 13087 |
| 66 | Ga0163161_10008499 | 3300017792 | Bacteria | 7110 |
| 67 | Ga0209675_1008637 | 3300025291 | Bacteria | 3710 |
| 68 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 69 | Ga0209050_1000099 | 3300025298 | Bacteria | 232176 |
| 70 | Ga0209051_1000026 | 3300025303 | Bacteria | 413311 |
| 71 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 72 | Ga0207656_10000008 | 3300025321 | Bacteria | 275365 |
| 73 | Ga0207696_1000020 | 3300025711 | Bacteria | 434998 |
| 74 | Ga0207696_1002256 | 3300025711 | Bacteria | 9594 |
| 75 | Ga0207696_1018956 | 3300025711 | Bacteria | 2250 |
| 76 | Ga0207696_1037790 | 3300025711 | Bacteria | 1428 |
| 77 | Ga0207655_1000310 | 3300025728 | Bacteria | 72872 |
| 78 | Ga0207655_1000453 | 3300025728 | Bacteria | 53763 |
| 79 | Ga0207655_1012873 | 3300025728 | Bacteria | 4846 |
| 80 | Ga0207713_1000032 | 3300025735 | Bacteria | 276465 |
| 81 | Ga0207713_1000225 | 3300025735 | Bacteria | 76469 |
| 82 | Ga0207713_1004147 | 3300025735 | Bacteria | 9524 |
| 83 | Ga0207713_1014684 | 3300025735 | Bacteria | 4053 |
| 84 | Ga0207713_1054260 | 3300025735 | Bacteria | 1573 |
| 85 | Ga0207671_10040515 | 3300025914 | Bacteria | 3448 |
| 86 | Ga0207681_10000048 | 3300025923 | Bacteria | 120755 |
| 87 | Ga0207681_10000267 | 3300025923 | Bacteria | 39591 |
| 88 | Ga0207650_10001072 | 3300025925 | Bacteria | 20331 |
| 89 | Ga0207706_10000374 | 3300025933 | Bacteria | 48637 |
| 90 | Ga0207709_10000040 | 3300025935 | Bacteria | 259497 |
| 91 | Ga0207709_10008336 | 3300025935 | Bacteria | 5738 |
| 92 | Ga0207679_10037604 | 3300025945 | Bacteria | 3442 |
| 93 | Ga0207639_10000392 | 3300026041 | Bacteria | 30199 |
| 94 | Ga0209969_1034154 | 3300027360 | Bacteria | 782 |
| 95 | Ga0209996_1000469 | 3300027395 | Bacteria | 4847 |
| 96 | Ga0209995_1001898 | 3300027471 | Bacteria | 3272 |
| 97 | Ga0209968_1007645 | 3300027526 | Bacteria | 1637 |
| 98 | Ga0209999_1002473 | 3300027543 | Bacteria | 3260 |
| 99 | Ga0210002_1027393 | 3300027617 | Bacteria | 938 |
| 100 | Ga0209983_1004755 | 3300027665 | Bacteria | 2837 |
| 101 | Ga0209971_1000485 | 3300027682 | Bacteria | 10524 |
| 102 | Ga0209974_10011289 | 3300027876 | Bacteria | 3004 |
| 103 | Ga0207428_10190792 | 3300027907 | Bacteria | 1545 |
| 104 | Ga0207428_10242571 | 3300027907 | Bacteria | 1346 |
| 105 | Ga0307511_10045857 | 3300030521 | Bacteria | 3606 |
| 106 | Ga0314311_1262426 | 3300030733 | Bacteria | 9362 |
| 107 | Ga0316183_1211848 | 3300030742 | Bacteria | 3254 |
| 108 | Ga0265331_10192145 | 3300031250 | Bacteria | 921 |
| 109 | Ga0307408_100005361 | 3300031548 | Bacteria | 8591 |
| 110 | Ga0307408_100730587 | 3300031548 | Bacteria | 892 |
| 111 | Ga0307408_100755265 | 3300031548 | Bacteria | 879 |
| 112 | Ga0307516_10532119 | 3300031730 | Bacteria | 829 |
| 113 | Ga0307405_10000725 | 3300031731 | Bacteria | 12841 |
| 114 | Ga0307405_10000811 | 3300031731 | Bacteria | 12271 |
| 115 | Ga0307413_10015240 | 3300031824 | Bacteria | 3933 |
| 116 | Ga0307413_10611503 | 3300031824 | Bacteria | 893 |
| 117 | Ga0307406_10005461 | 3300031901 | Bacteria | 6957 |
| 118 | Ga0307407_10048245 | 3300031903 | Bacteria | 2422 |
| 119 | Ga0307407_10138151 | 3300031903 | Bacteria | 1568 |
| 120 | Ga0307412_10000424 | 3300031911 | Bacteria | 25641 |
| 121 | Ga0307412_10040586 | 3300031911 | Bacteria | 3011 |
| 122 | Ga0307409_100602962 | 3300031995 | Bacteria | 1085 |
| 123 | Ga0307416_100047922 | 3300032002 | Bacteria | 3386 |
| 124 | Ga0307414_10023636 | 3300032004 | Bacteria | 3902 |
| 125 | Ga0373943_0269102 | 3300035170 | Bacteria | 961 |
| 126 | Ga0373927_0045856 | 3300035695 | Bacteria | 2828 |
| 127 | Ga0373925_0074355 | 3300037068 | Bacteria | 2574 |
| 128 | Ga0237819_07788 | 3300038705 | Bacteria | 1515 |
| 129 | Ga0400483_219793 | 3300039062 | Bacteria | 37446 |
| 130 | Ga0439436_0108509 | 3300041404 | Bacteria | 774 |
| 131 | Ga0439438_000416 | 3300041405 | Bacteria | 19201 |
| 132 | Ga0439438_008668 | 3300041405 | Bacteria | 3350 |
| 133 | Ga0439447_010317 | 3300041407 | Bacteria | 2777 |
| 134 | Ga0439447_011863 | 3300041407 | Bacteria | 2524 |
| 135 | Ga0439447_022330 | 3300041407 | Bacteria | 1658 |
| 136 | Ga0439447_029691 | 3300041407 | Bacteria | 1382 |
| 137 | Ga0439466_0004770 | 3300041411 | Bacteria | 5211 |
| 138 | Ga0439466_0007514 | 3300041411 | Bacteria | 4121 |
| 139 | Ga0439466_0021637 | 3300041411 | Bacteria | 2275 |
| 140 | Ga0439466_0035919 | 3300041411 | Bacteria | 1675 |
| 141 | Ga0439466_0041030 | 3300041411 | Bacteria | 1545 |
| 142 | Ga0439465_0002232 | 3300041413 | Bacteria | 6355 |
| 143 | Ga0439445_0006461 | 3300042004 | Bacteria | 2696 |
| 144 | Ga0439432_006121 | 3300042006 | Bacteria | 4308 |
| 145 | Ga0439432_019258 | 3300042006 | Bacteria | 2275 |
| 146 | Ga0439451_005286 | 3300042009 | Bacteria | 2629 |
| 147 | Ga0439451_026586 | 3300042009 | Bacteria | 1166 |
| 148 | Ga0439451_030119 | 3300042009 | Bacteria | 1091 |
| 149 | Ga0439451_056793 | 3300042009 | Bacteria | 783 |
| 150 | Ga0439452_002846 | 3300042010 | Bacteria | 6239 |
| 151 | Ga0439452_006619 | 3300042010 | Bacteria | 3618 |
| 152 | Ga0439452_006849 | 3300042010 | Bacteria | 3537 |
| 153 | Ga0439452_032970 | 3300042010 | Bacteria | 1260 |
| 154 | Ga0439456_003504 | 3300042013 | Bacteria | 3183 |
| 155 | Ga0439456_016742 | 3300042013 | Bacteria | 1533 |
| 156 | Ga0439456_066640 | 3300042013 | Bacteria | 795 |
| 157 | Ga0439463_000136 | 3300042016 | Bacteria | 18554 |
| 158 | Ga0450911_001020 | 3300042115 | Bacteria | 7134 |
| 159 | Ga0450922_001017 | 3300042124 | Bacteria | 2814 |
| 160 | Ga0450923_013260 | 3300042125 | Bacteria | 1513 |
| 161 | Ga0450890_000142 | 3300042127 | Bacteria | 11148 |
| 162 | Ga0450902_024102 | 3300042137 | Bacteria | 1012 |
| 163 | Ga0450903_023834 | 3300042138 | Bacteria | 940 |
| 164 | Ga0450904_003084 | 3300042139 | Bacteria | 1848 |
| 165 | Ga0450889_001105 | 3300042144 | Bacteria | 2827 |
| 166 | Ga0450907_001964 | 3300042146 | Bacteria | 4146 |
| 167 | Ga0450910_000099 | 3300042147 | Bacteria | 8865 |
| 168 | Ga0450910_031953 | 3300042147 | Bacteria | 829 |
| 169 | Ga0439446_0000812 | 3300042156 | Bacteria | 6649 |
| 170 | Ga0439446_0000865 | 3300042156 | Bacteria | 6493 |
| 171 | Ga0439446_0045722 | 3300042156 | Bacteria | 1298 |
| 172 | Ga0450908_000147 | 3300042184 | Bacteria | 14590 |
| 173 | Ga0450908_015554 | 3300042184 | Bacteria | 1362 |
| 174 | Ga0450908_028822 | 3300042184 | Bacteria | 966 |
| 175 | Ga0450909_051059 | 3300042185 | Bacteria | 645 |
| 176 | Ga0439434_0002018 | 3300042435 | Bacteria | 5866 |
| 177 | Ga0439434_0003912 | 3300042435 | Bacteria | 4347 |
| 178 | Ga0439464_0028182 | 3300042439 | Bacteria | 1565 |
| 179 | Ga0439460_0002283 | 3300042461 | Bacteria | 4615 |
| 180 | Ga0439460_0022495 | 3300042461 | Bacteria | 1729 |
| 181 | Ga0450893_0000829 | 3300042532 | Bacteria | 4561 |
| 182 | Ga0466963_0012961 | 3300044694 | Bacteria | 5110 |
| 183 | Ga0451576_0000053 | 3300045051 | Bacteria | 308708 |
| 184 | Ga0451576_0003050 | 3300045051 | Bacteria | 23589 |
| 185 | Ga0466958_0080341 | 3300045836 | Bacteria | 2006 |
| 186 | Ga0495617_013518 | 3300046452 | Bacteria | 2779 |
| 187 | Ga0495617_077789 | 3300046452 | Bacteria | 1088 |
| 188 | Ga0495627_000404 | 3300046453 | Bacteria | 38087 |
| 189 | Ga0495603_0004532 | 3300046455 | Bacteria | 8292 |
| 190 | Ga0495590_0001930 | 3300046457 | Bacteria | 8762 |
| 191 | Ga0495653_0190746 | 3300046463 | Bacteria | 1398 |
| 192 | Ga0495650_0006679 | 3300046471 | Bacteria | 7144 |
| 193 | Ga0495650_0107378 | 3300046471 | Bacteria | 1040 |
| 194 | Ga0495605_0057939 | 3300046474 | Bacteria | 1863 |
| 195 | Ga0495605_0099791 | 3300046474 | Bacteria | 1336 |
| 196 | Ga0495639_0061019 | 3300046475 | Bacteria | 1728 |
| 197 | Ga0495584_0002240 | 3300046491 | Bacteria | 11036 |
| 198 | Ga0495584_0149767 | 3300046491 | Bacteria | 1185 |
| 199 | Ga0495584_0240017 | 3300046491 | Bacteria | 921 |
| 200 | Ga0495585_0042029 | 3300046492 | Bacteria | 2562 |
| 201 | Ga0495607_0000050 | 3300046501 | Bacteria | 120052 |
| 202 | Ga0495607_0000392 | 3300046501 | Bacteria | 44546 |
| 203 | Ga0495607_0015842 | 3300046501 | Bacteria | 4875 |
| 204 | Ga0495607_0103822 | 3300046501 | Bacteria | 1518 |
| 205 | Ga0495583_0001901 | 3300046506 | Bacteria | 19343 |
| 206 | Ga0495583_0148941 | 3300046506 | Bacteria | 971 |
| 207 | Ga0495606_0267217 | 3300046507 | Bacteria | 941 |
| 208 | Ga0495610_0095060 | 3300046512 | Bacteria | 1344 |
| 209 | Ga0495620_0002007 | 3300046515 | Bacteria | 11879 |
| 210 | Ga0495620_0101053 | 3300046515 | Bacteria | 1149 |
| 211 | Ga0495631_0000166 | 3300046518 | Bacteria | 45256 |
| 212 | Ga0495632_0000532 | 3300046519 | Bacteria | 35904 |
| 213 | Ga0495632_0066113 | 3300046519 | Bacteria | 1745 |
| 214 | Ga0495632_0088868 | 3300046519 | Bacteria | 1467 |
| 215 | Ga0495637_0023056 | 3300046520 | Bacteria | 2833 |
| 216 | Ga0495637_0024798 | 3300046520 | Bacteria | 2711 |
| 217 | Ga0495643_0000275 | 3300046522 | Bacteria | 73599 |
| 218 | Ga0495643_0002468 | 3300046522 | Bacteria | 14625 |
| 219 | Ga0495643_0013879 | 3300046522 | Bacteria | 4805 |
| 220 | Ga0495648_0000533 | 3300046524 | Bacteria | 40990 |
| 221 | Ga0495648_0003581 | 3300046524 | Bacteria | 13593 |
| 222 | Ga0495648_0011192 | 3300046524 | Bacteria | 6776 |
| 223 | Ga0495648_0013605 | 3300046524 | Bacteria | 6003 |
| 224 | Ga0495666_0231145 | 3300046526 | Bacteria | 845 |
| 225 | Ga0495642_0000609 | 3300046528 | Bacteria | 18005 |
| 226 | Ga0495652_0304065 | 3300046529 | Bacteria | 1158 |
| 227 | Ga0495654_0005823 | 3300046530 | Bacteria | 7100 |
| 228 | Ga0495654_0006537 | 3300046530 | Bacteria | 6609 |
| 229 | Ga0495654_0039508 | 3300046530 | Bacteria | 2355 |
| 230 | Ga0495654_0055966 | 3300046530 | Bacteria | 1908 |
| 231 | Ga0495654_0099307 | 3300046530 | Bacteria | 1342 |
| 232 | Ga0495654_0158800 | 3300046530 | Bacteria | 994 |
| 233 | Ga0495586_0001759 | 3300046535 | Bacteria | 11831 |
| 234 | Ga0495587_0010981 | 3300046536 | Bacteria | 5744 |
| 235 | Ga0495609_0002121 | 3300046538 | Bacteria | 12465 |
| 236 | Ga0495609_0015416 | 3300046538 | Bacteria | 3576 |
| 237 | Ga0495609_0026290 | 3300046538 | Bacteria | 2665 |
| 238 | Ga0495597_0007602 | 3300046542 | Bacteria | 5484 |
| 239 | Ga0495597_0050064 | 3300046542 | Bacteria | 1845 |
| 240 | Ga0495645_0103669 | 3300046543 | Bacteria | 2021 |
| 241 | Ga0495633_0001098 | 3300046558 | Bacteria | 21834 |
| 242 | Ga0495633_0129780 | 3300046558 | Bacteria | 1166 |
| 243 | Ga0495633_0176077 | 3300046558 | Bacteria | 985 |
| 244 | Ga0495634_0001907 | 3300046642 | Bacteria | 17869 |
| 245 | Ga0495625_0050714 | 3300046660 | Bacteria | 2977 |
| 246 | Ga0495625_0055452 | 3300046660 | Bacteria | 2826 |
| 247 | Ga0495635_0000980 | 3300046663 | Bacteria | 18809 |
| 248 | Ga0495635_0003024 | 3300046663 | Bacteria | 11554 |
| 249 | Ga0495661_0000036 | 3300046665 | Bacteria | 164694 |
| 250 | Ga0495661_0065126 | 3300046665 | Bacteria | 2148 |
| 251 | Ga0495661_0219601 | 3300046665 | Bacteria | 985 |
| 252 | Ga0495623_0044048 | 3300046679 | Bacteria | 2837 |
| 253 | Ga0495646_0070608 | 3300046680 | Bacteria | 2056 |
| 254 | Ga0495624_0552305 | 3300046690 | Bacteria | 688 |
| 255 | Ga0495670_0216787 | 3300046691 | Bacteria | 1016 |
| 256 | Ga0495671_0007315 | 3300046692 | Bacteria | 6303 |
| 257 | Ga0495671_0019071 | 3300046692 | Bacteria | 3631 |
| 258 | Ga0495671_0021532 | 3300046692 | Bacteria | 3384 |
| 259 | Ga0495671_0052969 | 3300046692 | Bacteria | 2015 |
| 260 | Ga0495649_0000264 | 3300046694 | Bacteria | 46725 |
| 261 | Ga0495649_0091910 | 3300046694 | Bacteria | 1616 |
| 262 | Ga0495649_0157313 | 3300046694 | Bacteria | 1192 |
| 263 | Ga0495589_0014845 | 3300046794 | Bacteria | 4007 |
| 264 | Ga0495660_0013823 | 3300046810 | Bacteria | 4679 |
| 265 | Ga0495660_0016547 | 3300046810 | Bacteria | 4251 |
| 266 | Ga0495660_0061335 | 3300046810 | Bacteria | 2018 |
| 267 | Ga0495581_0020870 | 3300047315 | Bacteria | 3801 |
| 268 | Ga0495604_0001430 | 3300047317 | Bacteria | 19597 |
| 269 | Ga0495604_0005281 | 3300047317 | Bacteria | 10248 |
| 270 | Ga0495636_0003070 | 3300047318 | Bacteria | 6477 |
| 271 | Ga0495674_0009079 | 3300047319 | Bacteria | 9443 |
| 272 | Ga0495672_0005108 | 3300047320 | Bacteria | 10476 |
| 273 | Ga0495680_0005273 | 3300047322 | Bacteria | 12204 |
| 274 | Ga0495680_0010953 | 3300047322 | Bacteria | 8056 |
| 275 | Ga0495687_001663 | 3300047443 | Bacteria | 19943 |
| 276 | Ga0495675_0149298 | 3300047444 | Bacteria | 1444 |
| 277 | Ga0495679_000745 | 3300047446 | Bacteria | 20869 |
| 278 | Ga0495685_045137 | 3300047447 | Bacteria | 1502 |
| 279 | Ga0495673_0000558 | 3300047469 | Bacteria | 38053 |
| 280 | Ga0495673_0037676 | 3300047469 | Bacteria | 2206 |
| 281 | Ga0495681_0013673 | 3300047470 | Bacteria | 4697 |
| 282 | Ga0495681_0036389 | 3300047470 | Bacteria | 2434 |
| 283 | Ga0495681_0284791 | 3300047470 | Bacteria | 643 |
| 284 | Ga0495684_0276009 | 3300047471 | Bacteria | 1214 |
| 285 | Ga0495593_0097354 | 3300047673 | Bacteria | 1511 |
| 286 | Ga0495614_0378048 | 3300048089 | Bacteria | 663 |
| 287 | Ga0495626_0003535 | 3300048091 | Bacteria | 10000 |
| 288 | Ga0495626_0018116 | 3300048091 | Bacteria | 3544 |
| 289 | Ga0495626_0056026 | 3300048091 | Bacteria | 1806 |
| 290 | Ga0495626_0080373 | 3300048091 | Bacteria | 1449 |
| 291 | Ga0496102_0000893 | 3300048905 | Bacteria | 28294 |
| 292 | Ga0496103_0021720 | 3300048906 | Bacteria | 3862 |
| 293 | Ga0496112_0089834 | 3300048915 | Bacteria | 3040 |
| 294 | Ga0496114_0002923 | 3300048917 | Bacteria | 13090 |
| 295 | Ga0496116_0010789 | 3300048919 | Bacteria | 7624 |
| 296 | Ga0496117_0030979 | 3300048920 | Bacteria | 4092 |
| 297 | Ga0496117_0053541 | 3300048920 | Bacteria | 2834 |
| 298 | Ga0496117_0093423 | 3300048920 | Bacteria | 1929 |
| 299 | Ga0496117_0174527 | 3300048920 | Bacteria | 1243 |
| 300 | Ga0496118_0006950 | 3300048921 | Bacteria | 12230 |
| 301 | Ga0496118_0088339 | 3300048921 | Bacteria | 2144 |
| 302 | Ga0496118_0143423 | 3300048921 | Bacteria | 1509 |
| 303 | Ga0496119_0054890 | 3300048922 | Bacteria | 2423 |
| 304 | Ga0496119_0102072 | 3300048922 | Bacteria | 1608 |
| 305 | Ga0496120_0008011 | 3300048923 | Bacteria | 7774 |
| 306 | Ga0496120_0030399 | 3300048923 | Bacteria | 3284 |
| 307 | Ga0496121_0045292 | 3300048924 | Bacteria | 3782 |
| 308 | Ga0496121_0106680 | 3300048924 | Bacteria | 2147 |
| 309 | Ga0496122_0087651 | 3300048925 | Bacteria | 2137 |
| 310 | Ga0496124_0000073 | 3300048927 | Bacteria | 219306 |
| 311 | Ga0496124_0001240 | 3300048927 | Bacteria | 39185 |
| 312 | Ga0496124_0055552 | 3300048927 | Bacteria | 3346 |
| 313 | Ga0496124_0058772 | 3300048927 | Bacteria | 3232 |
| 314 | Ga0496124_0111989 | 3300048927 | Bacteria | 2195 |
| 315 | Ga0496124_0582662 | 3300048927 | Bacteria | 731 |
| 316 | Ga0496125_0001137 | 3300048928 | Bacteria | 40507 |
| 317 | Ga0496125_0003636 | 3300048928 | Bacteria | 18476 |
| 318 | Ga0496125_0055938 | 3300048928 | Bacteria | 3209 |
| 319 | Ga0496126_0121316 | 3300048929 | Bacteria | 2266 |
| 320 | Ga0495678_002588 | 3300049459 | Bacteria | 12101 |
| 321 | Ga0495678_003090 | 3300049459 | Bacteria | 10554 |
| 322 | Ga0495682_0000260 | 3300049460 | Bacteria | 41984 |
| 323 | Ga0495682_0105485 | 3300049460 | Bacteria | 1010 |
| 324 | Ga0501222_003694 | 3300049662 | Bacteria | 2080 |
| 325 | Ga0501257_129340 | 3300049686 | Bacteria | 682 |
| 326 | nmdc:mga0k408_121764_c1 | 3300050493 | Bacteria | 1545 |
| 327 | nmdc:mga0k408_2282_c1 | 3300050493 | Bacteria | 10241 |
| 328 | Ga0500618_008341 | 3300053125 | Bacteria | 2897 |
| 329 | Ga0500634_0055230 | 3300053161 | Bacteria | 2124 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2894510363 | 2894511798 | 174 |
| 2 | iso_pu_bacteria | 2891633521 | 2891637085 | 175 |
| 3 | 3300031548 | Ga0307408_100755265 | Ga0307408_1007552652 | 180 |
| 4 | 3300039062 | Ga0400483_219793 | Ga0400483_219793_25024_25566 | 180 |
| 5 | 3300044694 | Ga0466963_0012961 | Ga0466963_0012961_1147_1689 | 180 |
| 6 | 3300045051 | Ga0451576_0000053 | Ga0451576_0000053_178422_178967 | 180 |
| 7 | 3300045836 | Ga0466958_0080341 | Ga0466958_0080341_268_810 | 180 |
| 8 | 2162886011 | MRS1b_contig_8525056 | MRS1b_0468.00002560 | 181 |
| 9 | 3300001915 | JGI24741J21665_1004783 | JGI24741J21665_10047833 | 181 |
| 10 | 3300003781 | Ga0055536_1000855 | Ga0055536_10008557 | 181 |
| 11 | 3300003791 | Ga0055530_10001036 | Ga0055530_1000103615 | 181 |
| 12 | 3300003792 | Ga0055540_1000064 | Ga0055540_100006493 | 181 |
| 13 | 3300003794 | Ga0055531_10000039 | Ga0055531_1000003931 | 181 |
| 14 | 3300005288 | Ga0065714_10000193 | Ga0065714_100001935 | 181 |
| 15 | 3300005288 | Ga0065714_10032763 | Ga0065714_100327632 | 181 |
| 16 | 3300005288 | Ga0065714_10045568 | Ga0065714_100455682 | 181 |
| 17 | 3300005288 | Ga0065714_10080104 | Ga0065714_100801043 | 181 |
| 18 | 3300005288 | Ga0065714_10290330 | Ga0065714_102903301 | 181 |
| 19 | 3300005289 | Ga0065704_10021238 | Ga0065704_100212382 | 181 |
| 20 | 3300005290 | Ga0065712_10067962 | Ga0065712_1006796217 | 181 |
| 21 | 3300005331 | Ga0070670_100001383 | Ga0070670_10000138311 | 181 |
| 22 | 3300005353 | Ga0070669_100000090 | Ga0070669_10000009047 | 181 |
| 23 | 3300005457 | Ga0070662_100007352 | Ga0070662_1000073524 | 181 |
| 24 | 3300005539 | Ga0068853_100000218 | Ga0068853_10000021813 | 181 |
| 25 | 3300005564 | Ga0070664_100027302 | Ga0070664_1000273023 | 181 |
| 26 | 3300005578 | Ga0068854_100018615 | Ga0068854_1000186154 | 181 |
| 27 | 3300005834 | Ga0068851_10000118 | Ga0068851_100001184 | 181 |
| 28 | 3300006058 | Ga0075432_10002925 | Ga0075432_100029253 | 181 |
| 29 | 3300006058 | Ga0075432_10013157 | Ga0075432_100131573 | 181 |
| 30 | 3300006058 | Ga0075432_10014017 | Ga0075432_100140171 | 181 |
| 31 | 3300006195 | Ga0075366_10000239 | Ga0075366_1000023918 | 181 |
| 32 | 3300006195 | Ga0075366_10114300 | Ga0075366_101143002 | 181 |
| 33 | 3300006914 | Ga0075436_100015194 | Ga0075436_1000151943 | 181 |
| 34 | 3300006946 | Ga0079104_1033648 | Ga0079104_10336482 | 181 |
| 35 | 3300009011 | Ga0105251_10000009 | Ga0105251_1000000975 | 181 |
| 36 | 3300009011 | Ga0105251_10000423 | Ga0105251_100004237 | 181 |
| 37 | 3300009011 | Ga0105251_10017015 | Ga0105251_100170154 | 181 |
| 38 | 3300009036 | Ga0105244_10000110 | Ga0105244_1000011047 | 181 |
| 39 | 3300009036 | Ga0105244_10003730 | Ga0105244_100037304 | 181 |
| 40 | 3300009036 | Ga0105244_10168605 | Ga0105244_101686052 | 181 |
| 41 | 3300009036 | Ga0105244_10265740 | Ga0105244_102657402 | 181 |
| 42 | 3300009092 | Ga0105250_10000107 | Ga0105250_1000010732 | 181 |
| 43 | 3300009092 | Ga0105250_10013528 | Ga0105250_100135283 | 181 |
| 44 | 3300009092 | Ga0105250_10022697 | Ga0105250_100226972 | 181 |
| 45 | 3300009092 | Ga0105250_10030102 | Ga0105250_100301022 | 181 |
| 46 | 3300009148 | Ga0105243_10005026 | Ga0105243_100050263 | 181 |
| 47 | 3300009148 | Ga0105243_10039741 | Ga0105243_100397413 | 181 |
| 48 | 3300009148 | Ga0105243_10040122 | Ga0105243_100401223 | 181 |
| 49 | 3300009545 | Ga0105237_10009591 | Ga0105237_100095914 | 181 |
| 50 | 3300011119 | Ga0105246_10009506 | Ga0105246_100095063 | 181 |
| 51 | 3300011119 | Ga0105246_10021307 | Ga0105246_100213072 | 181 |
| 52 | 3300013100 | Ga0157373_10019869 | Ga0157373_100198693 | 181 |
| 53 | 3300013100 | Ga0157373_10027148 | Ga0157373_100271483 | 181 |
| 54 | 3300013100 | Ga0157373_10090681 | Ga0157373_100906813 | 181 |
| 55 | 3300013100 | Ga0157373_10275456 | Ga0157373_102754562 | 181 |
| 56 | 3300013102 | Ga0157371_10008494 | Ga0157371_100084942 | 181 |
| 57 | 3300013102 | Ga0157371_10442774 | Ga0157371_104427742 | 181 |
| 58 | 3300013104 | Ga0157370_10060291 | Ga0157370_100602913 | 181 |
| 59 | 3300013104 | Ga0157370_10159051 | Ga0157370_101590513 | 181 |
| 60 | 3300013104 | Ga0157370_10432630 | Ga0157370_104326302 | 181 |
| 61 | 3300013104 | Ga0157370_10569212 | Ga0157370_105692122 | 181 |
| 62 | 3300013104 | Ga0157370_10721852 | Ga0157370_107218521 | 181 |
| 63 | 3300013105 | Ga0157369_10036306 | Ga0157369_100363063 | 181 |
| 64 | 3300013105 | Ga0157369_10647321 | Ga0157369_106473212 | 181 |
| 65 | 3300013306 | Ga0163162_10401095 | Ga0163162_104010952 | 181 |
| 66 | 3300014497 | Ga0182008_10002273 | Ga0182008_100022733 | 181 |
| 67 | 3300014497 | Ga0182008_10214267 | Ga0182008_102142672 | 181 |
| 68 | 3300015261 | Ga0182006_1014804 | Ga0182006_10148043 | 181 |
| 69 | 3300015262 | Ga0182007_10102366 | Ga0182007_101023661 | 181 |
| 70 | 3300015265 | Ga0182005_1005744 | Ga0182005_10057442 | 181 |
| 71 | 3300015265 | Ga0182005_1075029 | Ga0182005_10750292 | 181 |
| 72 | 3300017792 | Ga0163161_10002513 | Ga0163161_100025138 | 181 |
| 73 | 3300017792 | Ga0163161_10008499 | Ga0163161_100084993 | 181 |
| 74 | 3300025291 | Ga0209675_1008637 | Ga0209675_10086372 | 181 |
| 75 | 3300025292 | Ga0209676_1000025 | Ga0209676_1000025412 | 181 |
| 76 | 3300025298 | Ga0209050_1000099 | Ga0209050_100009958 | 181 |
| 77 | 3300025303 | Ga0209051_1000026 | Ga0209051_1000026207 | 181 |
| 78 | 3300025304 | Ga0209257_1000034 | Ga0209257_1000034412 | 181 |
| 79 | 3300025321 | Ga0207656_10000008 | Ga0207656_1000000887 | 181 |
| 80 | 3300025711 | Ga0207696_1000020 | Ga0207696_1000020190 | 181 |
| 81 | 3300025711 | Ga0207696_1002256 | Ga0207696_10022563 | 181 |
| 82 | 3300025711 | Ga0207696_1018956 | Ga0207696_10189563 | 181 |
| 83 | 3300025711 | Ga0207696_1037790 | Ga0207696_10377902 | 181 |
| 84 | 3300025728 | Ga0207655_1000310 | Ga0207655_100031016 | 181 |
| 85 | 3300025728 | Ga0207655_1000453 | Ga0207655_100045326 | 181 |
| 86 | 3300025728 | Ga0207655_1012873 | Ga0207655_10128732 | 181 |
| 87 | 3300025735 | Ga0207713_1000032 | Ga0207713_1000032186 | 181 |
| 88 | 3300025735 | Ga0207713_1000225 | Ga0207713_100022523 | 181 |
| 89 | 3300025735 | Ga0207713_1004147 | Ga0207713_10041472 | 181 |
| 90 | 3300025735 | Ga0207713_1014684 | Ga0207713_10146843 | 181 |
| 91 | 3300025735 | Ga0207713_1054260 | Ga0207713_10542602 | 181 |
| 92 | 3300025914 | Ga0207671_10040515 | Ga0207671_100405153 | 181 |
| 93 | 3300025923 | Ga0207681_10000048 | Ga0207681_1000004824 | 181 |
| 94 | 3300025923 | Ga0207681_10000267 | Ga0207681_1000026721 | 181 |
| 95 | 3300025925 | Ga0207650_10001072 | Ga0207650_1000107211 | 181 |
| 96 | 3300025933 | Ga0207706_10000374 | Ga0207706_1000037420 | 181 |
| 97 | 3300025935 | Ga0207709_10000040 | Ga0207709_10000040166 | 181 |
| 98 | 3300025935 | Ga0207709_10008336 | Ga0207709_100083362 | 181 |
| 99 | 3300025945 | Ga0207679_10037604 | Ga0207679_100376042 | 181 |
| 100 | 3300026041 | Ga0207639_10000392 | Ga0207639_1000039212 | 181 |
| 101 | 3300027360 | Ga0209969_1034154 | Ga0209969_10341541 | 181 |
| 102 | 3300027395 | Ga0209996_1000469 | Ga0209996_10004693 | 181 |
| 103 | 3300027471 | Ga0209995_1001898 | Ga0209995_10018983 | 181 |
| 104 | 3300027526 | Ga0209968_1007645 | Ga0209968_10076452 | 181 |
| 105 | 3300027543 | Ga0209999_1002473 | Ga0209999_10024733 | 181 |
| 106 | 3300027617 | Ga0210002_1027393 | Ga0210002_10273932 | 181 |
| 107 | 3300027665 | Ga0209983_1004755 | Ga0209983_10047553 | 181 |
| 108 | 3300027682 | Ga0209971_1000485 | Ga0209971_100048510 | 181 |
| 109 | 3300027876 | Ga0209974_10011289 | Ga0209974_100112893 | 181 |
| 110 | 3300027907 | Ga0207428_10190792 | Ga0207428_101907922 | 181 |
| 111 | 3300027907 | Ga0207428_10242571 | Ga0207428_102425711 | 181 |
| 112 | 3300030521 | Ga0307511_10045857 | Ga0307511_100458573 | 181 |
| 113 | 3300030733 | Ga0314311_1262426 | Ga0314311_12624268 | 181 |
| 114 | 3300030742 | Ga0316183_1211848 | Ga0316183_12118482 | 181 |
| 115 | 3300031250 | Ga0265331_10192145 | Ga0265331_101921452 | 181 |
| 116 | 3300031548 | Ga0307408_100005361 | Ga0307408_1000053615 | 181 |
| 117 | 3300031548 | Ga0307408_100730587 | Ga0307408_1007305872 | 181 |
| 118 | 3300031730 | Ga0307516_10532119 | Ga0307516_105321191 | 181 |
| 119 | 3300031731 | Ga0307405_10000725 | Ga0307405_100007256 | 181 |
| 120 | 3300031731 | Ga0307405_10000811 | Ga0307405_100008117 | 181 |
| 121 | 3300031824 | Ga0307413_10015240 | Ga0307413_100152403 | 181 |
| 122 | 3300031824 | Ga0307413_10611503 | Ga0307413_106115032 | 181 |
| 123 | 3300031901 | Ga0307406_10005461 | Ga0307406_100054614 | 181 |
| 124 | 3300031903 | Ga0307407_10048245 | Ga0307407_100482452 | 181 |
| 125 | 3300031903 | Ga0307407_10138151 | Ga0307407_101381512 | 181 |
| 126 | 3300031911 | Ga0307412_10000424 | Ga0307412_1000042418 | 181 |
| 127 | 3300031911 | Ga0307412_10040586 | Ga0307412_100405862 | 181 |
| 128 | 3300031995 | Ga0307409_100602962 | Ga0307409_1006029621 | 181 |
| 129 | 3300032002 | Ga0307416_100047922 | Ga0307416_1000479222 | 181 |
| 130 | 3300032004 | Ga0307414_10023636 | Ga0307414_100236362 | 181 |
| 131 | 3300035170 | Ga0373943_0269102 | Ga0373943_0269102_32_586 | 181 |
| 132 | 3300035695 | Ga0373927_0045856 | Ga0373927_0045856_1536_2090 | 181 |
| 133 | 3300037068 | Ga0373925_0074355 | Ga0373925_0074355_606_1160 | 181 |
| 134 | 3300038705 | Ga0237819_07788 | Ga0237819_07788_39_620 | 181 |
| 135 | 3300041404 | Ga0439436_0108509 | Ga0439436_0108509_219_764 | 181 |
| 136 | 3300041405 | Ga0439438_000416 | Ga0439438_000416_15793_16338 | 181 |
| 137 | 3300041405 | Ga0439438_008668 | Ga0439438_008668_2202_2747 | 181 |
| 138 | 3300041407 | Ga0439447_010317 | Ga0439447_010317_1842_2387 | 181 |
| 139 | 3300041407 | Ga0439447_011863 | Ga0439447_011863_699_1244 | 181 |
| 140 | 3300041407 | Ga0439447_022330 | Ga0439447_022330_330_878 | 181 |
| 141 | 3300041407 | Ga0439447_029691 | Ga0439447_029691_159_704 | 181 |
| 142 | 3300041411 | Ga0439466_0004770 | Ga0439466_0004770_369_914 | 181 |
| 143 | 3300041411 | Ga0439466_0007514 | Ga0439466_0007514_681_1229 | 181 |
| 144 | 3300041411 | Ga0439466_0021637 | Ga0439466_0021637_519_1064 | 181 |
| 145 | 3300041411 | Ga0439466_0035919 | Ga0439466_0035919_375_920 | 181 |
| 146 | 3300041411 | Ga0439466_0041030 | Ga0439466_0041030_923_1468 | 181 |
| 147 | 3300041413 | Ga0439465_0002232 | Ga0439465_0002232_975_1520 | 181 |
| 148 | 3300042004 | Ga0439445_0006461 | Ga0439445_0006461_931_1479 | 181 |
| 149 | 3300042006 | Ga0439432_006121 | Ga0439432_006121_1140_1688 | 181 |
| 150 | 3300042006 | Ga0439432_019258 | Ga0439432_019258_670_1215 | 181 |
| 151 | 3300042009 | Ga0439451_005286 | Ga0439451_005286_1605_2150 | 181 |
| 152 | 3300042009 | Ga0439451_026586 | Ga0439451_026586_53_598 | 181 |
| 153 | 3300042009 | Ga0439451_030119 | Ga0439451_030119_427_972 | 181 |
| 154 | 3300042009 | Ga0439451_056793 | Ga0439451_056793_27_572 | 181 |
| 155 | 3300042010 | Ga0439452_002846 | Ga0439452_002846_2593_3138 | 181 |
| 156 | 3300042010 | Ga0439452_006619 | Ga0439452_006619_1227_1772 | 181 |
| 157 | 3300042010 | Ga0439452_006849 | Ga0439452_006849_572_1117 | 181 |
| 158 | 3300042010 | Ga0439452_032970 | Ga0439452_032970_293_838 | 181 |
| 159 | 3300042013 | Ga0439456_003504 | Ga0439456_003504_1305_1850 | 181 |
| 160 | 3300042013 | Ga0439456_016742 | Ga0439456_016742_174_719 | 181 |
| 161 | 3300042013 | Ga0439456_066640 | Ga0439456_066640_70_615 | 181 |
| 162 | 3300042016 | Ga0439463_000136 | Ga0439463_000136_11399_11944 | 181 |
| 163 | 3300042115 | Ga0450911_001020 | Ga0450911_001020_2689_3234 | 181 |
| 164 | 3300042124 | Ga0450922_001017 | Ga0450922_001017_2128_2673 | 181 |
| 165 | 3300042125 | Ga0450923_013260 | Ga0450923_013260_637_1182 | 181 |
| 166 | 3300042127 | Ga0450890_000142 | Ga0450890_000142_2224_2769 | 181 |
| 167 | 3300042137 | Ga0450902_024102 | Ga0450902_024102_273_818 | 181 |
| 168 | 3300042138 | Ga0450903_023834 | Ga0450903_023834_255_800 | 181 |
| 169 | 3300042139 | Ga0450904_003084 | Ga0450904_003084_134_679 | 181 |
| 170 | 3300042144 | Ga0450889_001105 | Ga0450889_001105_766_1311 | 181 |
| 171 | 3300042146 | Ga0450907_001964 | Ga0450907_001964_691_1236 | 181 |
| 172 | 3300042147 | Ga0450910_000099 | Ga0450910_000099_1964_2509 | 181 |
| 173 | 3300042147 | Ga0450910_031953 | Ga0450910_031953_244_789 | 181 |
| 174 | 3300042156 | Ga0439446_0000812 | Ga0439446_0000812_2804_3349 | 181 |
| 175 | 3300042156 | Ga0439446_0000865 | Ga0439446_0000865_5150_5695 | 181 |
| 176 | 3300042156 | Ga0439446_0045722 | Ga0439446_0045722_339_884 | 181 |
| 177 | 3300042184 | Ga0450908_000147 | Ga0450908_000147_6473_7018 | 181 |
| 178 | 3300042184 | Ga0450908_015554 | Ga0450908_015554_227_775 | 181 |
| 179 | 3300042184 | Ga0450908_028822 | Ga0450908_028822_252_797 | 181 |
| 180 | 3300042185 | Ga0450909_051059 | Ga0450909_051059_31_576 | 181 |
| 181 | 3300042435 | Ga0439434_0002018 | Ga0439434_0002018_5048_5593 | 181 |
| 182 | 3300042435 | Ga0439434_0003912 | Ga0439434_0003912_3557_4102 | 181 |
| 183 | 3300042439 | Ga0439464_0028182 | Ga0439464_0028182_721_1266 | 181 |
| 184 | 3300042461 | Ga0439460_0002283 | Ga0439460_0002283_3901_4446 | 181 |
| 185 | 3300042461 | Ga0439460_0022495 | Ga0439460_0022495_523_1068 | 181 |
| 186 | 3300042532 | Ga0450893_0000829 | Ga0450893_0000829_2907_3452 | 181 |
| 187 | 3300045051 | Ga0451576_0003050 | Ga0451576_0003050_14555_15103 | 181 |
| 188 | 3300046452 | Ga0495617_013518 | Ga0495617_013518_1334_1915 | 181 |
| 189 | 3300046452 | Ga0495617_077789 | Ga0495617_077789_101_646 | 181 |
| 190 | 3300046453 | Ga0495627_000404 | Ga0495627_000404_22544_23089 | 181 |
| 191 | 3300046455 | Ga0495603_0004532 | Ga0495603_0004532_4863_5408 | 181 |
| 192 | 3300046457 | Ga0495590_0001930 | Ga0495590_0001930_5471_6052 | 181 |
| 193 | 3300046463 | Ga0495653_0190746 | Ga0495653_0190746_410_955 | 181 |
| 194 | 3300046471 | Ga0495650_0006679 | Ga0495650_0006679_1371_1952 | 181 |
| 195 | 3300046471 | Ga0495650_0107378 | Ga0495650_0107378_244_825 | 181 |
| 196 | 3300046474 | Ga0495605_0057939 | Ga0495605_0057939_1007_1552 | 181 |
| 197 | 3300046474 | Ga0495605_0099791 | Ga0495605_0099791_360_911 | 181 |
| 198 | 3300046475 | Ga0495639_0061019 | Ga0495639_0061019_944_1489 | 181 |
| 199 | 3300046491 | Ga0495584_0002240 | Ga0495584_0002240_852_1433 | 181 |
| 200 | 3300046491 | Ga0495584_0149767 | Ga0495584_0149767_362_943 | 181 |
| 201 | 3300046491 | Ga0495584_0240017 | Ga0495584_0240017_11_556 | 181 |
| 202 | 3300046492 | Ga0495585_0042029 | Ga0495585_0042029_204_785 | 181 |
| 203 | 3300046501 | Ga0495607_0000050 | Ga0495607_0000050_77706_78254 | 181 |
| 204 | 3300046501 | Ga0495607_0000392 | Ga0495607_0000392_20580_21161 | 181 |
| 205 | 3300046501 | Ga0495607_0015842 | Ga0495607_0015842_3891_4436 | 181 |
| 206 | 3300046501 | Ga0495607_0103822 | Ga0495607_0103822_331_876 | 181 |
| 207 | 3300046506 | Ga0495583_0001901 | Ga0495583_0001901_8609_9154 | 181 |
| 208 | 3300046506 | Ga0495583_0148941 | Ga0495583_0148941_402_947 | 181 |
| 209 | 3300046507 | Ga0495606_0267217 | Ga0495606_0267217_228_809 | 181 |
| 210 | 3300046512 | Ga0495610_0095060 | Ga0495610_0095060_764_1309 | 181 |
| 211 | 3300046515 | Ga0495620_0002007 | Ga0495620_0002007_3792_4373 | 181 |
| 212 | 3300046515 | Ga0495620_0101053 | Ga0495620_0101053_130_675 | 181 |
| 213 | 3300046518 | Ga0495631_0000166 | Ga0495631_0000166_25118_25699 | 181 |
| 214 | 3300046519 | Ga0495632_0000532 | Ga0495632_0000532_1275_1856 | 181 |
| 215 | 3300046519 | Ga0495632_0066113 | Ga0495632_0066113_1006_1587 | 181 |
| 216 | 3300046519 | Ga0495632_0088868 | Ga0495632_0088868_677_1246 | 181 |
| 217 | 3300046520 | Ga0495637_0023056 | Ga0495637_0023056_1346_1891 | 181 |
| 218 | 3300046520 | Ga0495637_0024798 | Ga0495637_0024798_282_863 | 181 |
| 219 | 3300046522 | Ga0495643_0000275 | Ga0495643_0000275_18531_19076 | 181 |
| 220 | 3300046522 | Ga0495643_0002468 | Ga0495643_0002468_12746_13291 | 181 |
| 221 | 3300046522 | Ga0495643_0013879 | Ga0495643_0013879_964_1509 | 181 |
| 222 | 3300046524 | Ga0495648_0000533 | Ga0495648_0000533_20647_21315 | 181 |
| 223 | 3300046524 | Ga0495648_0003581 | Ga0495648_0003581_9544_10095 | 181 |
| 224 | 3300046524 | Ga0495648_0011192 | Ga0495648_0011192_5012_5557 | 181 |
| 225 | 3300046524 | Ga0495648_0013605 | Ga0495648_0013605_1540_2121 | 181 |
| 226 | 3300046526 | Ga0495666_0231145 | Ga0495666_0231145_122_670 | 181 |
| 227 | 3300046528 | Ga0495642_0000609 | Ga0495642_0000609_9525_10106 | 181 |
| 228 | 3300046529 | Ga0495652_0304065 | Ga0495652_0304065_54_602 | 181 |
| 229 | 3300046530 | Ga0495654_0005823 | Ga0495654_0005823_5826_6377 | 181 |
| 230 | 3300046530 | Ga0495654_0006537 | Ga0495654_0006537_4621_5202 | 181 |
| 231 | 3300046530 | Ga0495654_0039508 | Ga0495654_0039508_869_1414 | 181 |
| 232 | 3300046530 | Ga0495654_0055966 | Ga0495654_0055966_311_856 | 181 |
| 233 | 3300046530 | Ga0495654_0099307 | Ga0495654_0099307_643_1311 | 181 |
| 234 | 3300046530 | Ga0495654_0158800 | Ga0495654_0158800_182_727 | 181 |
| 235 | 3300046535 | Ga0495586_0001759 | Ga0495586_0001759_6310_6855 | 181 |
| 236 | 3300046536 | Ga0495587_0010981 | Ga0495587_0010981_1732_2277 | 181 |
| 237 | 3300046538 | Ga0495609_0002121 | Ga0495609_0002121_2896_3477 | 181 |
| 238 | 3300046538 | Ga0495609_0015416 | Ga0495609_0015416_1176_1721 | 181 |
| 239 | 3300046538 | Ga0495609_0026290 | Ga0495609_0026290_14_811 | 181 |
| 240 | 3300046542 | Ga0495597_0007602 | Ga0495597_0007602_2733_3278 | 181 |
| 241 | 3300046542 | Ga0495597_0050064 | Ga0495597_0050064_476_1021 | 181 |
| 242 | 3300046543 | Ga0495645_0103669 | Ga0495645_0103669_1230_1778 | 181 |
| 243 | 3300046558 | Ga0495633_0001098 | Ga0495633_0001098_1849_2430 | 181 |
| 244 | 3300046558 | Ga0495633_0129780 | Ga0495633_0129780_566_1147 | 181 |
| 245 | 3300046558 | Ga0495633_0176077 | Ga0495633_0176077_216_761 | 181 |
| 246 | 3300046642 | Ga0495634_0001907 | Ga0495634_0001907_10224_10769 | 181 |
| 247 | 3300046660 | Ga0495625_0050714 | Ga0495625_0050714_1421_1966 | 181 |
| 248 | 3300046660 | Ga0495625_0055452 | Ga0495625_0055452_2267_2812 | 181 |
| 249 | 3300046663 | Ga0495635_0000980 | Ga0495635_0000980_530_1075 | 181 |
| 250 | 3300046663 | Ga0495635_0003024 | Ga0495635_0003024_1855_2400 | 181 |
| 251 | 3300046665 | Ga0495661_0000036 | Ga0495661_0000036_101515_102060 | 181 |
| 252 | 3300046665 | Ga0495661_0065126 | Ga0495661_0065126_916_1461 | 181 |
| 253 | 3300046665 | Ga0495661_0219601 | Ga0495661_0219601_216_797 | 181 |
| 254 | 3300046679 | Ga0495623_0044048 | Ga0495623_0044048_1818_2363 | 181 |
| 255 | 3300046680 | Ga0495646_0070608 | Ga0495646_0070608_444_989 | 181 |
| 256 | 3300046690 | Ga0495624_0552305 | Ga0495624_0552305_108_662 | 181 |
| 257 | 3300046691 | Ga0495670_0216787 | Ga0495670_0216787_330_911 | 181 |
| 258 | 3300046692 | Ga0495671_0007315 | Ga0495671_0007315_914_1459 | 181 |
| 259 | 3300046692 | Ga0495671_0019071 | Ga0495671_0019071_950_1495 | 181 |
| 260 | 3300046692 | Ga0495671_0021532 | Ga0495671_0021532_1218_1763 | 181 |
| 261 | 3300046692 | Ga0495671_0052969 | Ga0495671_0052969_404_964 | 181 |
| 262 | 3300046694 | Ga0495649_0000264 | Ga0495649_0000264_34395_34976 | 181 |
| 263 | 3300046694 | Ga0495649_0091910 | Ga0495649_0091910_946_1491 | 181 |
| 264 | 3300046694 | Ga0495649_0157313 | Ga0495649_0157313_196_741 | 181 |
| 265 | 3300046794 | Ga0495589_0014845 | Ga0495589_0014845_2671_3216 | 181 |
| 266 | 3300046810 | Ga0495660_0013823 | Ga0495660_0013823_648_1193 | 181 |
| 267 | 3300046810 | Ga0495660_0016547 | Ga0495660_0016547_3532_4092 | 181 |
| 268 | 3300046810 | Ga0495660_0061335 | Ga0495660_0061335_225_806 | 181 |
| 269 | 3300047315 | Ga0495581_0020870 | Ga0495581_0020870_3187_3732 | 181 |
| 270 | 3300047317 | Ga0495604_0001430 | Ga0495604_0001430_4162_4707 | 181 |
| 271 | 3300047317 | Ga0495604_0005281 | Ga0495604_0005281_4758_5303 | 181 |
| 272 | 3300047318 | Ga0495636_0003070 | Ga0495636_0003070_455_1036 | 181 |
| 273 | 3300047319 | Ga0495674_0009079 | Ga0495674_0009079_3533_4078 | 181 |
| 274 | 3300047320 | Ga0495672_0005108 | Ga0495672_0005108_1790_2371 | 181 |
| 275 | 3300047322 | Ga0495680_0005273 | Ga0495680_0005273_1785_2330 | 181 |
| 276 | 3300047322 | Ga0495680_0010953 | Ga0495680_0010953_6528_7073 | 181 |
| 277 | 3300047443 | Ga0495687_001663 | Ga0495687_001663_9742_10323 | 181 |
| 278 | 3300047444 | Ga0495675_0149298 | Ga0495675_0149298_506_1051 | 181 |
| 279 | 3300047446 | Ga0495679_000745 | Ga0495679_000745_6070_6615 | 181 |
| 280 | 3300047447 | Ga0495685_045137 | Ga0495685_045137_776_1321 | 181 |
| 281 | 3300047469 | Ga0495673_0000558 | Ga0495673_0000558_17999_18580 | 181 |
| 282 | 3300047469 | Ga0495673_0037676 | Ga0495673_0037676_1219_1764 | 181 |
| 283 | 3300047470 | Ga0495681_0013673 | Ga0495681_0013673_2758_3339 | 181 |
| 284 | 3300047470 | Ga0495681_0036389 | Ga0495681_0036389_1111_1656 | 181 |
| 285 | 3300047470 | Ga0495681_0284791 | Ga0495681_0284791_13_558 | 181 |
| 286 | 3300047471 | Ga0495684_0276009 | Ga0495684_0276009_247_792 | 181 |
| 287 | 3300047673 | Ga0495593_0097354 | Ga0495593_0097354_162_707 | 181 |
| 288 | 3300048089 | Ga0495614_0378048 | Ga0495614_0378048_95_640 | 181 |
| 289 | 3300048091 | Ga0495626_0003535 | Ga0495626_0003535_8116_8697 | 181 |
| 290 | 3300048091 | Ga0495626_0018116 | Ga0495626_0018116_2185_2730 | 181 |
| 291 | 3300048091 | Ga0495626_0056026 | Ga0495626_0056026_417_965 | 181 |
| 292 | 3300048091 | Ga0495626_0080373 | Ga0495626_0080373_116_676 | 181 |
| 293 | 3300048905 | Ga0496102_0000893 | Ga0496102_0000893_9646_10191 | 181 |
| 294 | 3300048906 | Ga0496103_0021720 | Ga0496103_0021720_1988_2533 | 181 |
| 295 | 3300048915 | Ga0496112_0089834 | Ga0496112_0089834_1941_2489 | 181 |
| 296 | 3300048917 | Ga0496114_0002923 | Ga0496114_0002923_3777_4322 | 181 |
| 297 | 3300048919 | Ga0496116_0010789 | Ga0496116_0010789_1516_2061 | 181 |
| 298 | 3300048920 | Ga0496117_0030979 | Ga0496117_0030979_1729_2274 | 181 |
| 299 | 3300048920 | Ga0496117_0053541 | Ga0496117_0053541_105_650 | 181 |
| 300 | 3300048920 | Ga0496117_0093423 | Ga0496117_0093423_964_1554 | 181 |
| 301 | 3300048920 | Ga0496117_0174527 | Ga0496117_0174527_622_1215 | 181 |
| 302 | 3300048921 | Ga0496118_0006950 | Ga0496118_0006950_9885_10430 | 181 |
| 303 | 3300048921 | Ga0496118_0088339 | Ga0496118_0088339_1104_1649 | 181 |
| 304 | 3300048921 | Ga0496118_0143423 | Ga0496118_0143423_523_1113 | 181 |
| 305 | 3300048922 | Ga0496119_0054890 | Ga0496119_0054890_1087_1632 | 181 |
| 306 | 3300048922 | Ga0496119_0102072 | Ga0496119_0102072_162_707 | 181 |
| 307 | 3300048923 | Ga0496120_0008011 | Ga0496120_0008011_283_828 | 181 |
| 308 | 3300048923 | Ga0496120_0030399 | Ga0496120_0030399_465_1010 | 181 |
| 309 | 3300048924 | Ga0496121_0045292 | Ga0496121_0045292_2521_3102 | 181 |
| 310 | 3300048924 | Ga0496121_0106680 | Ga0496121_0106680_217_762 | 181 |
| 311 | 3300048925 | Ga0496122_0087651 | Ga0496122_0087651_64_609 | 181 |
| 312 | 3300048927 | Ga0496124_0000073 | Ga0496124_0000073_74549_75094 | 181 |
| 313 | 3300048927 | Ga0496124_0001240 | Ga0496124_0001240_19572_20117 | 181 |
| 314 | 3300048927 | Ga0496124_0055552 | Ga0496124_0055552_907_1452 | 181 |
| 315 | 3300048927 | Ga0496124_0058772 | Ga0496124_0058772_1324_1905 | 181 |
| 316 | 3300048927 | Ga0496124_0111989 | Ga0496124_0111989_1016_1561 | 181 |
| 317 | 3300048927 | Ga0496124_0582662 | Ga0496124_0582662_74_619 | 181 |
| 318 | 3300048928 | Ga0496125_0001137 | Ga0496125_0001137_20971_21516 | 181 |
| 319 | 3300048928 | Ga0496125_0003636 | Ga0496125_0003636_10181_10762 | 181 |
| 320 | 3300048928 | Ga0496125_0055938 | Ga0496125_0055938_459_1004 | 181 |
| 321 | 3300048929 | Ga0496126_0121316 | Ga0496126_0121316_1074_1619 | 181 |
| 322 | 3300049459 | Ga0495678_002588 | Ga0495678_002588_2183_2728 | 181 |
| 323 | 3300049459 | Ga0495678_003090 | Ga0495678_003090_8576_9157 | 181 |
| 324 | 3300049460 | Ga0495682_0000260 | Ga0495682_0000260_9710_10258 | 181 |
| 325 | 3300049460 | Ga0495682_0105485 | Ga0495682_0105485_19_600 | 181 |
| 326 | 3300049662 | Ga0501222_003694 | Ga0501222_003694_1220_1768 | 181 |
| 327 | 3300049686 | Ga0501257_129340 | Ga0501257_129340_101_649 | 181 |
| 328 | 3300050493 | nmdc:mga0k408_121764_c1 | nmdc:mga0k408_121764_c1_441_992 | 181 |
| 329 | 3300050493 | nmdc:mga0k408_2282_c1 | nmdc:mga0k408_2282_c1_2701_3252 | 181 |
| 330 | 3300053125 | Ga0500618_008341 | Ga0500618_008341_1007_1552 | 181 |
| 331 | 3300053161 | Ga0500634_0055230 | Ga0500634_0055230_388_933 | 181 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.9814 | 1 | 181 |
| 1dzt-assembly1.cif.gz_B | rmlc from salmonella typhimurium | 0.9761 | 2 | 177 |
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.976 | 1 | 181 |
| 6ndr-assembly1.cif.gz_B | crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose | 0.9735 | 2 | 180 |
| 6din-assembly1.cif.gz_A-2 | high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase | 0.973 | 1 | 181 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9727 | 2 | 181 | 2.60.120.10 |
| 2ixcB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9588 | 1 | 181 | 2.60.120.10 |
| af_Q17993_17_190_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9585 | 8 | 177 | 2.60.120.10 |
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.957 | 2 | 181 | 2.60.120.10 |
| 2c0zA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9566 | 1 | 176 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3G7WUY6-F1-model_v4 | deleted | 0.999 | 1 | 181 |
|
| AF-A0A7C8XNS0-F1-model_v4 | deleted | 0.9989 | 44 | 167 |
|
| AF-A0A432R1U7-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9987 | 45 | 181 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A7Y8G877-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9984 | 1 | 181 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A0A1Z6A3-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9984 | 1 | 181 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar