F410648

General Info

Members Datasets Scaffolds Average Seq Length
331 193 329 183

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0000533|Ga0495648_0000533_20647_21315
Length 222
Sequence VTCNATASGLTALVFHGGDCSHSTDSLGKNVDHQYLMLEKVMNVVPTDLPGVLILEPKVFGDERGFFYESFNARAFEQATGLTTQFVQDNHSRSQKGVLRGLHYQLENTQGKLVRVTAGEVLDVAVDIRRSSPHFGKWAAVRLSADNHRQLWVPEGFAHGFVVLSEFAEFLYKTTDYYTPAAERSIRWDDPDLAIDWQMDQAPRLSAKDEAASFLKDAEVFP

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
3 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
66 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
67 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
83 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
84 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
85 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
86 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
87 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
88 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
89 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
90 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
91 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
92 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
93 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
96 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
97 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
98 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
99 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
100 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
101 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
102 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
103 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
104 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
105 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
106 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
107 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
108 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
109 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
110 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
111 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
116 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
166 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
188 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
189 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
190 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
193 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.53
Nodule 0.3
Rhizoplane 1.21
Rhizosphere 84.89
Stem 0
Stem Tuber 0
Unclassified 9.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_8525056 2162886011 Bacteria 2022
2 JGI24741J21665_1004783 3300001915 Bacteria 2940
3 Ga0055536_1000855 3300003781 Bacteria 19989
4 Ga0055530_10001036 3300003791 Bacteria 22153
5 Ga0055540_1000064 3300003792 Bacteria 127318
6 Ga0055531_10000039 3300003794 Bacteria 141103
7 Ga0065714_10000193 3300005288 Bacteria 8109
8 Ga0065714_10032763 3300005288 Bacteria 933
9 Ga0065714_10045568 3300005288 Bacteria 770
10 Ga0065714_10080104 3300005288 Bacteria 2437
11 Ga0065714_10290330 3300005288 Bacteria 709
12 Ga0065704_10021238 3300005289 Bacteria 1276
13 Ga0065712_10067962 3300005290 Bacteria 18983
14 Ga0070670_100001383 3300005331 Bacteria 19441
15 Ga0070669_100000090 3300005353 Bacteria 88133
16 Ga0070662_100007352 3300005457 Bacteria 7136
17 Ga0068853_100000218 3300005539 Bacteria 40498
18 Ga0070664_100027302 3300005564 Bacteria 4743
19 Ga0068854_100018615 3300005578 Bacteria 4666
20 Ga0068851_10000118 3300005834 Bacteria 42408
21 Ga0075432_10002925 3300006058 Bacteria 5746
22 Ga0075432_10013157 3300006058 Bacteria 2811
23 Ga0075432_10014017 3300006058 Bacteria 2729
24 Ga0075366_10000239 3300006195 Bacteria 24396
25 Ga0075366_10114300 3300006195 Bacteria 1625
26 Ga0075436_100015194 3300006914 Bacteria 5275
27 Ga0079104_1033648 3300006946 Bacteria 1252
28 Ga0105251_10000009 3300009011 Bacteria 192384
29 Ga0105251_10000423 3300009011 Bacteria 41081
30 Ga0105251_10017015 3300009011 Bacteria 3907
31 Ga0105244_10000110 3300009036 Bacteria 85793
32 Ga0105244_10003730 3300009036 Bacteria 10750
33 Ga0105244_10168605 3300009036 Bacteria 1043
34 Ga0105244_10265740 3300009036 Bacteria 798
35 Ga0105250_10000107 3300009092 Bacteria 75197
36 Ga0105250_10013528 3300009092 Bacteria 3362
37 Ga0105250_10022697 3300009092 Bacteria 2529
38 Ga0105250_10030102 3300009092 Bacteria 2183
39 Ga0105243_10005026 3300009148 Bacteria 10372
40 Ga0105243_10039741 3300009148 Bacteria 3670
41 Ga0105243_10040122 3300009148 Bacteria 3654
42 Ga0105237_10009591 3300009545 Bacteria 10366
43 Ga0105246_10009506 3300011119 Bacteria 5989
44 Ga0105246_10021307 3300011119 Bacteria 4169
45 Ga0157373_10019869 3300013100 Bacteria 4887
46 Ga0157373_10027148 3300013100 Bacteria 4131
47 Ga0157373_10090681 3300013100 Bacteria 2153
48 Ga0157373_10275456 3300013100 Bacteria 1192
49 Ga0157371_10008494 3300013102 Bacteria 8174
50 Ga0157371_10442774 3300013102 Bacteria 954
51 Ga0157370_10060291 3300013104 Bacteria 3603
52 Ga0157370_10159051 3300013104 Bacteria 2102
53 Ga0157370_10432630 3300013104 Bacteria 1210
54 Ga0157370_10569212 3300013104 Bacteria 1038
55 Ga0157370_10721852 3300013104 Bacteria 909
56 Ga0157369_10036306 3300013105 Bacteria 5400
57 Ga0157369_10647321 3300013105 Bacteria 1090
58 Ga0163162_10401095 3300013306 Bacteria 1504
59 Ga0182008_10002273 3300014497 Bacteria 12125
60 Ga0182008_10214267 3300014497 Bacteria 984
61 Ga0182006_1014804 3300015261 Bacteria 3356
62 Ga0182007_10102366 3300015262 Bacteria 949
63 Ga0182005_1005744 3300015265 Bacteria 3850
64 Ga0182005_1075029 3300015265 Bacteria 931
65 Ga0163161_10002513 3300017792 Bacteria 13087
66 Ga0163161_10008499 3300017792 Bacteria 7110
67 Ga0209675_1008637 3300025291 Bacteria 3710
68 Ga0209676_1000025 3300025292 Bacteria 577569
69 Ga0209050_1000099 3300025298 Bacteria 232176
70 Ga0209051_1000026 3300025303 Bacteria 413311
71 Ga0209257_1000034 3300025304 Bacteria 662719
72 Ga0207656_10000008 3300025321 Bacteria 275365
73 Ga0207696_1000020 3300025711 Bacteria 434998
74 Ga0207696_1002256 3300025711 Bacteria 9594
75 Ga0207696_1018956 3300025711 Bacteria 2250
76 Ga0207696_1037790 3300025711 Bacteria 1428
77 Ga0207655_1000310 3300025728 Bacteria 72872
78 Ga0207655_1000453 3300025728 Bacteria 53763
79 Ga0207655_1012873 3300025728 Bacteria 4846
80 Ga0207713_1000032 3300025735 Bacteria 276465
81 Ga0207713_1000225 3300025735 Bacteria 76469
82 Ga0207713_1004147 3300025735 Bacteria 9524
83 Ga0207713_1014684 3300025735 Bacteria 4053
84 Ga0207713_1054260 3300025735 Bacteria 1573
85 Ga0207671_10040515 3300025914 Bacteria 3448
86 Ga0207681_10000048 3300025923 Bacteria 120755
87 Ga0207681_10000267 3300025923 Bacteria 39591
88 Ga0207650_10001072 3300025925 Bacteria 20331
89 Ga0207706_10000374 3300025933 Bacteria 48637
90 Ga0207709_10000040 3300025935 Bacteria 259497
91 Ga0207709_10008336 3300025935 Bacteria 5738
92 Ga0207679_10037604 3300025945 Bacteria 3442
93 Ga0207639_10000392 3300026041 Bacteria 30199
94 Ga0209969_1034154 3300027360 Bacteria 782
95 Ga0209996_1000469 3300027395 Bacteria 4847
96 Ga0209995_1001898 3300027471 Bacteria 3272
97 Ga0209968_1007645 3300027526 Bacteria 1637
98 Ga0209999_1002473 3300027543 Bacteria 3260
99 Ga0210002_1027393 3300027617 Bacteria 938
100 Ga0209983_1004755 3300027665 Bacteria 2837
101 Ga0209971_1000485 3300027682 Bacteria 10524
102 Ga0209974_10011289 3300027876 Bacteria 3004
103 Ga0207428_10190792 3300027907 Bacteria 1545
104 Ga0207428_10242571 3300027907 Bacteria 1346
105 Ga0307511_10045857 3300030521 Bacteria 3606
106 Ga0314311_1262426 3300030733 Bacteria 9362
107 Ga0316183_1211848 3300030742 Bacteria 3254
108 Ga0265331_10192145 3300031250 Bacteria 921
109 Ga0307408_100005361 3300031548 Bacteria 8591
110 Ga0307408_100730587 3300031548 Bacteria 892
111 Ga0307408_100755265 3300031548 Bacteria 879
112 Ga0307516_10532119 3300031730 Bacteria 829
113 Ga0307405_10000725 3300031731 Bacteria 12841
114 Ga0307405_10000811 3300031731 Bacteria 12271
115 Ga0307413_10015240 3300031824 Bacteria 3933
116 Ga0307413_10611503 3300031824 Bacteria 893
117 Ga0307406_10005461 3300031901 Bacteria 6957
118 Ga0307407_10048245 3300031903 Bacteria 2422
119 Ga0307407_10138151 3300031903 Bacteria 1568
120 Ga0307412_10000424 3300031911 Bacteria 25641
121 Ga0307412_10040586 3300031911 Bacteria 3011
122 Ga0307409_100602962 3300031995 Bacteria 1085
123 Ga0307416_100047922 3300032002 Bacteria 3386
124 Ga0307414_10023636 3300032004 Bacteria 3902
125 Ga0373943_0269102 3300035170 Bacteria 961
126 Ga0373927_0045856 3300035695 Bacteria 2828
127 Ga0373925_0074355 3300037068 Bacteria 2574
128 Ga0237819_07788 3300038705 Bacteria 1515
129 Ga0400483_219793 3300039062 Bacteria 37446
130 Ga0439436_0108509 3300041404 Bacteria 774
131 Ga0439438_000416 3300041405 Bacteria 19201
132 Ga0439438_008668 3300041405 Bacteria 3350
133 Ga0439447_010317 3300041407 Bacteria 2777
134 Ga0439447_011863 3300041407 Bacteria 2524
135 Ga0439447_022330 3300041407 Bacteria 1658
136 Ga0439447_029691 3300041407 Bacteria 1382
137 Ga0439466_0004770 3300041411 Bacteria 5211
138 Ga0439466_0007514 3300041411 Bacteria 4121
139 Ga0439466_0021637 3300041411 Bacteria 2275
140 Ga0439466_0035919 3300041411 Bacteria 1675
141 Ga0439466_0041030 3300041411 Bacteria 1545
142 Ga0439465_0002232 3300041413 Bacteria 6355
143 Ga0439445_0006461 3300042004 Bacteria 2696
144 Ga0439432_006121 3300042006 Bacteria 4308
145 Ga0439432_019258 3300042006 Bacteria 2275
146 Ga0439451_005286 3300042009 Bacteria 2629
147 Ga0439451_026586 3300042009 Bacteria 1166
148 Ga0439451_030119 3300042009 Bacteria 1091
149 Ga0439451_056793 3300042009 Bacteria 783
150 Ga0439452_002846 3300042010 Bacteria 6239
151 Ga0439452_006619 3300042010 Bacteria 3618
152 Ga0439452_006849 3300042010 Bacteria 3537
153 Ga0439452_032970 3300042010 Bacteria 1260
154 Ga0439456_003504 3300042013 Bacteria 3183
155 Ga0439456_016742 3300042013 Bacteria 1533
156 Ga0439456_066640 3300042013 Bacteria 795
157 Ga0439463_000136 3300042016 Bacteria 18554
158 Ga0450911_001020 3300042115 Bacteria 7134
159 Ga0450922_001017 3300042124 Bacteria 2814
160 Ga0450923_013260 3300042125 Bacteria 1513
161 Ga0450890_000142 3300042127 Bacteria 11148
162 Ga0450902_024102 3300042137 Bacteria 1012
163 Ga0450903_023834 3300042138 Bacteria 940
164 Ga0450904_003084 3300042139 Bacteria 1848
165 Ga0450889_001105 3300042144 Bacteria 2827
166 Ga0450907_001964 3300042146 Bacteria 4146
167 Ga0450910_000099 3300042147 Bacteria 8865
168 Ga0450910_031953 3300042147 Bacteria 829
169 Ga0439446_0000812 3300042156 Bacteria 6649
170 Ga0439446_0000865 3300042156 Bacteria 6493
171 Ga0439446_0045722 3300042156 Bacteria 1298
172 Ga0450908_000147 3300042184 Bacteria 14590
173 Ga0450908_015554 3300042184 Bacteria 1362
174 Ga0450908_028822 3300042184 Bacteria 966
175 Ga0450909_051059 3300042185 Bacteria 645
176 Ga0439434_0002018 3300042435 Bacteria 5866
177 Ga0439434_0003912 3300042435 Bacteria 4347
178 Ga0439464_0028182 3300042439 Bacteria 1565
179 Ga0439460_0002283 3300042461 Bacteria 4615
180 Ga0439460_0022495 3300042461 Bacteria 1729
181 Ga0450893_0000829 3300042532 Bacteria 4561
182 Ga0466963_0012961 3300044694 Bacteria 5110
183 Ga0451576_0000053 3300045051 Bacteria 308708
184 Ga0451576_0003050 3300045051 Bacteria 23589
185 Ga0466958_0080341 3300045836 Bacteria 2006
186 Ga0495617_013518 3300046452 Bacteria 2779
187 Ga0495617_077789 3300046452 Bacteria 1088
188 Ga0495627_000404 3300046453 Bacteria 38087
189 Ga0495603_0004532 3300046455 Bacteria 8292
190 Ga0495590_0001930 3300046457 Bacteria 8762
191 Ga0495653_0190746 3300046463 Bacteria 1398
192 Ga0495650_0006679 3300046471 Bacteria 7144
193 Ga0495650_0107378 3300046471 Bacteria 1040
194 Ga0495605_0057939 3300046474 Bacteria 1863
195 Ga0495605_0099791 3300046474 Bacteria 1336
196 Ga0495639_0061019 3300046475 Bacteria 1728
197 Ga0495584_0002240 3300046491 Bacteria 11036
198 Ga0495584_0149767 3300046491 Bacteria 1185
199 Ga0495584_0240017 3300046491 Bacteria 921
200 Ga0495585_0042029 3300046492 Bacteria 2562
201 Ga0495607_0000050 3300046501 Bacteria 120052
202 Ga0495607_0000392 3300046501 Bacteria 44546
203 Ga0495607_0015842 3300046501 Bacteria 4875
204 Ga0495607_0103822 3300046501 Bacteria 1518
205 Ga0495583_0001901 3300046506 Bacteria 19343
206 Ga0495583_0148941 3300046506 Bacteria 971
207 Ga0495606_0267217 3300046507 Bacteria 941
208 Ga0495610_0095060 3300046512 Bacteria 1344
209 Ga0495620_0002007 3300046515 Bacteria 11879
210 Ga0495620_0101053 3300046515 Bacteria 1149
211 Ga0495631_0000166 3300046518 Bacteria 45256
212 Ga0495632_0000532 3300046519 Bacteria 35904
213 Ga0495632_0066113 3300046519 Bacteria 1745
214 Ga0495632_0088868 3300046519 Bacteria 1467
215 Ga0495637_0023056 3300046520 Bacteria 2833
216 Ga0495637_0024798 3300046520 Bacteria 2711
217 Ga0495643_0000275 3300046522 Bacteria 73599
218 Ga0495643_0002468 3300046522 Bacteria 14625
219 Ga0495643_0013879 3300046522 Bacteria 4805
220 Ga0495648_0000533 3300046524 Bacteria 40990
221 Ga0495648_0003581 3300046524 Bacteria 13593
222 Ga0495648_0011192 3300046524 Bacteria 6776
223 Ga0495648_0013605 3300046524 Bacteria 6003
224 Ga0495666_0231145 3300046526 Bacteria 845
225 Ga0495642_0000609 3300046528 Bacteria 18005
226 Ga0495652_0304065 3300046529 Bacteria 1158
227 Ga0495654_0005823 3300046530 Bacteria 7100
228 Ga0495654_0006537 3300046530 Bacteria 6609
229 Ga0495654_0039508 3300046530 Bacteria 2355
230 Ga0495654_0055966 3300046530 Bacteria 1908
231 Ga0495654_0099307 3300046530 Bacteria 1342
232 Ga0495654_0158800 3300046530 Bacteria 994
233 Ga0495586_0001759 3300046535 Bacteria 11831
234 Ga0495587_0010981 3300046536 Bacteria 5744
235 Ga0495609_0002121 3300046538 Bacteria 12465
236 Ga0495609_0015416 3300046538 Bacteria 3576
237 Ga0495609_0026290 3300046538 Bacteria 2665
238 Ga0495597_0007602 3300046542 Bacteria 5484
239 Ga0495597_0050064 3300046542 Bacteria 1845
240 Ga0495645_0103669 3300046543 Bacteria 2021
241 Ga0495633_0001098 3300046558 Bacteria 21834
242 Ga0495633_0129780 3300046558 Bacteria 1166
243 Ga0495633_0176077 3300046558 Bacteria 985
244 Ga0495634_0001907 3300046642 Bacteria 17869
245 Ga0495625_0050714 3300046660 Bacteria 2977
246 Ga0495625_0055452 3300046660 Bacteria 2826
247 Ga0495635_0000980 3300046663 Bacteria 18809
248 Ga0495635_0003024 3300046663 Bacteria 11554
249 Ga0495661_0000036 3300046665 Bacteria 164694
250 Ga0495661_0065126 3300046665 Bacteria 2148
251 Ga0495661_0219601 3300046665 Bacteria 985
252 Ga0495623_0044048 3300046679 Bacteria 2837
253 Ga0495646_0070608 3300046680 Bacteria 2056
254 Ga0495624_0552305 3300046690 Bacteria 688
255 Ga0495670_0216787 3300046691 Bacteria 1016
256 Ga0495671_0007315 3300046692 Bacteria 6303
257 Ga0495671_0019071 3300046692 Bacteria 3631
258 Ga0495671_0021532 3300046692 Bacteria 3384
259 Ga0495671_0052969 3300046692 Bacteria 2015
260 Ga0495649_0000264 3300046694 Bacteria 46725
261 Ga0495649_0091910 3300046694 Bacteria 1616
262 Ga0495649_0157313 3300046694 Bacteria 1192
263 Ga0495589_0014845 3300046794 Bacteria 4007
264 Ga0495660_0013823 3300046810 Bacteria 4679
265 Ga0495660_0016547 3300046810 Bacteria 4251
266 Ga0495660_0061335 3300046810 Bacteria 2018
267 Ga0495581_0020870 3300047315 Bacteria 3801
268 Ga0495604_0001430 3300047317 Bacteria 19597
269 Ga0495604_0005281 3300047317 Bacteria 10248
270 Ga0495636_0003070 3300047318 Bacteria 6477
271 Ga0495674_0009079 3300047319 Bacteria 9443
272 Ga0495672_0005108 3300047320 Bacteria 10476
273 Ga0495680_0005273 3300047322 Bacteria 12204
274 Ga0495680_0010953 3300047322 Bacteria 8056
275 Ga0495687_001663 3300047443 Bacteria 19943
276 Ga0495675_0149298 3300047444 Bacteria 1444
277 Ga0495679_000745 3300047446 Bacteria 20869
278 Ga0495685_045137 3300047447 Bacteria 1502
279 Ga0495673_0000558 3300047469 Bacteria 38053
280 Ga0495673_0037676 3300047469 Bacteria 2206
281 Ga0495681_0013673 3300047470 Bacteria 4697
282 Ga0495681_0036389 3300047470 Bacteria 2434
283 Ga0495681_0284791 3300047470 Bacteria 643
284 Ga0495684_0276009 3300047471 Bacteria 1214
285 Ga0495593_0097354 3300047673 Bacteria 1511
286 Ga0495614_0378048 3300048089 Bacteria 663
287 Ga0495626_0003535 3300048091 Bacteria 10000
288 Ga0495626_0018116 3300048091 Bacteria 3544
289 Ga0495626_0056026 3300048091 Bacteria 1806
290 Ga0495626_0080373 3300048091 Bacteria 1449
291 Ga0496102_0000893 3300048905 Bacteria 28294
292 Ga0496103_0021720 3300048906 Bacteria 3862
293 Ga0496112_0089834 3300048915 Bacteria 3040
294 Ga0496114_0002923 3300048917 Bacteria 13090
295 Ga0496116_0010789 3300048919 Bacteria 7624
296 Ga0496117_0030979 3300048920 Bacteria 4092
297 Ga0496117_0053541 3300048920 Bacteria 2834
298 Ga0496117_0093423 3300048920 Bacteria 1929
299 Ga0496117_0174527 3300048920 Bacteria 1243
300 Ga0496118_0006950 3300048921 Bacteria 12230
301 Ga0496118_0088339 3300048921 Bacteria 2144
302 Ga0496118_0143423 3300048921 Bacteria 1509
303 Ga0496119_0054890 3300048922 Bacteria 2423
304 Ga0496119_0102072 3300048922 Bacteria 1608
305 Ga0496120_0008011 3300048923 Bacteria 7774
306 Ga0496120_0030399 3300048923 Bacteria 3284
307 Ga0496121_0045292 3300048924 Bacteria 3782
308 Ga0496121_0106680 3300048924 Bacteria 2147
309 Ga0496122_0087651 3300048925 Bacteria 2137
310 Ga0496124_0000073 3300048927 Bacteria 219306
311 Ga0496124_0001240 3300048927 Bacteria 39185
312 Ga0496124_0055552 3300048927 Bacteria 3346
313 Ga0496124_0058772 3300048927 Bacteria 3232
314 Ga0496124_0111989 3300048927 Bacteria 2195
315 Ga0496124_0582662 3300048927 Bacteria 731
316 Ga0496125_0001137 3300048928 Bacteria 40507
317 Ga0496125_0003636 3300048928 Bacteria 18476
318 Ga0496125_0055938 3300048928 Bacteria 3209
319 Ga0496126_0121316 3300048929 Bacteria 2266
320 Ga0495678_002588 3300049459 Bacteria 12101
321 Ga0495678_003090 3300049459 Bacteria 10554
322 Ga0495682_0000260 3300049460 Bacteria 41984
323 Ga0495682_0105485 3300049460 Bacteria 1010
324 Ga0501222_003694 3300049662 Bacteria 2080
325 Ga0501257_129340 3300049686 Bacteria 682
326 nmdc:mga0k408_121764_c1 3300050493 Bacteria 1545
327 nmdc:mga0k408_2282_c1 3300050493 Bacteria 10241
328 Ga0500618_008341 3300053125 Bacteria 2897
329 Ga0500634_0055230 3300053161 Bacteria 2124

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2894510363 2894511798 174
2 iso_pu_bacteria 2891633521 2891637085 175
3 3300031548 Ga0307408_100755265 Ga0307408_1007552652 180
4 3300039062 Ga0400483_219793 Ga0400483_219793_25024_25566 180
5 3300044694 Ga0466963_0012961 Ga0466963_0012961_1147_1689 180
6 3300045051 Ga0451576_0000053 Ga0451576_0000053_178422_178967 180
7 3300045836 Ga0466958_0080341 Ga0466958_0080341_268_810 180
8 2162886011 MRS1b_contig_8525056 MRS1b_0468.00002560 181
9 3300001915 JGI24741J21665_1004783 JGI24741J21665_10047833 181
10 3300003781 Ga0055536_1000855 Ga0055536_10008557 181
11 3300003791 Ga0055530_10001036 Ga0055530_1000103615 181
12 3300003792 Ga0055540_1000064 Ga0055540_100006493 181
13 3300003794 Ga0055531_10000039 Ga0055531_1000003931 181
14 3300005288 Ga0065714_10000193 Ga0065714_100001935 181
15 3300005288 Ga0065714_10032763 Ga0065714_100327632 181
16 3300005288 Ga0065714_10045568 Ga0065714_100455682 181
17 3300005288 Ga0065714_10080104 Ga0065714_100801043 181
18 3300005288 Ga0065714_10290330 Ga0065714_102903301 181
19 3300005289 Ga0065704_10021238 Ga0065704_100212382 181
20 3300005290 Ga0065712_10067962 Ga0065712_1006796217 181
21 3300005331 Ga0070670_100001383 Ga0070670_10000138311 181
22 3300005353 Ga0070669_100000090 Ga0070669_10000009047 181
23 3300005457 Ga0070662_100007352 Ga0070662_1000073524 181
24 3300005539 Ga0068853_100000218 Ga0068853_10000021813 181
25 3300005564 Ga0070664_100027302 Ga0070664_1000273023 181
26 3300005578 Ga0068854_100018615 Ga0068854_1000186154 181
27 3300005834 Ga0068851_10000118 Ga0068851_100001184 181
28 3300006058 Ga0075432_10002925 Ga0075432_100029253 181
29 3300006058 Ga0075432_10013157 Ga0075432_100131573 181
30 3300006058 Ga0075432_10014017 Ga0075432_100140171 181
31 3300006195 Ga0075366_10000239 Ga0075366_1000023918 181
32 3300006195 Ga0075366_10114300 Ga0075366_101143002 181
33 3300006914 Ga0075436_100015194 Ga0075436_1000151943 181
34 3300006946 Ga0079104_1033648 Ga0079104_10336482 181
35 3300009011 Ga0105251_10000009 Ga0105251_1000000975 181
36 3300009011 Ga0105251_10000423 Ga0105251_100004237 181
37 3300009011 Ga0105251_10017015 Ga0105251_100170154 181
38 3300009036 Ga0105244_10000110 Ga0105244_1000011047 181
39 3300009036 Ga0105244_10003730 Ga0105244_100037304 181
40 3300009036 Ga0105244_10168605 Ga0105244_101686052 181
41 3300009036 Ga0105244_10265740 Ga0105244_102657402 181
42 3300009092 Ga0105250_10000107 Ga0105250_1000010732 181
43 3300009092 Ga0105250_10013528 Ga0105250_100135283 181
44 3300009092 Ga0105250_10022697 Ga0105250_100226972 181
45 3300009092 Ga0105250_10030102 Ga0105250_100301022 181
46 3300009148 Ga0105243_10005026 Ga0105243_100050263 181
47 3300009148 Ga0105243_10039741 Ga0105243_100397413 181
48 3300009148 Ga0105243_10040122 Ga0105243_100401223 181
49 3300009545 Ga0105237_10009591 Ga0105237_100095914 181
50 3300011119 Ga0105246_10009506 Ga0105246_100095063 181
51 3300011119 Ga0105246_10021307 Ga0105246_100213072 181
52 3300013100 Ga0157373_10019869 Ga0157373_100198693 181
53 3300013100 Ga0157373_10027148 Ga0157373_100271483 181
54 3300013100 Ga0157373_10090681 Ga0157373_100906813 181
55 3300013100 Ga0157373_10275456 Ga0157373_102754562 181
56 3300013102 Ga0157371_10008494 Ga0157371_100084942 181
57 3300013102 Ga0157371_10442774 Ga0157371_104427742 181
58 3300013104 Ga0157370_10060291 Ga0157370_100602913 181
59 3300013104 Ga0157370_10159051 Ga0157370_101590513 181
60 3300013104 Ga0157370_10432630 Ga0157370_104326302 181
61 3300013104 Ga0157370_10569212 Ga0157370_105692122 181
62 3300013104 Ga0157370_10721852 Ga0157370_107218521 181
63 3300013105 Ga0157369_10036306 Ga0157369_100363063 181
64 3300013105 Ga0157369_10647321 Ga0157369_106473212 181
65 3300013306 Ga0163162_10401095 Ga0163162_104010952 181
66 3300014497 Ga0182008_10002273 Ga0182008_100022733 181
67 3300014497 Ga0182008_10214267 Ga0182008_102142672 181
68 3300015261 Ga0182006_1014804 Ga0182006_10148043 181
69 3300015262 Ga0182007_10102366 Ga0182007_101023661 181
70 3300015265 Ga0182005_1005744 Ga0182005_10057442 181
71 3300015265 Ga0182005_1075029 Ga0182005_10750292 181
72 3300017792 Ga0163161_10002513 Ga0163161_100025138 181
73 3300017792 Ga0163161_10008499 Ga0163161_100084993 181
74 3300025291 Ga0209675_1008637 Ga0209675_10086372 181
75 3300025292 Ga0209676_1000025 Ga0209676_1000025412 181
76 3300025298 Ga0209050_1000099 Ga0209050_100009958 181
77 3300025303 Ga0209051_1000026 Ga0209051_1000026207 181
78 3300025304 Ga0209257_1000034 Ga0209257_1000034412 181
79 3300025321 Ga0207656_10000008 Ga0207656_1000000887 181
80 3300025711 Ga0207696_1000020 Ga0207696_1000020190 181
81 3300025711 Ga0207696_1002256 Ga0207696_10022563 181
82 3300025711 Ga0207696_1018956 Ga0207696_10189563 181
83 3300025711 Ga0207696_1037790 Ga0207696_10377902 181
84 3300025728 Ga0207655_1000310 Ga0207655_100031016 181
85 3300025728 Ga0207655_1000453 Ga0207655_100045326 181
86 3300025728 Ga0207655_1012873 Ga0207655_10128732 181
87 3300025735 Ga0207713_1000032 Ga0207713_1000032186 181
88 3300025735 Ga0207713_1000225 Ga0207713_100022523 181
89 3300025735 Ga0207713_1004147 Ga0207713_10041472 181
90 3300025735 Ga0207713_1014684 Ga0207713_10146843 181
91 3300025735 Ga0207713_1054260 Ga0207713_10542602 181
92 3300025914 Ga0207671_10040515 Ga0207671_100405153 181
93 3300025923 Ga0207681_10000048 Ga0207681_1000004824 181
94 3300025923 Ga0207681_10000267 Ga0207681_1000026721 181
95 3300025925 Ga0207650_10001072 Ga0207650_1000107211 181
96 3300025933 Ga0207706_10000374 Ga0207706_1000037420 181
97 3300025935 Ga0207709_10000040 Ga0207709_10000040166 181
98 3300025935 Ga0207709_10008336 Ga0207709_100083362 181
99 3300025945 Ga0207679_10037604 Ga0207679_100376042 181
100 3300026041 Ga0207639_10000392 Ga0207639_1000039212 181
101 3300027360 Ga0209969_1034154 Ga0209969_10341541 181
102 3300027395 Ga0209996_1000469 Ga0209996_10004693 181
103 3300027471 Ga0209995_1001898 Ga0209995_10018983 181
104 3300027526 Ga0209968_1007645 Ga0209968_10076452 181
105 3300027543 Ga0209999_1002473 Ga0209999_10024733 181
106 3300027617 Ga0210002_1027393 Ga0210002_10273932 181
107 3300027665 Ga0209983_1004755 Ga0209983_10047553 181
108 3300027682 Ga0209971_1000485 Ga0209971_100048510 181
109 3300027876 Ga0209974_10011289 Ga0209974_100112893 181
110 3300027907 Ga0207428_10190792 Ga0207428_101907922 181
111 3300027907 Ga0207428_10242571 Ga0207428_102425711 181
112 3300030521 Ga0307511_10045857 Ga0307511_100458573 181
113 3300030733 Ga0314311_1262426 Ga0314311_12624268 181
114 3300030742 Ga0316183_1211848 Ga0316183_12118482 181
115 3300031250 Ga0265331_10192145 Ga0265331_101921452 181
116 3300031548 Ga0307408_100005361 Ga0307408_1000053615 181
117 3300031548 Ga0307408_100730587 Ga0307408_1007305872 181
118 3300031730 Ga0307516_10532119 Ga0307516_105321191 181
119 3300031731 Ga0307405_10000725 Ga0307405_100007256 181
120 3300031731 Ga0307405_10000811 Ga0307405_100008117 181
121 3300031824 Ga0307413_10015240 Ga0307413_100152403 181
122 3300031824 Ga0307413_10611503 Ga0307413_106115032 181
123 3300031901 Ga0307406_10005461 Ga0307406_100054614 181
124 3300031903 Ga0307407_10048245 Ga0307407_100482452 181
125 3300031903 Ga0307407_10138151 Ga0307407_101381512 181
126 3300031911 Ga0307412_10000424 Ga0307412_1000042418 181
127 3300031911 Ga0307412_10040586 Ga0307412_100405862 181
128 3300031995 Ga0307409_100602962 Ga0307409_1006029621 181
129 3300032002 Ga0307416_100047922 Ga0307416_1000479222 181
130 3300032004 Ga0307414_10023636 Ga0307414_100236362 181
131 3300035170 Ga0373943_0269102 Ga0373943_0269102_32_586 181
132 3300035695 Ga0373927_0045856 Ga0373927_0045856_1536_2090 181
133 3300037068 Ga0373925_0074355 Ga0373925_0074355_606_1160 181
134 3300038705 Ga0237819_07788 Ga0237819_07788_39_620 181
135 3300041404 Ga0439436_0108509 Ga0439436_0108509_219_764 181
136 3300041405 Ga0439438_000416 Ga0439438_000416_15793_16338 181
137 3300041405 Ga0439438_008668 Ga0439438_008668_2202_2747 181
138 3300041407 Ga0439447_010317 Ga0439447_010317_1842_2387 181
139 3300041407 Ga0439447_011863 Ga0439447_011863_699_1244 181
140 3300041407 Ga0439447_022330 Ga0439447_022330_330_878 181
141 3300041407 Ga0439447_029691 Ga0439447_029691_159_704 181
142 3300041411 Ga0439466_0004770 Ga0439466_0004770_369_914 181
143 3300041411 Ga0439466_0007514 Ga0439466_0007514_681_1229 181
144 3300041411 Ga0439466_0021637 Ga0439466_0021637_519_1064 181
145 3300041411 Ga0439466_0035919 Ga0439466_0035919_375_920 181
146 3300041411 Ga0439466_0041030 Ga0439466_0041030_923_1468 181
147 3300041413 Ga0439465_0002232 Ga0439465_0002232_975_1520 181
148 3300042004 Ga0439445_0006461 Ga0439445_0006461_931_1479 181
149 3300042006 Ga0439432_006121 Ga0439432_006121_1140_1688 181
150 3300042006 Ga0439432_019258 Ga0439432_019258_670_1215 181
151 3300042009 Ga0439451_005286 Ga0439451_005286_1605_2150 181
152 3300042009 Ga0439451_026586 Ga0439451_026586_53_598 181
153 3300042009 Ga0439451_030119 Ga0439451_030119_427_972 181
154 3300042009 Ga0439451_056793 Ga0439451_056793_27_572 181
155 3300042010 Ga0439452_002846 Ga0439452_002846_2593_3138 181
156 3300042010 Ga0439452_006619 Ga0439452_006619_1227_1772 181
157 3300042010 Ga0439452_006849 Ga0439452_006849_572_1117 181
158 3300042010 Ga0439452_032970 Ga0439452_032970_293_838 181
159 3300042013 Ga0439456_003504 Ga0439456_003504_1305_1850 181
160 3300042013 Ga0439456_016742 Ga0439456_016742_174_719 181
161 3300042013 Ga0439456_066640 Ga0439456_066640_70_615 181
162 3300042016 Ga0439463_000136 Ga0439463_000136_11399_11944 181
163 3300042115 Ga0450911_001020 Ga0450911_001020_2689_3234 181
164 3300042124 Ga0450922_001017 Ga0450922_001017_2128_2673 181
165 3300042125 Ga0450923_013260 Ga0450923_013260_637_1182 181
166 3300042127 Ga0450890_000142 Ga0450890_000142_2224_2769 181
167 3300042137 Ga0450902_024102 Ga0450902_024102_273_818 181
168 3300042138 Ga0450903_023834 Ga0450903_023834_255_800 181
169 3300042139 Ga0450904_003084 Ga0450904_003084_134_679 181
170 3300042144 Ga0450889_001105 Ga0450889_001105_766_1311 181
171 3300042146 Ga0450907_001964 Ga0450907_001964_691_1236 181
172 3300042147 Ga0450910_000099 Ga0450910_000099_1964_2509 181
173 3300042147 Ga0450910_031953 Ga0450910_031953_244_789 181
174 3300042156 Ga0439446_0000812 Ga0439446_0000812_2804_3349 181
175 3300042156 Ga0439446_0000865 Ga0439446_0000865_5150_5695 181
176 3300042156 Ga0439446_0045722 Ga0439446_0045722_339_884 181
177 3300042184 Ga0450908_000147 Ga0450908_000147_6473_7018 181
178 3300042184 Ga0450908_015554 Ga0450908_015554_227_775 181
179 3300042184 Ga0450908_028822 Ga0450908_028822_252_797 181
180 3300042185 Ga0450909_051059 Ga0450909_051059_31_576 181
181 3300042435 Ga0439434_0002018 Ga0439434_0002018_5048_5593 181
182 3300042435 Ga0439434_0003912 Ga0439434_0003912_3557_4102 181
183 3300042439 Ga0439464_0028182 Ga0439464_0028182_721_1266 181
184 3300042461 Ga0439460_0002283 Ga0439460_0002283_3901_4446 181
185 3300042461 Ga0439460_0022495 Ga0439460_0022495_523_1068 181
186 3300042532 Ga0450893_0000829 Ga0450893_0000829_2907_3452 181
187 3300045051 Ga0451576_0003050 Ga0451576_0003050_14555_15103 181
188 3300046452 Ga0495617_013518 Ga0495617_013518_1334_1915 181
189 3300046452 Ga0495617_077789 Ga0495617_077789_101_646 181
190 3300046453 Ga0495627_000404 Ga0495627_000404_22544_23089 181
191 3300046455 Ga0495603_0004532 Ga0495603_0004532_4863_5408 181
192 3300046457 Ga0495590_0001930 Ga0495590_0001930_5471_6052 181
193 3300046463 Ga0495653_0190746 Ga0495653_0190746_410_955 181
194 3300046471 Ga0495650_0006679 Ga0495650_0006679_1371_1952 181
195 3300046471 Ga0495650_0107378 Ga0495650_0107378_244_825 181
196 3300046474 Ga0495605_0057939 Ga0495605_0057939_1007_1552 181
197 3300046474 Ga0495605_0099791 Ga0495605_0099791_360_911 181
198 3300046475 Ga0495639_0061019 Ga0495639_0061019_944_1489 181
199 3300046491 Ga0495584_0002240 Ga0495584_0002240_852_1433 181
200 3300046491 Ga0495584_0149767 Ga0495584_0149767_362_943 181
201 3300046491 Ga0495584_0240017 Ga0495584_0240017_11_556 181
202 3300046492 Ga0495585_0042029 Ga0495585_0042029_204_785 181
203 3300046501 Ga0495607_0000050 Ga0495607_0000050_77706_78254 181
204 3300046501 Ga0495607_0000392 Ga0495607_0000392_20580_21161 181
205 3300046501 Ga0495607_0015842 Ga0495607_0015842_3891_4436 181
206 3300046501 Ga0495607_0103822 Ga0495607_0103822_331_876 181
207 3300046506 Ga0495583_0001901 Ga0495583_0001901_8609_9154 181
208 3300046506 Ga0495583_0148941 Ga0495583_0148941_402_947 181
209 3300046507 Ga0495606_0267217 Ga0495606_0267217_228_809 181
210 3300046512 Ga0495610_0095060 Ga0495610_0095060_764_1309 181
211 3300046515 Ga0495620_0002007 Ga0495620_0002007_3792_4373 181
212 3300046515 Ga0495620_0101053 Ga0495620_0101053_130_675 181
213 3300046518 Ga0495631_0000166 Ga0495631_0000166_25118_25699 181
214 3300046519 Ga0495632_0000532 Ga0495632_0000532_1275_1856 181
215 3300046519 Ga0495632_0066113 Ga0495632_0066113_1006_1587 181
216 3300046519 Ga0495632_0088868 Ga0495632_0088868_677_1246 181
217 3300046520 Ga0495637_0023056 Ga0495637_0023056_1346_1891 181
218 3300046520 Ga0495637_0024798 Ga0495637_0024798_282_863 181
219 3300046522 Ga0495643_0000275 Ga0495643_0000275_18531_19076 181
220 3300046522 Ga0495643_0002468 Ga0495643_0002468_12746_13291 181
221 3300046522 Ga0495643_0013879 Ga0495643_0013879_964_1509 181
222 3300046524 Ga0495648_0000533 Ga0495648_0000533_20647_21315 181
223 3300046524 Ga0495648_0003581 Ga0495648_0003581_9544_10095 181
224 3300046524 Ga0495648_0011192 Ga0495648_0011192_5012_5557 181
225 3300046524 Ga0495648_0013605 Ga0495648_0013605_1540_2121 181
226 3300046526 Ga0495666_0231145 Ga0495666_0231145_122_670 181
227 3300046528 Ga0495642_0000609 Ga0495642_0000609_9525_10106 181
228 3300046529 Ga0495652_0304065 Ga0495652_0304065_54_602 181
229 3300046530 Ga0495654_0005823 Ga0495654_0005823_5826_6377 181
230 3300046530 Ga0495654_0006537 Ga0495654_0006537_4621_5202 181
231 3300046530 Ga0495654_0039508 Ga0495654_0039508_869_1414 181
232 3300046530 Ga0495654_0055966 Ga0495654_0055966_311_856 181
233 3300046530 Ga0495654_0099307 Ga0495654_0099307_643_1311 181
234 3300046530 Ga0495654_0158800 Ga0495654_0158800_182_727 181
235 3300046535 Ga0495586_0001759 Ga0495586_0001759_6310_6855 181
236 3300046536 Ga0495587_0010981 Ga0495587_0010981_1732_2277 181
237 3300046538 Ga0495609_0002121 Ga0495609_0002121_2896_3477 181
238 3300046538 Ga0495609_0015416 Ga0495609_0015416_1176_1721 181
239 3300046538 Ga0495609_0026290 Ga0495609_0026290_14_811 181
240 3300046542 Ga0495597_0007602 Ga0495597_0007602_2733_3278 181
241 3300046542 Ga0495597_0050064 Ga0495597_0050064_476_1021 181
242 3300046543 Ga0495645_0103669 Ga0495645_0103669_1230_1778 181
243 3300046558 Ga0495633_0001098 Ga0495633_0001098_1849_2430 181
244 3300046558 Ga0495633_0129780 Ga0495633_0129780_566_1147 181
245 3300046558 Ga0495633_0176077 Ga0495633_0176077_216_761 181
246 3300046642 Ga0495634_0001907 Ga0495634_0001907_10224_10769 181
247 3300046660 Ga0495625_0050714 Ga0495625_0050714_1421_1966 181
248 3300046660 Ga0495625_0055452 Ga0495625_0055452_2267_2812 181
249 3300046663 Ga0495635_0000980 Ga0495635_0000980_530_1075 181
250 3300046663 Ga0495635_0003024 Ga0495635_0003024_1855_2400 181
251 3300046665 Ga0495661_0000036 Ga0495661_0000036_101515_102060 181
252 3300046665 Ga0495661_0065126 Ga0495661_0065126_916_1461 181
253 3300046665 Ga0495661_0219601 Ga0495661_0219601_216_797 181
254 3300046679 Ga0495623_0044048 Ga0495623_0044048_1818_2363 181
255 3300046680 Ga0495646_0070608 Ga0495646_0070608_444_989 181
256 3300046690 Ga0495624_0552305 Ga0495624_0552305_108_662 181
257 3300046691 Ga0495670_0216787 Ga0495670_0216787_330_911 181
258 3300046692 Ga0495671_0007315 Ga0495671_0007315_914_1459 181
259 3300046692 Ga0495671_0019071 Ga0495671_0019071_950_1495 181
260 3300046692 Ga0495671_0021532 Ga0495671_0021532_1218_1763 181
261 3300046692 Ga0495671_0052969 Ga0495671_0052969_404_964 181
262 3300046694 Ga0495649_0000264 Ga0495649_0000264_34395_34976 181
263 3300046694 Ga0495649_0091910 Ga0495649_0091910_946_1491 181
264 3300046694 Ga0495649_0157313 Ga0495649_0157313_196_741 181
265 3300046794 Ga0495589_0014845 Ga0495589_0014845_2671_3216 181
266 3300046810 Ga0495660_0013823 Ga0495660_0013823_648_1193 181
267 3300046810 Ga0495660_0016547 Ga0495660_0016547_3532_4092 181
268 3300046810 Ga0495660_0061335 Ga0495660_0061335_225_806 181
269 3300047315 Ga0495581_0020870 Ga0495581_0020870_3187_3732 181
270 3300047317 Ga0495604_0001430 Ga0495604_0001430_4162_4707 181
271 3300047317 Ga0495604_0005281 Ga0495604_0005281_4758_5303 181
272 3300047318 Ga0495636_0003070 Ga0495636_0003070_455_1036 181
273 3300047319 Ga0495674_0009079 Ga0495674_0009079_3533_4078 181
274 3300047320 Ga0495672_0005108 Ga0495672_0005108_1790_2371 181
275 3300047322 Ga0495680_0005273 Ga0495680_0005273_1785_2330 181
276 3300047322 Ga0495680_0010953 Ga0495680_0010953_6528_7073 181
277 3300047443 Ga0495687_001663 Ga0495687_001663_9742_10323 181
278 3300047444 Ga0495675_0149298 Ga0495675_0149298_506_1051 181
279 3300047446 Ga0495679_000745 Ga0495679_000745_6070_6615 181
280 3300047447 Ga0495685_045137 Ga0495685_045137_776_1321 181
281 3300047469 Ga0495673_0000558 Ga0495673_0000558_17999_18580 181
282 3300047469 Ga0495673_0037676 Ga0495673_0037676_1219_1764 181
283 3300047470 Ga0495681_0013673 Ga0495681_0013673_2758_3339 181
284 3300047470 Ga0495681_0036389 Ga0495681_0036389_1111_1656 181
285 3300047470 Ga0495681_0284791 Ga0495681_0284791_13_558 181
286 3300047471 Ga0495684_0276009 Ga0495684_0276009_247_792 181
287 3300047673 Ga0495593_0097354 Ga0495593_0097354_162_707 181
288 3300048089 Ga0495614_0378048 Ga0495614_0378048_95_640 181
289 3300048091 Ga0495626_0003535 Ga0495626_0003535_8116_8697 181
290 3300048091 Ga0495626_0018116 Ga0495626_0018116_2185_2730 181
291 3300048091 Ga0495626_0056026 Ga0495626_0056026_417_965 181
292 3300048091 Ga0495626_0080373 Ga0495626_0080373_116_676 181
293 3300048905 Ga0496102_0000893 Ga0496102_0000893_9646_10191 181
294 3300048906 Ga0496103_0021720 Ga0496103_0021720_1988_2533 181
295 3300048915 Ga0496112_0089834 Ga0496112_0089834_1941_2489 181
296 3300048917 Ga0496114_0002923 Ga0496114_0002923_3777_4322 181
297 3300048919 Ga0496116_0010789 Ga0496116_0010789_1516_2061 181
298 3300048920 Ga0496117_0030979 Ga0496117_0030979_1729_2274 181
299 3300048920 Ga0496117_0053541 Ga0496117_0053541_105_650 181
300 3300048920 Ga0496117_0093423 Ga0496117_0093423_964_1554 181
301 3300048920 Ga0496117_0174527 Ga0496117_0174527_622_1215 181
302 3300048921 Ga0496118_0006950 Ga0496118_0006950_9885_10430 181
303 3300048921 Ga0496118_0088339 Ga0496118_0088339_1104_1649 181
304 3300048921 Ga0496118_0143423 Ga0496118_0143423_523_1113 181
305 3300048922 Ga0496119_0054890 Ga0496119_0054890_1087_1632 181
306 3300048922 Ga0496119_0102072 Ga0496119_0102072_162_707 181
307 3300048923 Ga0496120_0008011 Ga0496120_0008011_283_828 181
308 3300048923 Ga0496120_0030399 Ga0496120_0030399_465_1010 181
309 3300048924 Ga0496121_0045292 Ga0496121_0045292_2521_3102 181
310 3300048924 Ga0496121_0106680 Ga0496121_0106680_217_762 181
311 3300048925 Ga0496122_0087651 Ga0496122_0087651_64_609 181
312 3300048927 Ga0496124_0000073 Ga0496124_0000073_74549_75094 181
313 3300048927 Ga0496124_0001240 Ga0496124_0001240_19572_20117 181
314 3300048927 Ga0496124_0055552 Ga0496124_0055552_907_1452 181
315 3300048927 Ga0496124_0058772 Ga0496124_0058772_1324_1905 181
316 3300048927 Ga0496124_0111989 Ga0496124_0111989_1016_1561 181
317 3300048927 Ga0496124_0582662 Ga0496124_0582662_74_619 181
318 3300048928 Ga0496125_0001137 Ga0496125_0001137_20971_21516 181
319 3300048928 Ga0496125_0003636 Ga0496125_0003636_10181_10762 181
320 3300048928 Ga0496125_0055938 Ga0496125_0055938_459_1004 181
321 3300048929 Ga0496126_0121316 Ga0496126_0121316_1074_1619 181
322 3300049459 Ga0495678_002588 Ga0495678_002588_2183_2728 181
323 3300049459 Ga0495678_003090 Ga0495678_003090_8576_9157 181
324 3300049460 Ga0495682_0000260 Ga0495682_0000260_9710_10258 181
325 3300049460 Ga0495682_0105485 Ga0495682_0105485_19_600 181
326 3300049662 Ga0501222_003694 Ga0501222_003694_1220_1768 181
327 3300049686 Ga0501257_129340 Ga0501257_129340_101_649 181
328 3300050493 nmdc:mga0k408_121764_c1 nmdc:mga0k408_121764_c1_441_992 181
329 3300050493 nmdc:mga0k408_2282_c1 nmdc:mga0k408_2282_c1_2701_3252 181
330 3300053125 Ga0500618_008341 Ga0500618_008341_1007_1552 181
331 3300053161 Ga0500634_0055230 Ga0500634_0055230_388_933 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

46

217

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9814 1 181
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9761 2 177
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.976 1 181
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.9735 2 180
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.973 1 181
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9727 2 181 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9588 1 181 2.60.120.10
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9585 8 177 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.957 2 181 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9566 1 176 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3G7WUY6-F1-model_v4 deleted 0.999 1 181
AF-A0A7C8XNS0-F1-model_v4 deleted 0.9989 44 167
AF-A0A432R1U7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9987 45 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7Y8G877-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9984 1 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A0A1Z6A3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9984 1 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
95.74 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map