F410569

General Info

Members Datasets Scaffolds Average Seq Length
331 217 331 204

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0000310|Ga0373934_0000310_9399_10025
Length 208
Sequence VKLRTTLLALGLTFPATAFAGAQIYEPLAAEVRAGLQASIADKPTQHAFKNMEAAVDWLTEMSQRLGSKIPDFESRVQFLRTVHFEATRARVDPQLVLALIQVESGFRKYAVSRSGARGYMQVMPFWVGLIGRPGDNLFNLRNNLRYGCVILKYYLDAEKGDLQRALARYNGSLGKSNYPNLVIGAWRSTWHYQGRLTYLPDTGFGRT

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.3
Rhizosphere 99.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100363366 3300005330 Unclassified 1054
2 Ga0068869_100000173 3300005334 Bacteria 32748
3 Ga0070680_100005731 3300005336 Bacteria 9423
4 Ga0070682_100018005 3300005337 Bacteria 4122
5 Ga0068868_100000510 3300005338 Bacteria 25961
6 Ga0070689_100000268 3300005340 Bacteria 30093
7 Ga0070691_10002480 3300005341 Bacteria 8204
8 Ga0070691_10080730 3300005341 Bacteria 1592
9 Ga0070687_100000048 3300005343 Bacteria 38178
10 Ga0070692_10011786 3300005345 Bacteria 4027
11 Ga0070692_10143384 3300005345 Bacteria 1354
12 Ga0070673_100167776 3300005364 Bacteria 1872
13 Ga0070688_100101475 3300005365 Bacteria 1898
14 Ga0070701_10000094 3300005438 Bacteria 24873
15 Ga0070705_100000061 3300005440 Bacteria 56772
16 Ga0070700_100000690 3300005441 Bacteria 16656
17 Ga0070700_100018135 3300005441 Bacteria 4041
18 Ga0070694_100000087 3300005444 Bacteria 43937
19 Ga0070694_100028746 3300005444 Bacteria 3620
20 Ga0070694_100118443 3300005444 Bacteria 1897
21 Ga0070678_100075703 3300005456 Bacteria 2533
22 Ga0068867_100000308 3300005459 Bacteria 32195
23 Ga0068867_100980218 3300005459 Bacteria 765
24 Ga0070679_100044832 3300005530 Bacteria 4406
25 Ga0070697_100544332 3300005536 Bacteria 1018
26 Ga0068853_100527457 3300005539 Bacteria 1117
27 Ga0070686_100000348 3300005544 Bacteria 29898
28 Ga0070695_100000991 3300005545 Bacteria 15439
29 Ga0070695_100066800 3300005545 Bacteria 2344
30 Ga0070696_100000013 3300005546 Bacteria 78718
31 Ga0070696_100377960 3300005546 Bacteria 1103
32 Ga0070693_100000003 3300005547 Bacteria 95793
33 Ga0070704_100000029 3300005549 Bacteria 47486
34 Ga0068855_100008704 3300005563 Bacteria 12270
35 Ga0068854_100008305 3300005578 Bacteria 6668
36 Ga0070702_100000067 3300005615 Bacteria 29275
37 Ga0068852_100072545 3300005616 Bacteria 3026
38 Ga0068859_100001987 3300005617 Bacteria 20874
39 Ga0068866_10000437 3300005718 Bacteria 19319
40 Ga0068861_100000135 3300005719 Bacteria 38189
41 Ga0068870_10039047 3300005840 Bacteria 2455
42 Ga0068858_100001335 3300005842 Bacteria 25445
43 Ga0068860_100000929 3300005843 Bacteria 32389
44 Ga0068862_100001963 3300005844 Bacteria 18651
45 Ga0070715_10078672 3300006163 Bacteria 1491
46 Ga0070716_100046932 3300006173 Bacteria 2434
47 Ga0097621_100000024 3300006237 Bacteria 81390
48 Ga0097621_100012183 3300006237 Bacteria 6364
49 Ga0068871_100001309 3300006358 Bacteria 16656
50 Ga0075431_100661923 3300006847 Bacteria 1024
51 Ga0075433_10122991 3300006852 Bacteria 2305
52 Ga0075433_10309295 3300006852 Bacteria 1399
53 Ga0075434_100018240 3300006871 Bacteria 6777
54 Ga0075429_100001307 3300006880 Bacteria 20302
55 Ga0068865_100000207 3300006881 Bacteria 32741
56 Ga0075436_100015929 3300006914 Bacteria 5146
57 Ga0075436_100037968 3300006914 Bacteria 3325
58 Ga0075436_100059824 3300006914 Bacteria 2632
59 Ga0075436_100268217 3300006914 Bacteria 1218
60 Ga0097620_100001987 3300006931 Bacteria 20874
61 Ga0075435_100008098 3300007076 Bacteria 7527
62 Ga0075435_100929358 3300007076 Bacteria 759
63 Ga0099794_10388081 3300007265 Bacteria 729
64 Ga0099795_10042452 3300007788 Bacteria 1623
65 Ga0105245_10000544 3300009098 Bacteria 34380
66 Ga0105245_10037385 3300009098 Bacteria 4315
67 Ga0114129_10003063 3300009147 Bacteria 23443
68 Ga0105243_10000339 3300009148 Bacteria 51082
69 Ga0105243_10819947 3300009148 Bacteria 919
70 Ga0105241_10024923 3300009174 Bacteria 4444
71 Ga0105242_10000416 3300009176 Bacteria 33943
72 Ga0105242_10064586 3300009176 Bacteria 3018
73 Ga0105248_10247346 3300009177 Bacteria 2007
74 Ga0105238_10044789 3300009551 Bacteria 4471
75 Ga0105238_10937327 3300009551 Bacteria 885
76 Ga0105249_10004765 3300009553 Bacteria 11702
77 Ga0099796_10017691 3300010159 Bacteria 2127
78 Ga0105239_10013820 3300010375 Bacteria 8958
79 Ga0157337_1008928 3300012483 Bacteria 747
80 Ga0157374_10376850 3300013296 Bacteria 1413
81 Ga0157378_10001176 3300013297 Bacteria 23804
82 Ga0163162_10460322 3300013306 Bacteria 1403
83 Ga0157380_10108386 3300014326 Bacteria 2328
84 Ga0157380_10345990 3300014326 Bacteria 1389
85 Ga0157379_10087855 3300014968 Bacteria 2787
86 Ga0157376_10023183 3300014969 Bacteria 4855
87 Ga0207653_10004359 3300025885 Bacteria 4442
88 Ga0207642_10000618 3300025899 Bacteria 10951
89 Ga0207643_10006018 3300025908 Bacteria 6483
90 Ga0207654_10007456 3300025911 Bacteria 5510
91 Ga0207707_10108181 3300025912 Bacteria 2431
92 Ga0207707_10399099 3300025912 Bacteria 1181
93 Ga0207660_10003082 3300025917 Bacteria 10889
94 Ga0207660_10045334 3300025917 Bacteria 3098
95 Ga0207662_10000034 3300025918 Bacteria 60878
96 Ga0207652_10014909 3300025921 Bacteria 6302
97 Ga0207659_10673669 3300025926 Bacteria 885
98 Ga0207687_10001364 3300025927 Bacteria 16705
99 Ga0207686_10001176 3300025934 Bacteria 15118
100 Ga0207686_10077623 3300025934 Bacteria 2157
101 Ga0207709_10000297 3300025935 Bacteria 55386
102 Ga0207709_10619799 3300025935 Bacteria 858
103 Ga0207670_10001671 3300025936 Bacteria 11563
104 Ga0207704_10001437 3300025938 Bacteria 10648
105 Ga0207665_10066919 3300025939 Bacteria 2446
106 Ga0207691_10206388 3300025940 Bacteria 1708
107 Ga0207711_10133706 3300025941 Bacteria 2226
108 Ga0207711_10484617 3300025941 Bacteria 1152
109 Ga0207689_10000336 3300025942 Bacteria 43682
110 Ga0207667_10006876 3300025949 Bacteria 13742
111 Ga0207640_10001441 3300025981 Bacteria 12866
112 Ga0207703_10002827 3300026035 Bacteria 14818
113 Ga0207639_10438888 3300026041 Bacteria 1183
114 Ga0207708_10000048 3300026075 Bacteria 114754
115 Ga0207702_10017023 3300026078 Bacteria 6015
116 Ga0207648_10000519 3300026089 Bacteria 43028
117 Ga0207648_10017632 3300026089 Bacteria 6485
118 Ga0207675_100000464 3300026118 Bacteria 39538
119 Ga0207698_10088618 3300026142 Bacteria 2524
120 Ga0209969_1006468 3300027360 Bacteria 1651
121 Ga0209996_1007683 3300027395 Bacteria 1407
122 Ga0209995_1005986 3300027471 Bacteria 1957
123 Ga0209968_1007769 3300027526 Bacteria 1626
124 Ga0209971_1004757 3300027682 Bacteria 3223
125 Ga0207428_10000748 3300027907 Bacteria 37159
126 Ga0268265_10001624 3300028380 Bacteria 18508
127 Ga0268264_10000423 3300028381 Bacteria 59146
128 Ga0265336_10002226 3300028666 Bacteria 8154
129 Ga0265336_10067824 3300028666 Bacteria 1067
130 Ga0265324_10000002 3300029957 Bacteria 382754
131 Ga0265324_10002313 3300029957 Bacteria 9882
132 Ga0265324_10108466 3300029957 Bacteria 943
133 Ga0265324_10138185 3300029957 Bacteria 827
134 Ga0265330_10008022 3300031235 Bacteria 5113
135 Ga0265332_10011352 3300031238 Bacteria 3960
136 Ga0265328_10024132 3300031239 Bacteria 2300
137 Ga0265325_10002066 3300031241 Bacteria 13759
138 Ga0265325_10245744 3300031241 Bacteria 812
139 Ga0265331_10003938 3300031250 Bacteria 9384
140 Ga0265331_10005696 3300031250 Bacteria 7475
141 Ga0265331_10051689 3300031250 Bacteria 1966
142 Ga0265331_10080403 3300031250 Bacteria 1515
143 Ga0265331_10082944 3300031250 Bacteria 1487
144 Ga0265327_10001224 3300031251 Bacteria 34492
145 Ga0265327_10004904 3300031251 Bacteria 11551
146 Ga0265327_10014344 3300031251 Bacteria 5191
147 Ga0265316_10038233 3300031344 Bacteria 3868
148 Ga0265316_10118384 3300031344 Bacteria 2002
149 Ga0265314_10004039 3300031711 Bacteria 13869
150 Ga0265314_10017586 3300031711 Bacteria 5606
151 Ga0307416_100436445 3300032002 Bacteria 1358
152 Ga0373930_0047884 3300034816 Bacteria 926
153 Ga0373926_0007026 3300035083 Bacteria 3744
154 Ga0373934_0000310 3300035086 Bacteria 17068
155 Ga0373934_0017274 3300035086 Bacteria 2752
156 Ga0373944_0021963 3300035089 Bacteria 1851
157 Ga0373951_0002305 3300035091 Bacteria 4845
158 Ga0373951_0074918 3300035091 Bacteria 868
159 Ga0373923_0120539 3300035111 Bacteria 1172
160 Ga0373936_0018914 3300035113 Bacteria 2665
161 Ga0373936_0067176 3300035113 Bacteria 1473
162 Ga0373939_0072232 3300035114 Bacteria 1126
163 Ga0373945_0013502 3300035116 Bacteria 2727
164 Ga0373945_0017953 3300035116 Bacteria 2402
165 Ga0373953_0231002 3300035117 Unclassified 802
166 Ga0373954_0008567 3300035118 Bacteria 4496
167 Ga0373956_0000428 3300035119 Bacteria 17130
168 Ga0373956_0076394 3300035119 Bacteria 1532
169 Ga0373956_0243232 3300035119 Bacteria 855
170 Ga0373957_0002458 3300035120 Bacteria 5295
171 Ga0373943_0015943 3300035170 Bacteria 3421
172 Ga0373946_0083831 3300035171 Bacteria 1401
173 Ga0373955_0005800 3300035172 Bacteria 5575
174 Ga0373931_0002594 3300035691 Bacteria 8053
175 Ga0373931_0069123 3300035691 Bacteria 1924
176 Ga0373931_0137448 3300035691 Bacteria 1412
177 Ga0373935_0027700 3300035692 Bacteria 3502
178 Ga0373935_0453649 3300035692 Bacteria 926
179 Ga0373927_0070922 3300035695 Bacteria 2255
180 Ga0373933_0000632 3300035724 Bacteria 21965
181 Ga0373937_0000371 3300036401 Bacteria 41765
182 Ga0373937_0029221 3300036401 Bacteria 4992
183 Ga0373937_0368152 3300036401 Bacteria 1362
184 Ga0373937_0582742 3300036401 Bacteria 1062
185 Ga0373925_0056418 3300037068 Bacteria 2942
186 Ga0450896_009450 3300042133 Bacteria 1358
187 Ga0439446_0033612 3300042156 Bacteria 1490
188 Ga0439435_0001698 3300042436 Bacteria 4159
189 Ga0451577_0000013 3300042876 Bacteria 550689
190 Ga0451577_0002441 3300042876 Bacteria 22169
191 Ga0451577_0009089 3300042876 Bacteria 9591
192 Ga0451577_0020031 3300042876 Bacteria 6143
193 Ga0451577_0101326 3300042876 Bacteria 2573
194 Ga0451577_0115421 3300042876 Bacteria 2404
195 Ga0451577_0336192 3300042876 Bacteria 1370
196 Ga0453683_0000059 3300044673 Bacteria 187158
197 Ga0453683_0059499 3300044673 Bacteria 2388
198 Ga0453683_0134722 3300044673 Bacteria 1557
199 Ga0453683_0528827 3300044673 Bacteria 766
200 Ga0453684_0000040 3300044712 Bacteria 690210
201 Ga0453684_0000085 3300044712 Bacteria 397817
202 Ga0453684_0001529 3300044712 Bacteria 64683
203 Ga0453684_0019085 3300044712 Bacteria 10467
204 Ga0453684_0027336 3300044712 Bacteria 8186
205 Ga0453684_0057667 3300044712 Bacteria 5024
206 Ga0453684_0062868 3300044712 Bacteria 4752
207 Ga0453684_0451583 3300044712 Bacteria 1431
208 Ga0453684_0569900 3300044712 Bacteria 1245
209 Ga0466960_0505054 3300044901 Bacteria 709
210 Ga0451576_0000013 3300045051 Bacteria 665120
211 Ga0451576_0000018 3300045051 Bacteria 550689
212 Ga0451576_0000220 3300045051 Bacteria 141261
213 Ga0451576_0001977 3300045051 Bacteria 32557
214 Ga0451576_0002261 3300045051 Bacteria 29427
215 Ga0451576_0002688 3300045051 Bacteria 25898
216 Ga0451576_0057736 3300045051 Bacteria 4057
217 Ga0451576_0119767 3300045051 Bacteria 2740
218 Ga0451576_0152782 3300045051 Bacteria 2407
219 Ga0451576_1466499 3300045051 Bacteria 709
220 Ga0466967_0233665 3300045976 Bacteria 1751
221 Ga0495592_0001655 3300046454 Bacteria 15626
222 Ga0495592_0012915 3300046454 Bacteria 6349
223 Ga0495603_0006622 3300046455 Bacteria 6950
224 Ga0495641_0010479 3300046461 Bacteria 5367
225 Ga0495651_0000056 3300046462 Bacteria 83191
226 Ga0495653_0074900 3300046463 Bacteria 2520
227 Ga0495580_0126246 3300046472 Bacteria 1775
228 Ga0495639_0001898 3300046475 Bacteria 9268
229 Ga0495639_0002795 3300046475 Bacteria 7590
230 Ga0495594_0181691 3300046499 Bacteria 1197
231 Ga0495608_0023227 3300046511 Bacteria 4250
232 Ga0495618_0165241 3300046514 Bacteria 1409
233 Ga0495628_0053758 3300046516 Bacteria 3176
234 Ga0495628_0136003 3300046516 Bacteria 1878
235 Ga0495630_0000139 3300046517 Bacteria 57204
236 Ga0495666_0009661 3300046526 Bacteria 4822
237 Ga0495666_0011157 3300046526 Bacteria 4483
238 Ga0495642_0064653 3300046528 Bacteria 1522
239 Ga0495652_0009814 3300046529 Bacteria 8680
240 Ga0495652_0028583 3300046529 Bacteria 4904
241 Ga0495652_0120977 3300046529 Bacteria 2088
242 Ga0495665_0024216 3300046531 Bacteria 3261
243 Ga0495640_0096765 3300046533 Bacteria 1941
244 Ga0495586_0001299 3300046535 Bacteria 13928
245 Ga0495586_0122644 3300046535 Bacteria 1452
246 Ga0495587_0251266 3300046536 Bacteria 994
247 Ga0495587_0326772 3300046536 Unclassified 856
248 Ga0495598_0012664 3300046537 Bacteria 2075
249 Ga0495645_0000629 3300046543 Bacteria 24231
250 Ga0495667_0011307 3300046559 Bacteria 6041
251 Ga0495667_0130713 3300046559 Bacteria 1619
252 Ga0495634_0142375 3300046642 Bacteria 1521
253 Ga0495635_0126449 3300046663 Bacteria 1743
254 Ga0495657_0014304 3300046675 Bacteria 5827
255 Ga0495657_0024434 3300046675 Bacteria 4304
256 Ga0495599_0001044 3300046678 Bacteria 15560
257 Ga0495599_0010627 3300046678 Bacteria 5634
258 Ga0495599_0031240 3300046678 Bacteria 3343
259 Ga0495599_0145848 3300046678 Bacteria 1467
260 Ga0495647_0000143 3300046681 Bacteria 18295
261 Ga0495647_0009032 3300046681 Bacteria 3363
262 Ga0495658_0002373 3300046683 Bacteria 9509
263 Ga0495669_0004659 3300046684 Bacteria 5684
264 Ga0495624_0073876 3300046690 Bacteria 2119
265 Ga0495600_0003884 3300046809 Bacteria 8870
266 Ga0495581_0042946 3300047315 Bacteria 2616
267 Ga0495604_0087524 3300047317 Bacteria 2320
268 Ga0495636_0006545 3300047318 Bacteria 4580
269 Ga0495676_0022759 3300047321 Bacteria 5448
270 Ga0495680_0112853 3300047322 Bacteria 2012
271 Ga0495675_0015904 3300047444 Bacteria 4757
272 Ga0495675_0298845 3300047444 Bacteria 956
273 Ga0495684_0035836 3300047471 Bacteria 3804
274 Ga0496106_0527343 3300048909 Bacteria 948
275 Ga0501031_0716685 3300049568 Bacteria 642
276 Ga0501034_0025211 3300049571 Bacteria 6052
277 Ga0501036_0184516 3300049572 Bacteria 1756
278 Ga0501036_0302034 3300049572 Bacteria 1339
279 Ga0501037_0211427 3300049573 Bacteria 1368
280 Ga0501038_0309944 3300049574 Bacteria 1237
281 Ga0501039_0149722 3300049575 Bacteria 1834
282 Ga0501039_0505016 3300049575 Bacteria 949
283 Ga0501039_0585816 3300049575 Bacteria 874
284 Ga0501040_0179675 3300049576 Bacteria 1500
285 Ga0501041_0095391 3300049577 Bacteria 1838
286 Ga0501042_0038721 3300049578 Bacteria 3386
287 Ga0501046_0361322 3300049580 Bacteria 1053
288 Ga0501048_0175204 3300049582 Bacteria 1520
289 Ga0501048_0519852 3300049582 Bacteria 854
290 Ga0501068_0163897 3300049584 Bacteria 1401
291 Ga0501070_0181714 3300049586 Bacteria 1731
292 Ga0501071_0163116 3300049587 Bacteria 1666
293 Ga0501071_0327497 3300049587 Bacteria 1164
294 Ga0501071_0364536 3300049587 Bacteria 1101
295 Ga0501071_0695487 3300049587 Bacteria 783
296 Ga0501072_0011354 3300049588 Bacteria 6808
297 Ga0501072_0025395 3300049588 Bacteria 4615
298 Ga0501072_0077849 3300049588 Bacteria 2626
299 Ga0501072_0559891 3300049588 Bacteria 902
300 Ga0501075_0492315 3300049591 Bacteria 935
301 Ga0501076_0455319 3300049592 Bacteria 1053
302 Ga0501079_0120326 3300049741 Bacteria 2042
303 Ga0501080_0113002 3300049742 Bacteria 2517
304 Ga0501081_0115819 3300049743 Bacteria 1905
305 Ga0501045_0018343 3300049824 Bacteria 4977
306 Ga0501045_0251589 3300049824 Bacteria 1315
307 nmdc:mga05p37_181348_c1 3300050507 Bacteria 2561
308 nmdc:mga05p37_467_c2 3300050507 Bacteria 32843
309 nmdc:mga09592_9873_c1 3300050508 Bacteria 7763
310 nmdc:mga0qj67_357597_c1 3300050509 Bacteria 1180
311 nmdc:mga0qj67_815940_c1 3300050509 Bacteria 738
312 nmdc:mga06r32_27893_c1 3300050510 Bacteria 5280
313 nmdc:mga06r32_590222_c1 3300050510 Bacteria 1082
314 nmdc:mga08y16_8490_c1 3300050511 Bacteria 10759
315 nmdc:mga0n895_609281_c1 3300050512 Bacteria 1094
316 nmdc:mga0n895_864525_c1 3300050512 Bacteria 891
317 nmdc:mga0rr50_245705_c1 3300050513 Bacteria 1485
318 nmdc:mga0rr50_4790_c1 3300050513 Bacteria 7987
319 nmdc:mga08x19_12569_c1 3300050514 Bacteria 5103
320 nmdc:mga08x19_16341_c1 3300050514 Bacteria 4525
321 nmdc:mga08x19_208891_c1 3300050514 Bacteria 1340
322 nmdc:mga08x19_54481_c1 3300050514 Bacteria 2575
323 nmdc:mga0a205_174121_c1 3300050515 Bacteria 2048
324 nmdc:mga0a205_20391_c1 3300050515 Bacteria 6253
325 Ga0495601_0001562 3300053077 Bacteria 12662
326 Ga0495601_0022367 3300053077 Bacteria 3880
327 Ga0495601_0173980 3300053077 Bacteria 1407
328 Ga0495595_0043204 3300053084 Bacteria 2066
329 Ga0501084_0089303 3300054114 Bacteria 2587
330 Ga0501084_0327153 3300054114 Bacteria 1294
331 Ga0590071_010908 3300059421 Bacteria 2125

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0181691 Ga0495594_0181691_37_615 190
2 3300049568 Ga0501031_0716685 Ga0501031_0716685_57_629 190
3 3300006914 Ga0075436_100037968 Ga0075436_1000379682 193
4 3300050512 nmdc:mga0n895_864525_c1 nmdc:mga0n895_864525_c1_45_677 193
5 3300050514 nmdc:mga08x19_54481_c1 nmdc:mga08x19_54481_c1_699_1331 193
6 3300046675 Ga0495657_0014304 Ga0495657_0014304_1981_2580 195
7 3300005341 Ga0070691_10080730 Ga0070691_100807302 196
8 3300005444 Ga0070694_100118443 Ga0070694_1001184433 196
9 3300005536 Ga0070697_100544332 Ga0070697_1005443321 196
10 3300006847 Ga0075431_100661923 Ga0075431_1006619232 196
11 3300006852 Ga0075433_10309295 Ga0075433_103092952 196
12 3300006871 Ga0075434_100018240 Ga0075434_1000182403 196
13 3300006914 Ga0075436_100015929 Ga0075436_1000159293 196
14 3300006914 Ga0075436_100059824 Ga0075436_1000598242 196
15 3300006914 Ga0075436_100268217 Ga0075436_1002682172 196
16 3300014326 Ga0157380_10345990 Ga0157380_103459901 196
17 3300027360 Ga0209969_1006468 Ga0209969_10064682 196
18 3300027395 Ga0209996_1007683 Ga0209996_10076832 196
19 3300027471 Ga0209995_1005986 Ga0209995_10059862 196
20 3300027526 Ga0209968_1007769 Ga0209968_10077692 196
21 3300027682 Ga0209971_1004757 Ga0209971_10047572 196
22 3300032002 Ga0307416_100436445 Ga0307416_1004364452 196
23 3300035691 Ga0373931_0069123 Ga0373931_0069123_538_1128 196
24 3300042133 Ga0450896_009450 Ga0450896_009450_724_1314 196
25 3300042156 Ga0439446_0033612 Ga0439446_0033612_789_1379 196
26 3300042436 Ga0439435_0001698 Ga0439435_0001698_3118_3708 196
27 3300044673 Ga0453683_0134722 Ga0453683_0134722_703_1302 196
28 3300044901 Ga0466960_0505054 Ga0466960_0505054_65_655 196
29 3300045051 Ga0451576_0000013 Ga0451576_0000013_364472_365071 196
30 3300045051 Ga0451576_1466499 Ga0451576_1466499_81_671 196
31 3300046537 Ga0495598_0012664 Ga0495598_0012664_580_1170 196
32 3300049572 Ga0501036_0302034 Ga0501036_0302034_108_698 196
33 3300049574 Ga0501038_0309944 Ga0501038_0309944_600_1190 196
34 3300049575 Ga0501039_0149722 Ga0501039_0149722_575_1165 196
35 3300049575 Ga0501039_0505016 Ga0501039_0505016_159_749 196
36 3300049575 Ga0501039_0585816 Ga0501039_0585816_102_692 196
37 3300049576 Ga0501040_0179675 Ga0501040_0179675_575_1165 196
38 3300049577 Ga0501041_0095391 Ga0501041_0095391_930_1520 196
39 3300049578 Ga0501042_0038721 Ga0501042_0038721_518_1108 196
40 3300049580 Ga0501046_0361322 Ga0501046_0361322_380_970 196
41 3300049582 Ga0501048_0175204 Ga0501048_0175204_262_852 196
42 3300049587 Ga0501071_0163116 Ga0501071_0163116_680_1270 196
43 3300049587 Ga0501071_0327497 Ga0501071_0327497_21_611 196
44 3300049587 Ga0501071_0695487 Ga0501071_0695487_160_750 196
45 3300049588 Ga0501072_0011354 Ga0501072_0011354_2854_3444 196
46 3300049588 Ga0501072_0077849 Ga0501072_0077849_990_1580 196
47 3300049588 Ga0501072_0559891 Ga0501072_0559891_199_789 196
48 3300049591 Ga0501075_0492315 Ga0501075_0492315_20_610 196
49 3300049592 Ga0501076_0455319 Ga0501076_0455319_294_884 196
50 3300049741 Ga0501079_0120326 Ga0501079_0120326_866_1456 196
51 3300049743 Ga0501081_0115819 Ga0501081_0115819_133_723 196
52 3300049824 Ga0501045_0018343 Ga0501045_0018343_1302_1892 196
53 3300049824 Ga0501045_0251589 Ga0501045_0251589_527_1117 196
54 3300050507 nmdc:mga05p37_181348_c1 nmdc:mga05p37_181348_c1_1625_2215 196
55 3300050510 nmdc:mga06r32_590222_c1 nmdc:mga06r32_590222_c1_345_935 196
56 3300050512 nmdc:mga0n895_609281_c1 nmdc:mga0n895_609281_c1_383_973 196
57 3300050513 nmdc:mga0rr50_245705_c1 nmdc:mga0rr50_245705_c1_606_1196 196
58 3300050514 nmdc:mga08x19_12569_c1 nmdc:mga08x19_12569_c1_1692_2282 196
59 3300050514 nmdc:mga08x19_16341_c1 nmdc:mga08x19_16341_c1_2542_3174 196
60 3300050514 nmdc:mga08x19_208891_c1 nmdc:mga08x19_208891_c1_487_1077 196
61 3300050515 nmdc:mga0a205_174121_c1 nmdc:mga0a205_174121_c1_303_893 196
62 3300054114 Ga0501084_0327153 Ga0501084_0327153_462_1052 196
63 3300059421 Ga0590071_010908 Ga0590071_010908_57_647 196
64 3300005334 Ga0068869_100000173 Ga0068869_10000017328 197
65 3300005336 Ga0070680_100005731 Ga0070680_1000057314 197
66 3300005337 Ga0070682_100018005 Ga0070682_1000180052 197
67 3300005338 Ga0068868_100000510 Ga0068868_10000051018 197
68 3300005340 Ga0070689_100000268 Ga0070689_10000026819 197
69 3300005341 Ga0070691_10002480 Ga0070691_100024809 197
70 3300005343 Ga0070687_100000048 Ga0070687_10000004829 197
71 3300005345 Ga0070692_10011786 Ga0070692_100117863 197
72 3300005345 Ga0070692_10143384 Ga0070692_101433842 197
73 3300005364 Ga0070673_100167776 Ga0070673_1001677762 197
74 3300005365 Ga0070688_100101475 Ga0070688_1001014752 197
75 3300005438 Ga0070701_10000094 Ga0070701_100000947 197
76 3300005440 Ga0070705_100000061 Ga0070705_10000006156 197
77 3300005441 Ga0070700_100000690 Ga0070700_10000069013 197
78 3300005444 Ga0070694_100000087 Ga0070694_10000008729 197
79 3300005444 Ga0070694_100028746 Ga0070694_1000287464 197
80 3300005456 Ga0070678_100075703 Ga0070678_1000757032 197
81 3300005459 Ga0068867_100000308 Ga0068867_10000030828 197
82 3300005530 Ga0070679_100044832 Ga0070679_1000448322 197
83 3300005539 Ga0068853_100527457 Ga0068853_1005274571 197
84 3300005544 Ga0070686_100000348 Ga0070686_10000034828 197
85 3300005545 Ga0070695_100000991 Ga0070695_10000099115 197
86 3300005545 Ga0070695_100066800 Ga0070695_1000668003 197
87 3300005546 Ga0070696_100000013 Ga0070696_10000001364 197
88 3300005546 Ga0070696_100377960 Ga0070696_1003779602 197
89 3300005547 Ga0070693_100000003 Ga0070693_10000000394 197
90 3300005549 Ga0070704_100000029 Ga0070704_10000002929 197
91 3300005563 Ga0068855_100008704 Ga0068855_1000087049 197
92 3300005578 Ga0068854_100008305 Ga0068854_1000083053 197
93 3300005615 Ga0070702_100000067 Ga0070702_10000006718 197
94 3300005616 Ga0068852_100072545 Ga0068852_1000725453 197
95 3300005617 Ga0068859_100001987 Ga0068859_1000019878 197
96 3300005718 Ga0068866_10000437 Ga0068866_1000043718 197
97 3300005719 Ga0068861_100000135 Ga0068861_10000013522 197
98 3300005840 Ga0068870_10039047 Ga0068870_100390472 197
99 3300005842 Ga0068858_100001335 Ga0068858_10000133522 197
100 3300005843 Ga0068860_100000929 Ga0068860_10000092916 197
101 3300005844 Ga0068862_100001963 Ga0068862_10000196315 197
102 3300006237 Ga0097621_100000024 Ga0097621_10000002438 197
103 3300006358 Ga0068871_100001309 Ga0068871_1000013092 197
104 3300006852 Ga0075433_10122991 Ga0075433_101229912 197
105 3300006880 Ga0075429_100001307 Ga0075429_1000013074 197
106 3300006881 Ga0068865_100000207 Ga0068865_1000002078 197
107 3300006931 Ga0097620_100001987 Ga0097620_1000019878 197
108 3300007076 Ga0075435_100008098 Ga0075435_1000080989 197
109 3300009098 Ga0105245_10000544 Ga0105245_100005449 197
110 3300009147 Ga0114129_10003063 Ga0114129_1000306318 197
111 3300009148 Ga0105243_10000339 Ga0105243_1000033949 197
112 3300009174 Ga0105241_10024923 Ga0105241_100249234 197
113 3300009176 Ga0105242_10000416 Ga0105242_100004166 197
114 3300009177 Ga0105248_10247346 Ga0105248_102473462 197
115 3300009551 Ga0105238_10937327 Ga0105238_109373272 197
116 3300009553 Ga0105249_10004765 Ga0105249_100047653 197
117 3300010375 Ga0105239_10013820 Ga0105239_1001382012 197
118 3300012483 Ga0157337_1008928 Ga0157337_10089281 197
119 3300013297 Ga0157378_10001176 Ga0157378_1000117620 197
120 3300013306 Ga0163162_10460322 Ga0163162_104603222 197
121 3300014326 Ga0157380_10108386 Ga0157380_101083863 197
122 3300014968 Ga0157379_10087855 Ga0157379_100878552 197
123 3300014969 Ga0157376_10023183 Ga0157376_100231832 197
124 3300025885 Ga0207653_10004359 Ga0207653_100043592 197
125 3300025899 Ga0207642_10000618 Ga0207642_100006183 197
126 3300025908 Ga0207643_10006018 Ga0207643_100060183 197
127 3300025911 Ga0207654_10007456 Ga0207654_100074564 197
128 3300025912 Ga0207707_10399099 Ga0207707_103990992 197
129 3300025917 Ga0207660_10003082 Ga0207660_100030823 197
130 3300025917 Ga0207660_10045334 Ga0207660_100453343 197
131 3300025918 Ga0207662_10000034 Ga0207662_1000003451 197
132 3300025921 Ga0207652_10014909 Ga0207652_100149093 197
133 3300025926 Ga0207659_10673669 Ga0207659_106736691 197
134 3300025927 Ga0207687_10001364 Ga0207687_100013642 197
135 3300025934 Ga0207686_10001176 Ga0207686_100011762 197
136 3300025935 Ga0207709_10000297 Ga0207709_1000029757 197
137 3300025936 Ga0207670_10001671 Ga0207670_100016719 197
138 3300025938 Ga0207704_10001437 Ga0207704_100014378 197
139 3300025940 Ga0207691_10206388 Ga0207691_102063882 197
140 3300025941 Ga0207711_10484617 Ga0207711_104846172 197
141 3300025942 Ga0207689_10000336 Ga0207689_1000033618 197
142 3300025949 Ga0207667_10006876 Ga0207667_100068765 197
143 3300025981 Ga0207640_10001441 Ga0207640_100014413 197
144 3300026035 Ga0207703_10002827 Ga0207703_1000282716 197
145 3300026041 Ga0207639_10438888 Ga0207639_104388882 197
146 3300026075 Ga0207708_10000048 Ga0207708_10000048108 197
147 3300026078 Ga0207702_10017023 Ga0207702_100170236 197
148 3300026089 Ga0207648_10000519 Ga0207648_1000051931 197
149 3300026118 Ga0207675_100000464 Ga0207675_10000046428 197
150 3300026142 Ga0207698_10088618 Ga0207698_100886182 197
151 3300027907 Ga0207428_10000748 Ga0207428_1000074816 197
152 3300028380 Ga0268265_10001624 Ga0268265_100016248 197
153 3300028381 Ga0268264_10000423 Ga0268264_1000042341 197
154 3300034816 Ga0373930_0047884 Ga0373930_0047884_247_840 197
155 3300035089 Ga0373944_0021963 Ga0373944_0021963_868_1461 197
156 3300035091 Ga0373951_0002305 Ga0373951_0002305_2070_2663 197
157 3300035111 Ga0373923_0120539 Ga0373923_0120539_548_1141 197
158 3300035113 Ga0373936_0018914 Ga0373936_0018914_527_1120 197
159 3300035114 Ga0373939_0072232 Ga0373939_0072232_204_797 197
160 3300035116 Ga0373945_0013502 Ga0373945_0013502_500_1093 197
161 3300035171 Ga0373946_0083831 Ga0373946_0083831_482_1075 197
162 3300035691 Ga0373931_0002594 Ga0373931_0002594_3242_3835 197
163 3300035692 Ga0373935_0027700 Ga0373935_0027700_2508_3101 197
164 3300042876 Ga0451577_0115421 Ga0451577_0115421_440_1033 197
165 3300044712 Ga0453684_0019085 Ga0453684_0019085_800_1516 197
166 3300044712 Ga0453684_0569900 Ga0453684_0569900_374_967 197
167 3300045051 Ga0451576_0000220 Ga0451576_0000220_123419_124012 197
168 3300045051 Ga0451576_0152782 Ga0451576_0152782_520_1113 197
169 3300045976 Ga0466967_0233665 Ga0466967_0233665_577_1170 197
170 3300046455 Ga0495603_0006622 Ga0495603_0006622_1251_1844 197
171 3300046475 Ga0495639_0001898 Ga0495639_0001898_3793_4386 197
172 3300046526 Ga0495666_0009661 Ga0495666_0009661_2267_2860 197
173 3300046528 Ga0495642_0064653 Ga0495642_0064653_191_784 197
174 3300046531 Ga0495665_0024216 Ga0495665_0024216_242_835 197
175 3300046535 Ga0495586_0001299 Ga0495586_0001299_5731_6324 197
176 3300046681 Ga0495647_0000143 Ga0495647_0000143_5074_5667 197
177 3300046683 Ga0495658_0002373 Ga0495658_0002373_5571_6164 197
178 3300046684 Ga0495669_0004659 Ga0495669_0004659_3167_3760 197
179 3300047315 Ga0495581_0042946 Ga0495581_0042946_1571_2164 197
180 3300047321 Ga0495676_0022759 Ga0495676_0022759_3801_4394 197
181 3300049582 Ga0501048_0519852 Ga0501048_0519852_183_785 197
182 3300049587 Ga0501071_0364536 Ga0501071_0364536_294_899 197
183 3300050507 nmdc:mga05p37_467_c2 nmdc:mga05p37_467_c2_16999_17592 197
184 3300050508 nmdc:mga09592_9873_c1 nmdc:mga09592_9873_c1_4342_4935 197
185 3300050509 nmdc:mga0qj67_357597_c1 nmdc:mga0qj67_357597_c1_38_631 197
186 3300050510 nmdc:mga06r32_27893_c1 nmdc:mga06r32_27893_c1_3402_3995 197
187 3300050511 nmdc:mga08y16_8490_c1 nmdc:mga08y16_8490_c1_3436_4029 197
188 3300050513 nmdc:mga0rr50_4790_c1 nmdc:mga0rr50_4790_c1_4667_5260 197
189 3300050515 nmdc:mga0a205_20391_c1 nmdc:mga0a205_20391_c1_4259_4852 197
190 3300031250 Ga0265331_10080403 Ga0265331_100804032 198
191 3300044673 Ga0453683_0059499 Ga0453683_0059499_1659_2270 199
192 3300045051 Ga0451576_0057736 Ga0451576_0057736_2641_3252 199
193 3300049573 Ga0501037_0211427 Ga0501037_0211427_46_687 200
194 3300049584 Ga0501068_0163897 Ga0501068_0163897_721_1362 200
195 3300049586 Ga0501070_0181714 Ga0501070_0181714_480_1121 200
196 3300049742 Ga0501080_0113002 Ga0501080_0113002_454_1095 200
197 3300054114 Ga0501084_0089303 Ga0501084_0089303_951_1592 200
198 3300028666 Ga0265336_10067824 Ga0265336_100678242 201
199 3300029957 Ga0265324_10002313 Ga0265324_1000231311 201
200 3300031235 Ga0265330_10008022 Ga0265330_100080222 201
201 3300031238 Ga0265332_10011352 Ga0265332_100113523 201
202 3300031250 Ga0265331_10051689 Ga0265331_100516892 201
203 3300031250 Ga0265331_10082944 Ga0265331_100829442 201
204 3300031711 Ga0265314_10004039 Ga0265314_1000403911 201
205 3300042876 Ga0451577_0020031 Ga0451577_0020031_1582_2199 201
206 3300044673 Ga0453683_0528827 Ga0453683_0528827_102_719 201
207 3300044712 Ga0453684_0001529 Ga0453684_0001529_54631_55248 201
208 3300044712 Ga0453684_0451583 Ga0453684_0451583_730_1371 201
209 3300045051 Ga0451576_0001977 Ga0451576_0001977_22953_23570 201
210 3300029957 Ga0265324_10108466 Ga0265324_101084661 202
211 3300031241 Ga0265325_10245744 Ga0265325_102457441 202
212 3300031251 Ga0265327_10004904 Ga0265327_1000490413 202
213 3300031251 Ga0265327_10014344 Ga0265327_100143442 202
214 3300031344 Ga0265316_10038233 Ga0265316_100382332 202
215 3300035086 Ga0373934_0000310 Ga0373934_0000310_9399_10025 202
216 3300035091 Ga0373951_0074918 Ga0373951_0074918_13_624 202
217 3300035119 Ga0373956_0000428 Ga0373956_0000428_9765_10391 202
218 3300035120 Ga0373957_0002458 Ga0373957_0002458_2655_3281 202
219 3300035691 Ga0373931_0137448 Ga0373931_0137448_329_940 202
220 3300035724 Ga0373933_0000632 Ga0373933_0000632_7545_8171 202
221 3300036401 Ga0373937_0000371 Ga0373937_0000371_40495_41121 202
222 3300044712 Ga0453684_0027336 Ga0453684_0027336_7419_8030 202
223 3300046462 Ga0495651_0000056 Ga0495651_0000056_66676_67302 202
224 3300047444 Ga0495675_0298845 Ga0495675_0298845_129_755 202
225 3300048909 Ga0496106_0527343 Ga0496106_0527343_210_821 202
226 3300050509 nmdc:mga0qj67_815940_c1 nmdc:mga0qj67_815940_c1_62_706 202
227 3300007788 Ga0099795_10042452 Ga0099795_100424522 203
228 3300025912 Ga0207707_10108181 Ga0207707_101081812 203
229 3300028666 Ga0265336_10002226 Ga0265336_100022267 203
230 3300029957 Ga0265324_10000002 Ga0265324_1000000238 203
231 3300029957 Ga0265324_10138185 Ga0265324_101381852 203
232 3300031239 Ga0265328_10024132 Ga0265328_100241323 203
233 3300031241 Ga0265325_10002066 Ga0265325_100020665 203
234 3300031250 Ga0265331_10003938 Ga0265331_100039385 203
235 3300031250 Ga0265331_10005696 Ga0265331_100056966 203
236 3300031251 Ga0265327_10001224 Ga0265327_1000122429 203
237 3300031344 Ga0265316_10118384 Ga0265316_101183843 203
238 3300031711 Ga0265314_10017586 Ga0265314_100175862 203
239 3300035083 Ga0373926_0007026 Ga0373926_0007026_3046_3675 203
240 3300035086 Ga0373934_0017274 Ga0373934_0017274_364_993 203
241 3300035113 Ga0373936_0067176 Ga0373936_0067176_29_658 203
242 3300035116 Ga0373945_0017953 Ga0373945_0017953_1732_2361 203
243 3300035118 Ga0373954_0008567 Ga0373954_0008567_3251_3877 203
244 3300035119 Ga0373956_0076394 Ga0373956_0076394_871_1500 203
245 3300035170 Ga0373943_0015943 Ga0373943_0015943_1099_1728 203
246 3300035172 Ga0373955_0005800 Ga0373955_0005800_1071_1700 203
247 3300035692 Ga0373935_0453649 Ga0373935_0453649_264_893 203
248 3300035695 Ga0373927_0070922 Ga0373927_0070922_673_1302 203
249 3300036401 Ga0373937_0368152 Ga0373937_0368152_320_949 203
250 3300037068 Ga0373925_0056418 Ga0373925_0056418_1319_1948 203
251 3300042876 Ga0451577_0000013 Ga0451577_0000013_388502_389140 203
252 3300042876 Ga0451577_0002441 Ga0451577_0002441_9820_10470 203
253 3300042876 Ga0451577_0009089 Ga0451577_0009089_8863_9513 203
254 3300042876 Ga0451577_0101326 Ga0451577_0101326_502_1116 203
255 3300042876 Ga0451577_0336192 Ga0451577_0336192_285_923 203
256 3300044673 Ga0453683_0000059 Ga0453683_0000059_24971_25609 203
257 3300044712 Ga0453684_0000040 Ga0453684_0000040_8679_9368 203
258 3300044712 Ga0453684_0000085 Ga0453684_0000085_8678_9316 203
259 3300044712 Ga0453684_0057667 Ga0453684_0057667_3479_4129 203
260 3300044712 Ga0453684_0062868 Ga0453684_0062868_638_1252 203
261 3300045051 Ga0451576_0000018 Ga0451576_0000018_161550_162188 203
262 3300045051 Ga0451576_0002261 Ga0451576_0002261_16612_17262 203
263 3300045051 Ga0451576_0002688 Ga0451576_0002688_12926_13576 203
264 3300045051 Ga0451576_0119767 Ga0451576_0119767_1842_2492 203
265 3300046454 Ga0495592_0001655 Ga0495592_0001655_9705_10334 203
266 3300046454 Ga0495592_0012915 Ga0495592_0012915_4195_4824 203
267 3300046461 Ga0495641_0010479 Ga0495641_0010479_4384_5013 203
268 3300046463 Ga0495653_0074900 Ga0495653_0074900_1526_2155 203
269 3300046472 Ga0495580_0126246 Ga0495580_0126246_365_994 203
270 3300046475 Ga0495639_0002795 Ga0495639_0002795_6473_7102 203
271 3300046511 Ga0495608_0023227 Ga0495608_0023227_1361_1990 203
272 3300046514 Ga0495618_0165241 Ga0495618_0165241_367_996 203
273 3300046516 Ga0495628_0053758 Ga0495628_0053758_1923_2552 203
274 3300046516 Ga0495628_0136003 Ga0495628_0136003_640_1269 203
275 3300046517 Ga0495630_0000139 Ga0495630_0000139_5106_5735 203
276 3300046526 Ga0495666_0011157 Ga0495666_0011157_3166_3795 203
277 3300046529 Ga0495652_0009814 Ga0495652_0009814_4884_5513 203
278 3300046529 Ga0495652_0028583 Ga0495652_0028583_1192_1821 203
279 3300046529 Ga0495652_0120977 Ga0495652_0120977_1390_2019 203
280 3300046533 Ga0495640_0096765 Ga0495640_0096765_770_1399 203
281 3300046535 Ga0495586_0122644 Ga0495586_0122644_112_741 203
282 3300046536 Ga0495587_0251266 Ga0495587_0251266_144_770 203
283 3300046543 Ga0495645_0000629 Ga0495645_0000629_14206_14835 203
284 3300046559 Ga0495667_0130713 Ga0495667_0130713_958_1587 203
285 3300046642 Ga0495634_0142375 Ga0495634_0142375_845_1474 203
286 3300046663 Ga0495635_0126449 Ga0495635_0126449_1099_1728 203
287 3300046675 Ga0495657_0024434 Ga0495657_0024434_2708_3337 203
288 3300046678 Ga0495599_0001044 Ga0495599_0001044_9681_10310 203
289 3300046678 Ga0495599_0010627 Ga0495599_0010627_2045_2674 203
290 3300046678 Ga0495599_0031240 Ga0495599_0031240_1225_1851 203
291 3300046678 Ga0495599_0145848 Ga0495599_0145848_701_1330 203
292 3300046681 Ga0495647_0009032 Ga0495647_0009032_2368_2997 203
293 3300046690 Ga0495624_0073876 Ga0495624_0073876_625_1254 203
294 3300046809 Ga0495600_0003884 Ga0495600_0003884_414_1043 203
295 3300047318 Ga0495636_0006545 Ga0495636_0006545_3590_4216 203
296 3300047322 Ga0495680_0112853 Ga0495680_0112853_143_772 203
297 3300047444 Ga0495675_0015904 Ga0495675_0015904_90_719 203
298 3300047471 Ga0495684_0035836 Ga0495684_0035836_265_894 203
299 3300053077 Ga0495601_0001562 Ga0495601_0001562_3435_4064 203
300 3300053077 Ga0495601_0022367 Ga0495601_0022367_455_1084 203
301 3300053077 Ga0495601_0173980 Ga0495601_0173980_570_1199 203
302 3300053084 Ga0495595_0043204 Ga0495595_0043204_1347_1976 203
303 3300007265 Ga0099794_10388081 Ga0099794_103880811 204
304 3300006173 Ga0070716_100046932 Ga0070716_1000469322 205
305 3300007076 Ga0075435_100929358 Ga0075435_1009293582 205
306 3300025939 Ga0207665_10066919 Ga0207665_100669192 205
307 3300010159 Ga0099796_10017691 Ga0099796_100176912 206
308 3300025941 Ga0207711_10133706 Ga0207711_101337063 207
309 3300005441 Ga0070700_100018135 Ga0070700_1000181352 209
310 3300006163 Ga0070715_10078672 Ga0070715_100786722 209
311 3300009098 Ga0105245_10037385 Ga0105245_100373853 209
312 3300009148 Ga0105243_10819947 Ga0105243_108199472 209
313 3300009176 Ga0105242_10064586 Ga0105242_100645862 209
314 3300013296 Ga0157374_10376850 Ga0157374_103768503 209
315 3300025934 Ga0207686_10077623 Ga0207686_100776232 209
316 3300025935 Ga0207709_10619799 Ga0207709_106197992 209
317 3300026089 Ga0207648_10017632 Ga0207648_100176322 209
318 3300035117 Ga0373953_0231002 Ga0373953_0231002_99_776 209
319 3300036401 Ga0373937_0029221 Ga0373937_0029221_2312_2989 209
320 3300046536 Ga0495587_0326772 Ga0495587_0326772_108_785 209
321 3300046559 Ga0495667_0011307 Ga0495667_0011307_4892_5569 209
322 3300047317 Ga0495604_0087524 Ga0495604_0087524_1259_1936 209
323 3300049571 Ga0501034_0025211 Ga0501034_0025211_240_923 210
324 3300049588 Ga0501072_0025395 Ga0501072_0025395_1115_1798 210
325 3300036401 Ga0373937_0582742 Ga0373937_0582742_124_810 211
326 3300049572 Ga0501036_0184516 Ga0501036_0184516_429_1088 211
327 3300006237 Ga0097621_100012183 Ga0097621_1000121832 212
328 3300009551 Ga0105238_10044789 Ga0105238_100447893 213
329 3300035119 Ga0373956_0243232 Ga0373956_0243232_64_789 213
330 3300005330 Ga0070690_100363366 Ga0070690_1003633661 215
331 3300005459 Ga0068867_100980218 Ga0068867_1009802181 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01464

SLT

Transglycosylase SLT domain

81

181

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o1j-assembly1.cif.gz_A lytic transglycosylase in action 0.8104 85 201
6h5f-assembly1.cif.gz_A ltga disordered helix 0.8097 85 190
6fbt-assembly1.cif.gz_A the x-ray structure of lytic transglycosylase slt from pseudomonas aeruginosa in complex with the reaction product nag-anhnampentapeptide 0.7734 85 190
4oxv-assembly1.cif.gz_A crystal structure of mltf from pseudomonas aeruginosa complexed with valine 0.7714 71 196
1qte-assembly1.cif.gz_A crystal structure of the 70 kda soluble lytic transglycosylase slt70 from escherichia coli at 1.90 a resolution in complex with a 1,6-anhydromurotripeptide 0.7522 95 207
ID Description Score Start End Superfamily
af_P0AEZ7_97_250_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.8201 81 178 1.10.530.10
1slyA03 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.766 95 207 1.10.530.10
af_A0A1D6QSC1_388_533_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.7506 85 195 1.10.530.10
4cfoB02 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.7175 82 191 1.10.530.10
af_A0A178WGK2_281_420_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.7027 81 198 1.10.530.10
ID Description Score Start End GO Terms
AF-A0A5C1DPK5-F1-model_v4 Lytic transglycosylase domain-containing protein 0.9833 30 197
AF-A0A536ZLX0-F1-model_v4 Lytic transglycosylase domain-containing protein 0.9787 22 196
AF-A0A1F4BE54-F1-model_v4 Transglycosylase 0.9779 17 196
AF-A0A537AJ55-F1-model_v4 Lytic transglycosylase domain-containing protein 0.977 52 197
AF-A0A523GN10-F1-model_v4 Lytic transglycosylase domain-containing protein 0.9766 122 196

Feature Viewer

pLDDT pTM Quality
79.41 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map