F410569
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 331 | 217 | 331 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300035086|Ga0373934_0000310|Ga0373934_0000310_9399_10025 |
| Length | 208 |
| Sequence | VKLRTTLLALGLTFPATAFAGAQIYEPLAAEVRAGLQASIADKPTQHAFKNMEAAVDWLTEMSQRLGSKIPDFESRVQFLRTVHFEATRARVDPQLVLALIQVESGFRKYAVSRSGARGYMQVMPFWVGLIGRPGDNLFNLRNNLRYGCVILKYYLDAEKGDLQRALARYNGSLGKSNYPNLVIGAWRSTWHYQGRLTYLPDTGFGRT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 2 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 50 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 101 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 105 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 108 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 109 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 111 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 112 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 115 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 116 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 117 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 118 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 120 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 122 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 124 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 125 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 126 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 127 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 130 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 133 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 137 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 138 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 139 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 140 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 141 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 142 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 143 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 144 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 145 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 184 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.3 |
| Rhizosphere | 99.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070690_100363366 | 3300005330 | Unclassified | 1054 |
| 2 | Ga0068869_100000173 | 3300005334 | Bacteria | 32748 |
| 3 | Ga0070680_100005731 | 3300005336 | Bacteria | 9423 |
| 4 | Ga0070682_100018005 | 3300005337 | Bacteria | 4122 |
| 5 | Ga0068868_100000510 | 3300005338 | Bacteria | 25961 |
| 6 | Ga0070689_100000268 | 3300005340 | Bacteria | 30093 |
| 7 | Ga0070691_10002480 | 3300005341 | Bacteria | 8204 |
| 8 | Ga0070691_10080730 | 3300005341 | Bacteria | 1592 |
| 9 | Ga0070687_100000048 | 3300005343 | Bacteria | 38178 |
| 10 | Ga0070692_10011786 | 3300005345 | Bacteria | 4027 |
| 11 | Ga0070692_10143384 | 3300005345 | Bacteria | 1354 |
| 12 | Ga0070673_100167776 | 3300005364 | Bacteria | 1872 |
| 13 | Ga0070688_100101475 | 3300005365 | Bacteria | 1898 |
| 14 | Ga0070701_10000094 | 3300005438 | Bacteria | 24873 |
| 15 | Ga0070705_100000061 | 3300005440 | Bacteria | 56772 |
| 16 | Ga0070700_100000690 | 3300005441 | Bacteria | 16656 |
| 17 | Ga0070700_100018135 | 3300005441 | Bacteria | 4041 |
| 18 | Ga0070694_100000087 | 3300005444 | Bacteria | 43937 |
| 19 | Ga0070694_100028746 | 3300005444 | Bacteria | 3620 |
| 20 | Ga0070694_100118443 | 3300005444 | Bacteria | 1897 |
| 21 | Ga0070678_100075703 | 3300005456 | Bacteria | 2533 |
| 22 | Ga0068867_100000308 | 3300005459 | Bacteria | 32195 |
| 23 | Ga0068867_100980218 | 3300005459 | Bacteria | 765 |
| 24 | Ga0070679_100044832 | 3300005530 | Bacteria | 4406 |
| 25 | Ga0070697_100544332 | 3300005536 | Bacteria | 1018 |
| 26 | Ga0068853_100527457 | 3300005539 | Bacteria | 1117 |
| 27 | Ga0070686_100000348 | 3300005544 | Bacteria | 29898 |
| 28 | Ga0070695_100000991 | 3300005545 | Bacteria | 15439 |
| 29 | Ga0070695_100066800 | 3300005545 | Bacteria | 2344 |
| 30 | Ga0070696_100000013 | 3300005546 | Bacteria | 78718 |
| 31 | Ga0070696_100377960 | 3300005546 | Bacteria | 1103 |
| 32 | Ga0070693_100000003 | 3300005547 | Bacteria | 95793 |
| 33 | Ga0070704_100000029 | 3300005549 | Bacteria | 47486 |
| 34 | Ga0068855_100008704 | 3300005563 | Bacteria | 12270 |
| 35 | Ga0068854_100008305 | 3300005578 | Bacteria | 6668 |
| 36 | Ga0070702_100000067 | 3300005615 | Bacteria | 29275 |
| 37 | Ga0068852_100072545 | 3300005616 | Bacteria | 3026 |
| 38 | Ga0068859_100001987 | 3300005617 | Bacteria | 20874 |
| 39 | Ga0068866_10000437 | 3300005718 | Bacteria | 19319 |
| 40 | Ga0068861_100000135 | 3300005719 | Bacteria | 38189 |
| 41 | Ga0068870_10039047 | 3300005840 | Bacteria | 2455 |
| 42 | Ga0068858_100001335 | 3300005842 | Bacteria | 25445 |
| 43 | Ga0068860_100000929 | 3300005843 | Bacteria | 32389 |
| 44 | Ga0068862_100001963 | 3300005844 | Bacteria | 18651 |
| 45 | Ga0070715_10078672 | 3300006163 | Bacteria | 1491 |
| 46 | Ga0070716_100046932 | 3300006173 | Bacteria | 2434 |
| 47 | Ga0097621_100000024 | 3300006237 | Bacteria | 81390 |
| 48 | Ga0097621_100012183 | 3300006237 | Bacteria | 6364 |
| 49 | Ga0068871_100001309 | 3300006358 | Bacteria | 16656 |
| 50 | Ga0075431_100661923 | 3300006847 | Bacteria | 1024 |
| 51 | Ga0075433_10122991 | 3300006852 | Bacteria | 2305 |
| 52 | Ga0075433_10309295 | 3300006852 | Bacteria | 1399 |
| 53 | Ga0075434_100018240 | 3300006871 | Bacteria | 6777 |
| 54 | Ga0075429_100001307 | 3300006880 | Bacteria | 20302 |
| 55 | Ga0068865_100000207 | 3300006881 | Bacteria | 32741 |
| 56 | Ga0075436_100015929 | 3300006914 | Bacteria | 5146 |
| 57 | Ga0075436_100037968 | 3300006914 | Bacteria | 3325 |
| 58 | Ga0075436_100059824 | 3300006914 | Bacteria | 2632 |
| 59 | Ga0075436_100268217 | 3300006914 | Bacteria | 1218 |
| 60 | Ga0097620_100001987 | 3300006931 | Bacteria | 20874 |
| 61 | Ga0075435_100008098 | 3300007076 | Bacteria | 7527 |
| 62 | Ga0075435_100929358 | 3300007076 | Bacteria | 759 |
| 63 | Ga0099794_10388081 | 3300007265 | Bacteria | 729 |
| 64 | Ga0099795_10042452 | 3300007788 | Bacteria | 1623 |
| 65 | Ga0105245_10000544 | 3300009098 | Bacteria | 34380 |
| 66 | Ga0105245_10037385 | 3300009098 | Bacteria | 4315 |
| 67 | Ga0114129_10003063 | 3300009147 | Bacteria | 23443 |
| 68 | Ga0105243_10000339 | 3300009148 | Bacteria | 51082 |
| 69 | Ga0105243_10819947 | 3300009148 | Bacteria | 919 |
| 70 | Ga0105241_10024923 | 3300009174 | Bacteria | 4444 |
| 71 | Ga0105242_10000416 | 3300009176 | Bacteria | 33943 |
| 72 | Ga0105242_10064586 | 3300009176 | Bacteria | 3018 |
| 73 | Ga0105248_10247346 | 3300009177 | Bacteria | 2007 |
| 74 | Ga0105238_10044789 | 3300009551 | Bacteria | 4471 |
| 75 | Ga0105238_10937327 | 3300009551 | Bacteria | 885 |
| 76 | Ga0105249_10004765 | 3300009553 | Bacteria | 11702 |
| 77 | Ga0099796_10017691 | 3300010159 | Bacteria | 2127 |
| 78 | Ga0105239_10013820 | 3300010375 | Bacteria | 8958 |
| 79 | Ga0157337_1008928 | 3300012483 | Bacteria | 747 |
| 80 | Ga0157374_10376850 | 3300013296 | Bacteria | 1413 |
| 81 | Ga0157378_10001176 | 3300013297 | Bacteria | 23804 |
| 82 | Ga0163162_10460322 | 3300013306 | Bacteria | 1403 |
| 83 | Ga0157380_10108386 | 3300014326 | Bacteria | 2328 |
| 84 | Ga0157380_10345990 | 3300014326 | Bacteria | 1389 |
| 85 | Ga0157379_10087855 | 3300014968 | Bacteria | 2787 |
| 86 | Ga0157376_10023183 | 3300014969 | Bacteria | 4855 |
| 87 | Ga0207653_10004359 | 3300025885 | Bacteria | 4442 |
| 88 | Ga0207642_10000618 | 3300025899 | Bacteria | 10951 |
| 89 | Ga0207643_10006018 | 3300025908 | Bacteria | 6483 |
| 90 | Ga0207654_10007456 | 3300025911 | Bacteria | 5510 |
| 91 | Ga0207707_10108181 | 3300025912 | Bacteria | 2431 |
| 92 | Ga0207707_10399099 | 3300025912 | Bacteria | 1181 |
| 93 | Ga0207660_10003082 | 3300025917 | Bacteria | 10889 |
| 94 | Ga0207660_10045334 | 3300025917 | Bacteria | 3098 |
| 95 | Ga0207662_10000034 | 3300025918 | Bacteria | 60878 |
| 96 | Ga0207652_10014909 | 3300025921 | Bacteria | 6302 |
| 97 | Ga0207659_10673669 | 3300025926 | Bacteria | 885 |
| 98 | Ga0207687_10001364 | 3300025927 | Bacteria | 16705 |
| 99 | Ga0207686_10001176 | 3300025934 | Bacteria | 15118 |
| 100 | Ga0207686_10077623 | 3300025934 | Bacteria | 2157 |
| 101 | Ga0207709_10000297 | 3300025935 | Bacteria | 55386 |
| 102 | Ga0207709_10619799 | 3300025935 | Bacteria | 858 |
| 103 | Ga0207670_10001671 | 3300025936 | Bacteria | 11563 |
| 104 | Ga0207704_10001437 | 3300025938 | Bacteria | 10648 |
| 105 | Ga0207665_10066919 | 3300025939 | Bacteria | 2446 |
| 106 | Ga0207691_10206388 | 3300025940 | Bacteria | 1708 |
| 107 | Ga0207711_10133706 | 3300025941 | Bacteria | 2226 |
| 108 | Ga0207711_10484617 | 3300025941 | Bacteria | 1152 |
| 109 | Ga0207689_10000336 | 3300025942 | Bacteria | 43682 |
| 110 | Ga0207667_10006876 | 3300025949 | Bacteria | 13742 |
| 111 | Ga0207640_10001441 | 3300025981 | Bacteria | 12866 |
| 112 | Ga0207703_10002827 | 3300026035 | Bacteria | 14818 |
| 113 | Ga0207639_10438888 | 3300026041 | Bacteria | 1183 |
| 114 | Ga0207708_10000048 | 3300026075 | Bacteria | 114754 |
| 115 | Ga0207702_10017023 | 3300026078 | Bacteria | 6015 |
| 116 | Ga0207648_10000519 | 3300026089 | Bacteria | 43028 |
| 117 | Ga0207648_10017632 | 3300026089 | Bacteria | 6485 |
| 118 | Ga0207675_100000464 | 3300026118 | Bacteria | 39538 |
| 119 | Ga0207698_10088618 | 3300026142 | Bacteria | 2524 |
| 120 | Ga0209969_1006468 | 3300027360 | Bacteria | 1651 |
| 121 | Ga0209996_1007683 | 3300027395 | Bacteria | 1407 |
| 122 | Ga0209995_1005986 | 3300027471 | Bacteria | 1957 |
| 123 | Ga0209968_1007769 | 3300027526 | Bacteria | 1626 |
| 124 | Ga0209971_1004757 | 3300027682 | Bacteria | 3223 |
| 125 | Ga0207428_10000748 | 3300027907 | Bacteria | 37159 |
| 126 | Ga0268265_10001624 | 3300028380 | Bacteria | 18508 |
| 127 | Ga0268264_10000423 | 3300028381 | Bacteria | 59146 |
| 128 | Ga0265336_10002226 | 3300028666 | Bacteria | 8154 |
| 129 | Ga0265336_10067824 | 3300028666 | Bacteria | 1067 |
| 130 | Ga0265324_10000002 | 3300029957 | Bacteria | 382754 |
| 131 | Ga0265324_10002313 | 3300029957 | Bacteria | 9882 |
| 132 | Ga0265324_10108466 | 3300029957 | Bacteria | 943 |
| 133 | Ga0265324_10138185 | 3300029957 | Bacteria | 827 |
| 134 | Ga0265330_10008022 | 3300031235 | Bacteria | 5113 |
| 135 | Ga0265332_10011352 | 3300031238 | Bacteria | 3960 |
| 136 | Ga0265328_10024132 | 3300031239 | Bacteria | 2300 |
| 137 | Ga0265325_10002066 | 3300031241 | Bacteria | 13759 |
| 138 | Ga0265325_10245744 | 3300031241 | Bacteria | 812 |
| 139 | Ga0265331_10003938 | 3300031250 | Bacteria | 9384 |
| 140 | Ga0265331_10005696 | 3300031250 | Bacteria | 7475 |
| 141 | Ga0265331_10051689 | 3300031250 | Bacteria | 1966 |
| 142 | Ga0265331_10080403 | 3300031250 | Bacteria | 1515 |
| 143 | Ga0265331_10082944 | 3300031250 | Bacteria | 1487 |
| 144 | Ga0265327_10001224 | 3300031251 | Bacteria | 34492 |
| 145 | Ga0265327_10004904 | 3300031251 | Bacteria | 11551 |
| 146 | Ga0265327_10014344 | 3300031251 | Bacteria | 5191 |
| 147 | Ga0265316_10038233 | 3300031344 | Bacteria | 3868 |
| 148 | Ga0265316_10118384 | 3300031344 | Bacteria | 2002 |
| 149 | Ga0265314_10004039 | 3300031711 | Bacteria | 13869 |
| 150 | Ga0265314_10017586 | 3300031711 | Bacteria | 5606 |
| 151 | Ga0307416_100436445 | 3300032002 | Bacteria | 1358 |
| 152 | Ga0373930_0047884 | 3300034816 | Bacteria | 926 |
| 153 | Ga0373926_0007026 | 3300035083 | Bacteria | 3744 |
| 154 | Ga0373934_0000310 | 3300035086 | Bacteria | 17068 |
| 155 | Ga0373934_0017274 | 3300035086 | Bacteria | 2752 |
| 156 | Ga0373944_0021963 | 3300035089 | Bacteria | 1851 |
| 157 | Ga0373951_0002305 | 3300035091 | Bacteria | 4845 |
| 158 | Ga0373951_0074918 | 3300035091 | Bacteria | 868 |
| 159 | Ga0373923_0120539 | 3300035111 | Bacteria | 1172 |
| 160 | Ga0373936_0018914 | 3300035113 | Bacteria | 2665 |
| 161 | Ga0373936_0067176 | 3300035113 | Bacteria | 1473 |
| 162 | Ga0373939_0072232 | 3300035114 | Bacteria | 1126 |
| 163 | Ga0373945_0013502 | 3300035116 | Bacteria | 2727 |
| 164 | Ga0373945_0017953 | 3300035116 | Bacteria | 2402 |
| 165 | Ga0373953_0231002 | 3300035117 | Unclassified | 802 |
| 166 | Ga0373954_0008567 | 3300035118 | Bacteria | 4496 |
| 167 | Ga0373956_0000428 | 3300035119 | Bacteria | 17130 |
| 168 | Ga0373956_0076394 | 3300035119 | Bacteria | 1532 |
| 169 | Ga0373956_0243232 | 3300035119 | Bacteria | 855 |
| 170 | Ga0373957_0002458 | 3300035120 | Bacteria | 5295 |
| 171 | Ga0373943_0015943 | 3300035170 | Bacteria | 3421 |
| 172 | Ga0373946_0083831 | 3300035171 | Bacteria | 1401 |
| 173 | Ga0373955_0005800 | 3300035172 | Bacteria | 5575 |
| 174 | Ga0373931_0002594 | 3300035691 | Bacteria | 8053 |
| 175 | Ga0373931_0069123 | 3300035691 | Bacteria | 1924 |
| 176 | Ga0373931_0137448 | 3300035691 | Bacteria | 1412 |
| 177 | Ga0373935_0027700 | 3300035692 | Bacteria | 3502 |
| 178 | Ga0373935_0453649 | 3300035692 | Bacteria | 926 |
| 179 | Ga0373927_0070922 | 3300035695 | Bacteria | 2255 |
| 180 | Ga0373933_0000632 | 3300035724 | Bacteria | 21965 |
| 181 | Ga0373937_0000371 | 3300036401 | Bacteria | 41765 |
| 182 | Ga0373937_0029221 | 3300036401 | Bacteria | 4992 |
| 183 | Ga0373937_0368152 | 3300036401 | Bacteria | 1362 |
| 184 | Ga0373937_0582742 | 3300036401 | Bacteria | 1062 |
| 185 | Ga0373925_0056418 | 3300037068 | Bacteria | 2942 |
| 186 | Ga0450896_009450 | 3300042133 | Bacteria | 1358 |
| 187 | Ga0439446_0033612 | 3300042156 | Bacteria | 1490 |
| 188 | Ga0439435_0001698 | 3300042436 | Bacteria | 4159 |
| 189 | Ga0451577_0000013 | 3300042876 | Bacteria | 550689 |
| 190 | Ga0451577_0002441 | 3300042876 | Bacteria | 22169 |
| 191 | Ga0451577_0009089 | 3300042876 | Bacteria | 9591 |
| 192 | Ga0451577_0020031 | 3300042876 | Bacteria | 6143 |
| 193 | Ga0451577_0101326 | 3300042876 | Bacteria | 2573 |
| 194 | Ga0451577_0115421 | 3300042876 | Bacteria | 2404 |
| 195 | Ga0451577_0336192 | 3300042876 | Bacteria | 1370 |
| 196 | Ga0453683_0000059 | 3300044673 | Bacteria | 187158 |
| 197 | Ga0453683_0059499 | 3300044673 | Bacteria | 2388 |
| 198 | Ga0453683_0134722 | 3300044673 | Bacteria | 1557 |
| 199 | Ga0453683_0528827 | 3300044673 | Bacteria | 766 |
| 200 | Ga0453684_0000040 | 3300044712 | Bacteria | 690210 |
| 201 | Ga0453684_0000085 | 3300044712 | Bacteria | 397817 |
| 202 | Ga0453684_0001529 | 3300044712 | Bacteria | 64683 |
| 203 | Ga0453684_0019085 | 3300044712 | Bacteria | 10467 |
| 204 | Ga0453684_0027336 | 3300044712 | Bacteria | 8186 |
| 205 | Ga0453684_0057667 | 3300044712 | Bacteria | 5024 |
| 206 | Ga0453684_0062868 | 3300044712 | Bacteria | 4752 |
| 207 | Ga0453684_0451583 | 3300044712 | Bacteria | 1431 |
| 208 | Ga0453684_0569900 | 3300044712 | Bacteria | 1245 |
| 209 | Ga0466960_0505054 | 3300044901 | Bacteria | 709 |
| 210 | Ga0451576_0000013 | 3300045051 | Bacteria | 665120 |
| 211 | Ga0451576_0000018 | 3300045051 | Bacteria | 550689 |
| 212 | Ga0451576_0000220 | 3300045051 | Bacteria | 141261 |
| 213 | Ga0451576_0001977 | 3300045051 | Bacteria | 32557 |
| 214 | Ga0451576_0002261 | 3300045051 | Bacteria | 29427 |
| 215 | Ga0451576_0002688 | 3300045051 | Bacteria | 25898 |
| 216 | Ga0451576_0057736 | 3300045051 | Bacteria | 4057 |
| 217 | Ga0451576_0119767 | 3300045051 | Bacteria | 2740 |
| 218 | Ga0451576_0152782 | 3300045051 | Bacteria | 2407 |
| 219 | Ga0451576_1466499 | 3300045051 | Bacteria | 709 |
| 220 | Ga0466967_0233665 | 3300045976 | Bacteria | 1751 |
| 221 | Ga0495592_0001655 | 3300046454 | Bacteria | 15626 |
| 222 | Ga0495592_0012915 | 3300046454 | Bacteria | 6349 |
| 223 | Ga0495603_0006622 | 3300046455 | Bacteria | 6950 |
| 224 | Ga0495641_0010479 | 3300046461 | Bacteria | 5367 |
| 225 | Ga0495651_0000056 | 3300046462 | Bacteria | 83191 |
| 226 | Ga0495653_0074900 | 3300046463 | Bacteria | 2520 |
| 227 | Ga0495580_0126246 | 3300046472 | Bacteria | 1775 |
| 228 | Ga0495639_0001898 | 3300046475 | Bacteria | 9268 |
| 229 | Ga0495639_0002795 | 3300046475 | Bacteria | 7590 |
| 230 | Ga0495594_0181691 | 3300046499 | Bacteria | 1197 |
| 231 | Ga0495608_0023227 | 3300046511 | Bacteria | 4250 |
| 232 | Ga0495618_0165241 | 3300046514 | Bacteria | 1409 |
| 233 | Ga0495628_0053758 | 3300046516 | Bacteria | 3176 |
| 234 | Ga0495628_0136003 | 3300046516 | Bacteria | 1878 |
| 235 | Ga0495630_0000139 | 3300046517 | Bacteria | 57204 |
| 236 | Ga0495666_0009661 | 3300046526 | Bacteria | 4822 |
| 237 | Ga0495666_0011157 | 3300046526 | Bacteria | 4483 |
| 238 | Ga0495642_0064653 | 3300046528 | Bacteria | 1522 |
| 239 | Ga0495652_0009814 | 3300046529 | Bacteria | 8680 |
| 240 | Ga0495652_0028583 | 3300046529 | Bacteria | 4904 |
| 241 | Ga0495652_0120977 | 3300046529 | Bacteria | 2088 |
| 242 | Ga0495665_0024216 | 3300046531 | Bacteria | 3261 |
| 243 | Ga0495640_0096765 | 3300046533 | Bacteria | 1941 |
| 244 | Ga0495586_0001299 | 3300046535 | Bacteria | 13928 |
| 245 | Ga0495586_0122644 | 3300046535 | Bacteria | 1452 |
| 246 | Ga0495587_0251266 | 3300046536 | Bacteria | 994 |
| 247 | Ga0495587_0326772 | 3300046536 | Unclassified | 856 |
| 248 | Ga0495598_0012664 | 3300046537 | Bacteria | 2075 |
| 249 | Ga0495645_0000629 | 3300046543 | Bacteria | 24231 |
| 250 | Ga0495667_0011307 | 3300046559 | Bacteria | 6041 |
| 251 | Ga0495667_0130713 | 3300046559 | Bacteria | 1619 |
| 252 | Ga0495634_0142375 | 3300046642 | Bacteria | 1521 |
| 253 | Ga0495635_0126449 | 3300046663 | Bacteria | 1743 |
| 254 | Ga0495657_0014304 | 3300046675 | Bacteria | 5827 |
| 255 | Ga0495657_0024434 | 3300046675 | Bacteria | 4304 |
| 256 | Ga0495599_0001044 | 3300046678 | Bacteria | 15560 |
| 257 | Ga0495599_0010627 | 3300046678 | Bacteria | 5634 |
| 258 | Ga0495599_0031240 | 3300046678 | Bacteria | 3343 |
| 259 | Ga0495599_0145848 | 3300046678 | Bacteria | 1467 |
| 260 | Ga0495647_0000143 | 3300046681 | Bacteria | 18295 |
| 261 | Ga0495647_0009032 | 3300046681 | Bacteria | 3363 |
| 262 | Ga0495658_0002373 | 3300046683 | Bacteria | 9509 |
| 263 | Ga0495669_0004659 | 3300046684 | Bacteria | 5684 |
| 264 | Ga0495624_0073876 | 3300046690 | Bacteria | 2119 |
| 265 | Ga0495600_0003884 | 3300046809 | Bacteria | 8870 |
| 266 | Ga0495581_0042946 | 3300047315 | Bacteria | 2616 |
| 267 | Ga0495604_0087524 | 3300047317 | Bacteria | 2320 |
| 268 | Ga0495636_0006545 | 3300047318 | Bacteria | 4580 |
| 269 | Ga0495676_0022759 | 3300047321 | Bacteria | 5448 |
| 270 | Ga0495680_0112853 | 3300047322 | Bacteria | 2012 |
| 271 | Ga0495675_0015904 | 3300047444 | Bacteria | 4757 |
| 272 | Ga0495675_0298845 | 3300047444 | Bacteria | 956 |
| 273 | Ga0495684_0035836 | 3300047471 | Bacteria | 3804 |
| 274 | Ga0496106_0527343 | 3300048909 | Bacteria | 948 |
| 275 | Ga0501031_0716685 | 3300049568 | Bacteria | 642 |
| 276 | Ga0501034_0025211 | 3300049571 | Bacteria | 6052 |
| 277 | Ga0501036_0184516 | 3300049572 | Bacteria | 1756 |
| 278 | Ga0501036_0302034 | 3300049572 | Bacteria | 1339 |
| 279 | Ga0501037_0211427 | 3300049573 | Bacteria | 1368 |
| 280 | Ga0501038_0309944 | 3300049574 | Bacteria | 1237 |
| 281 | Ga0501039_0149722 | 3300049575 | Bacteria | 1834 |
| 282 | Ga0501039_0505016 | 3300049575 | Bacteria | 949 |
| 283 | Ga0501039_0585816 | 3300049575 | Bacteria | 874 |
| 284 | Ga0501040_0179675 | 3300049576 | Bacteria | 1500 |
| 285 | Ga0501041_0095391 | 3300049577 | Bacteria | 1838 |
| 286 | Ga0501042_0038721 | 3300049578 | Bacteria | 3386 |
| 287 | Ga0501046_0361322 | 3300049580 | Bacteria | 1053 |
| 288 | Ga0501048_0175204 | 3300049582 | Bacteria | 1520 |
| 289 | Ga0501048_0519852 | 3300049582 | Bacteria | 854 |
| 290 | Ga0501068_0163897 | 3300049584 | Bacteria | 1401 |
| 291 | Ga0501070_0181714 | 3300049586 | Bacteria | 1731 |
| 292 | Ga0501071_0163116 | 3300049587 | Bacteria | 1666 |
| 293 | Ga0501071_0327497 | 3300049587 | Bacteria | 1164 |
| 294 | Ga0501071_0364536 | 3300049587 | Bacteria | 1101 |
| 295 | Ga0501071_0695487 | 3300049587 | Bacteria | 783 |
| 296 | Ga0501072_0011354 | 3300049588 | Bacteria | 6808 |
| 297 | Ga0501072_0025395 | 3300049588 | Bacteria | 4615 |
| 298 | Ga0501072_0077849 | 3300049588 | Bacteria | 2626 |
| 299 | Ga0501072_0559891 | 3300049588 | Bacteria | 902 |
| 300 | Ga0501075_0492315 | 3300049591 | Bacteria | 935 |
| 301 | Ga0501076_0455319 | 3300049592 | Bacteria | 1053 |
| 302 | Ga0501079_0120326 | 3300049741 | Bacteria | 2042 |
| 303 | Ga0501080_0113002 | 3300049742 | Bacteria | 2517 |
| 304 | Ga0501081_0115819 | 3300049743 | Bacteria | 1905 |
| 305 | Ga0501045_0018343 | 3300049824 | Bacteria | 4977 |
| 306 | Ga0501045_0251589 | 3300049824 | Bacteria | 1315 |
| 307 | nmdc:mga05p37_181348_c1 | 3300050507 | Bacteria | 2561 |
| 308 | nmdc:mga05p37_467_c2 | 3300050507 | Bacteria | 32843 |
| 309 | nmdc:mga09592_9873_c1 | 3300050508 | Bacteria | 7763 |
| 310 | nmdc:mga0qj67_357597_c1 | 3300050509 | Bacteria | 1180 |
| 311 | nmdc:mga0qj67_815940_c1 | 3300050509 | Bacteria | 738 |
| 312 | nmdc:mga06r32_27893_c1 | 3300050510 | Bacteria | 5280 |
| 313 | nmdc:mga06r32_590222_c1 | 3300050510 | Bacteria | 1082 |
| 314 | nmdc:mga08y16_8490_c1 | 3300050511 | Bacteria | 10759 |
| 315 | nmdc:mga0n895_609281_c1 | 3300050512 | Bacteria | 1094 |
| 316 | nmdc:mga0n895_864525_c1 | 3300050512 | Bacteria | 891 |
| 317 | nmdc:mga0rr50_245705_c1 | 3300050513 | Bacteria | 1485 |
| 318 | nmdc:mga0rr50_4790_c1 | 3300050513 | Bacteria | 7987 |
| 319 | nmdc:mga08x19_12569_c1 | 3300050514 | Bacteria | 5103 |
| 320 | nmdc:mga08x19_16341_c1 | 3300050514 | Bacteria | 4525 |
| 321 | nmdc:mga08x19_208891_c1 | 3300050514 | Bacteria | 1340 |
| 322 | nmdc:mga08x19_54481_c1 | 3300050514 | Bacteria | 2575 |
| 323 | nmdc:mga0a205_174121_c1 | 3300050515 | Bacteria | 2048 |
| 324 | nmdc:mga0a205_20391_c1 | 3300050515 | Bacteria | 6253 |
| 325 | Ga0495601_0001562 | 3300053077 | Bacteria | 12662 |
| 326 | Ga0495601_0022367 | 3300053077 | Bacteria | 3880 |
| 327 | Ga0495601_0173980 | 3300053077 | Bacteria | 1407 |
| 328 | Ga0495595_0043204 | 3300053084 | Bacteria | 2066 |
| 329 | Ga0501084_0089303 | 3300054114 | Bacteria | 2587 |
| 330 | Ga0501084_0327153 | 3300054114 | Bacteria | 1294 |
| 331 | Ga0590071_010908 | 3300059421 | Bacteria | 2125 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046499 | Ga0495594_0181691 | Ga0495594_0181691_37_615 | 190 |
| 2 | 3300049568 | Ga0501031_0716685 | Ga0501031_0716685_57_629 | 190 |
| 3 | 3300006914 | Ga0075436_100037968 | Ga0075436_1000379682 | 193 |
| 4 | 3300050512 | nmdc:mga0n895_864525_c1 | nmdc:mga0n895_864525_c1_45_677 | 193 |
| 5 | 3300050514 | nmdc:mga08x19_54481_c1 | nmdc:mga08x19_54481_c1_699_1331 | 193 |
| 6 | 3300046675 | Ga0495657_0014304 | Ga0495657_0014304_1981_2580 | 195 |
| 7 | 3300005341 | Ga0070691_10080730 | Ga0070691_100807302 | 196 |
| 8 | 3300005444 | Ga0070694_100118443 | Ga0070694_1001184433 | 196 |
| 9 | 3300005536 | Ga0070697_100544332 | Ga0070697_1005443321 | 196 |
| 10 | 3300006847 | Ga0075431_100661923 | Ga0075431_1006619232 | 196 |
| 11 | 3300006852 | Ga0075433_10309295 | Ga0075433_103092952 | 196 |
| 12 | 3300006871 | Ga0075434_100018240 | Ga0075434_1000182403 | 196 |
| 13 | 3300006914 | Ga0075436_100015929 | Ga0075436_1000159293 | 196 |
| 14 | 3300006914 | Ga0075436_100059824 | Ga0075436_1000598242 | 196 |
| 15 | 3300006914 | Ga0075436_100268217 | Ga0075436_1002682172 | 196 |
| 16 | 3300014326 | Ga0157380_10345990 | Ga0157380_103459901 | 196 |
| 17 | 3300027360 | Ga0209969_1006468 | Ga0209969_10064682 | 196 |
| 18 | 3300027395 | Ga0209996_1007683 | Ga0209996_10076832 | 196 |
| 19 | 3300027471 | Ga0209995_1005986 | Ga0209995_10059862 | 196 |
| 20 | 3300027526 | Ga0209968_1007769 | Ga0209968_10077692 | 196 |
| 21 | 3300027682 | Ga0209971_1004757 | Ga0209971_10047572 | 196 |
| 22 | 3300032002 | Ga0307416_100436445 | Ga0307416_1004364452 | 196 |
| 23 | 3300035691 | Ga0373931_0069123 | Ga0373931_0069123_538_1128 | 196 |
| 24 | 3300042133 | Ga0450896_009450 | Ga0450896_009450_724_1314 | 196 |
| 25 | 3300042156 | Ga0439446_0033612 | Ga0439446_0033612_789_1379 | 196 |
| 26 | 3300042436 | Ga0439435_0001698 | Ga0439435_0001698_3118_3708 | 196 |
| 27 | 3300044673 | Ga0453683_0134722 | Ga0453683_0134722_703_1302 | 196 |
| 28 | 3300044901 | Ga0466960_0505054 | Ga0466960_0505054_65_655 | 196 |
| 29 | 3300045051 | Ga0451576_0000013 | Ga0451576_0000013_364472_365071 | 196 |
| 30 | 3300045051 | Ga0451576_1466499 | Ga0451576_1466499_81_671 | 196 |
| 31 | 3300046537 | Ga0495598_0012664 | Ga0495598_0012664_580_1170 | 196 |
| 32 | 3300049572 | Ga0501036_0302034 | Ga0501036_0302034_108_698 | 196 |
| 33 | 3300049574 | Ga0501038_0309944 | Ga0501038_0309944_600_1190 | 196 |
| 34 | 3300049575 | Ga0501039_0149722 | Ga0501039_0149722_575_1165 | 196 |
| 35 | 3300049575 | Ga0501039_0505016 | Ga0501039_0505016_159_749 | 196 |
| 36 | 3300049575 | Ga0501039_0585816 | Ga0501039_0585816_102_692 | 196 |
| 37 | 3300049576 | Ga0501040_0179675 | Ga0501040_0179675_575_1165 | 196 |
| 38 | 3300049577 | Ga0501041_0095391 | Ga0501041_0095391_930_1520 | 196 |
| 39 | 3300049578 | Ga0501042_0038721 | Ga0501042_0038721_518_1108 | 196 |
| 40 | 3300049580 | Ga0501046_0361322 | Ga0501046_0361322_380_970 | 196 |
| 41 | 3300049582 | Ga0501048_0175204 | Ga0501048_0175204_262_852 | 196 |
| 42 | 3300049587 | Ga0501071_0163116 | Ga0501071_0163116_680_1270 | 196 |
| 43 | 3300049587 | Ga0501071_0327497 | Ga0501071_0327497_21_611 | 196 |
| 44 | 3300049587 | Ga0501071_0695487 | Ga0501071_0695487_160_750 | 196 |
| 45 | 3300049588 | Ga0501072_0011354 | Ga0501072_0011354_2854_3444 | 196 |
| 46 | 3300049588 | Ga0501072_0077849 | Ga0501072_0077849_990_1580 | 196 |
| 47 | 3300049588 | Ga0501072_0559891 | Ga0501072_0559891_199_789 | 196 |
| 48 | 3300049591 | Ga0501075_0492315 | Ga0501075_0492315_20_610 | 196 |
| 49 | 3300049592 | Ga0501076_0455319 | Ga0501076_0455319_294_884 | 196 |
| 50 | 3300049741 | Ga0501079_0120326 | Ga0501079_0120326_866_1456 | 196 |
| 51 | 3300049743 | Ga0501081_0115819 | Ga0501081_0115819_133_723 | 196 |
| 52 | 3300049824 | Ga0501045_0018343 | Ga0501045_0018343_1302_1892 | 196 |
| 53 | 3300049824 | Ga0501045_0251589 | Ga0501045_0251589_527_1117 | 196 |
| 54 | 3300050507 | nmdc:mga05p37_181348_c1 | nmdc:mga05p37_181348_c1_1625_2215 | 196 |
| 55 | 3300050510 | nmdc:mga06r32_590222_c1 | nmdc:mga06r32_590222_c1_345_935 | 196 |
| 56 | 3300050512 | nmdc:mga0n895_609281_c1 | nmdc:mga0n895_609281_c1_383_973 | 196 |
| 57 | 3300050513 | nmdc:mga0rr50_245705_c1 | nmdc:mga0rr50_245705_c1_606_1196 | 196 |
| 58 | 3300050514 | nmdc:mga08x19_12569_c1 | nmdc:mga08x19_12569_c1_1692_2282 | 196 |
| 59 | 3300050514 | nmdc:mga08x19_16341_c1 | nmdc:mga08x19_16341_c1_2542_3174 | 196 |
| 60 | 3300050514 | nmdc:mga08x19_208891_c1 | nmdc:mga08x19_208891_c1_487_1077 | 196 |
| 61 | 3300050515 | nmdc:mga0a205_174121_c1 | nmdc:mga0a205_174121_c1_303_893 | 196 |
| 62 | 3300054114 | Ga0501084_0327153 | Ga0501084_0327153_462_1052 | 196 |
| 63 | 3300059421 | Ga0590071_010908 | Ga0590071_010908_57_647 | 196 |
| 64 | 3300005334 | Ga0068869_100000173 | Ga0068869_10000017328 | 197 |
| 65 | 3300005336 | Ga0070680_100005731 | Ga0070680_1000057314 | 197 |
| 66 | 3300005337 | Ga0070682_100018005 | Ga0070682_1000180052 | 197 |
| 67 | 3300005338 | Ga0068868_100000510 | Ga0068868_10000051018 | 197 |
| 68 | 3300005340 | Ga0070689_100000268 | Ga0070689_10000026819 | 197 |
| 69 | 3300005341 | Ga0070691_10002480 | Ga0070691_100024809 | 197 |
| 70 | 3300005343 | Ga0070687_100000048 | Ga0070687_10000004829 | 197 |
| 71 | 3300005345 | Ga0070692_10011786 | Ga0070692_100117863 | 197 |
| 72 | 3300005345 | Ga0070692_10143384 | Ga0070692_101433842 | 197 |
| 73 | 3300005364 | Ga0070673_100167776 | Ga0070673_1001677762 | 197 |
| 74 | 3300005365 | Ga0070688_100101475 | Ga0070688_1001014752 | 197 |
| 75 | 3300005438 | Ga0070701_10000094 | Ga0070701_100000947 | 197 |
| 76 | 3300005440 | Ga0070705_100000061 | Ga0070705_10000006156 | 197 |
| 77 | 3300005441 | Ga0070700_100000690 | Ga0070700_10000069013 | 197 |
| 78 | 3300005444 | Ga0070694_100000087 | Ga0070694_10000008729 | 197 |
| 79 | 3300005444 | Ga0070694_100028746 | Ga0070694_1000287464 | 197 |
| 80 | 3300005456 | Ga0070678_100075703 | Ga0070678_1000757032 | 197 |
| 81 | 3300005459 | Ga0068867_100000308 | Ga0068867_10000030828 | 197 |
| 82 | 3300005530 | Ga0070679_100044832 | Ga0070679_1000448322 | 197 |
| 83 | 3300005539 | Ga0068853_100527457 | Ga0068853_1005274571 | 197 |
| 84 | 3300005544 | Ga0070686_100000348 | Ga0070686_10000034828 | 197 |
| 85 | 3300005545 | Ga0070695_100000991 | Ga0070695_10000099115 | 197 |
| 86 | 3300005545 | Ga0070695_100066800 | Ga0070695_1000668003 | 197 |
| 87 | 3300005546 | Ga0070696_100000013 | Ga0070696_10000001364 | 197 |
| 88 | 3300005546 | Ga0070696_100377960 | Ga0070696_1003779602 | 197 |
| 89 | 3300005547 | Ga0070693_100000003 | Ga0070693_10000000394 | 197 |
| 90 | 3300005549 | Ga0070704_100000029 | Ga0070704_10000002929 | 197 |
| 91 | 3300005563 | Ga0068855_100008704 | Ga0068855_1000087049 | 197 |
| 92 | 3300005578 | Ga0068854_100008305 | Ga0068854_1000083053 | 197 |
| 93 | 3300005615 | Ga0070702_100000067 | Ga0070702_10000006718 | 197 |
| 94 | 3300005616 | Ga0068852_100072545 | Ga0068852_1000725453 | 197 |
| 95 | 3300005617 | Ga0068859_100001987 | Ga0068859_1000019878 | 197 |
| 96 | 3300005718 | Ga0068866_10000437 | Ga0068866_1000043718 | 197 |
| 97 | 3300005719 | Ga0068861_100000135 | Ga0068861_10000013522 | 197 |
| 98 | 3300005840 | Ga0068870_10039047 | Ga0068870_100390472 | 197 |
| 99 | 3300005842 | Ga0068858_100001335 | Ga0068858_10000133522 | 197 |
| 100 | 3300005843 | Ga0068860_100000929 | Ga0068860_10000092916 | 197 |
| 101 | 3300005844 | Ga0068862_100001963 | Ga0068862_10000196315 | 197 |
| 102 | 3300006237 | Ga0097621_100000024 | Ga0097621_10000002438 | 197 |
| 103 | 3300006358 | Ga0068871_100001309 | Ga0068871_1000013092 | 197 |
| 104 | 3300006852 | Ga0075433_10122991 | Ga0075433_101229912 | 197 |
| 105 | 3300006880 | Ga0075429_100001307 | Ga0075429_1000013074 | 197 |
| 106 | 3300006881 | Ga0068865_100000207 | Ga0068865_1000002078 | 197 |
| 107 | 3300006931 | Ga0097620_100001987 | Ga0097620_1000019878 | 197 |
| 108 | 3300007076 | Ga0075435_100008098 | Ga0075435_1000080989 | 197 |
| 109 | 3300009098 | Ga0105245_10000544 | Ga0105245_100005449 | 197 |
| 110 | 3300009147 | Ga0114129_10003063 | Ga0114129_1000306318 | 197 |
| 111 | 3300009148 | Ga0105243_10000339 | Ga0105243_1000033949 | 197 |
| 112 | 3300009174 | Ga0105241_10024923 | Ga0105241_100249234 | 197 |
| 113 | 3300009176 | Ga0105242_10000416 | Ga0105242_100004166 | 197 |
| 114 | 3300009177 | Ga0105248_10247346 | Ga0105248_102473462 | 197 |
| 115 | 3300009551 | Ga0105238_10937327 | Ga0105238_109373272 | 197 |
| 116 | 3300009553 | Ga0105249_10004765 | Ga0105249_100047653 | 197 |
| 117 | 3300010375 | Ga0105239_10013820 | Ga0105239_1001382012 | 197 |
| 118 | 3300012483 | Ga0157337_1008928 | Ga0157337_10089281 | 197 |
| 119 | 3300013297 | Ga0157378_10001176 | Ga0157378_1000117620 | 197 |
| 120 | 3300013306 | Ga0163162_10460322 | Ga0163162_104603222 | 197 |
| 121 | 3300014326 | Ga0157380_10108386 | Ga0157380_101083863 | 197 |
| 122 | 3300014968 | Ga0157379_10087855 | Ga0157379_100878552 | 197 |
| 123 | 3300014969 | Ga0157376_10023183 | Ga0157376_100231832 | 197 |
| 124 | 3300025885 | Ga0207653_10004359 | Ga0207653_100043592 | 197 |
| 125 | 3300025899 | Ga0207642_10000618 | Ga0207642_100006183 | 197 |
| 126 | 3300025908 | Ga0207643_10006018 | Ga0207643_100060183 | 197 |
| 127 | 3300025911 | Ga0207654_10007456 | Ga0207654_100074564 | 197 |
| 128 | 3300025912 | Ga0207707_10399099 | Ga0207707_103990992 | 197 |
| 129 | 3300025917 | Ga0207660_10003082 | Ga0207660_100030823 | 197 |
| 130 | 3300025917 | Ga0207660_10045334 | Ga0207660_100453343 | 197 |
| 131 | 3300025918 | Ga0207662_10000034 | Ga0207662_1000003451 | 197 |
| 132 | 3300025921 | Ga0207652_10014909 | Ga0207652_100149093 | 197 |
| 133 | 3300025926 | Ga0207659_10673669 | Ga0207659_106736691 | 197 |
| 134 | 3300025927 | Ga0207687_10001364 | Ga0207687_100013642 | 197 |
| 135 | 3300025934 | Ga0207686_10001176 | Ga0207686_100011762 | 197 |
| 136 | 3300025935 | Ga0207709_10000297 | Ga0207709_1000029757 | 197 |
| 137 | 3300025936 | Ga0207670_10001671 | Ga0207670_100016719 | 197 |
| 138 | 3300025938 | Ga0207704_10001437 | Ga0207704_100014378 | 197 |
| 139 | 3300025940 | Ga0207691_10206388 | Ga0207691_102063882 | 197 |
| 140 | 3300025941 | Ga0207711_10484617 | Ga0207711_104846172 | 197 |
| 141 | 3300025942 | Ga0207689_10000336 | Ga0207689_1000033618 | 197 |
| 142 | 3300025949 | Ga0207667_10006876 | Ga0207667_100068765 | 197 |
| 143 | 3300025981 | Ga0207640_10001441 | Ga0207640_100014413 | 197 |
| 144 | 3300026035 | Ga0207703_10002827 | Ga0207703_1000282716 | 197 |
| 145 | 3300026041 | Ga0207639_10438888 | Ga0207639_104388882 | 197 |
| 146 | 3300026075 | Ga0207708_10000048 | Ga0207708_10000048108 | 197 |
| 147 | 3300026078 | Ga0207702_10017023 | Ga0207702_100170236 | 197 |
| 148 | 3300026089 | Ga0207648_10000519 | Ga0207648_1000051931 | 197 |
| 149 | 3300026118 | Ga0207675_100000464 | Ga0207675_10000046428 | 197 |
| 150 | 3300026142 | Ga0207698_10088618 | Ga0207698_100886182 | 197 |
| 151 | 3300027907 | Ga0207428_10000748 | Ga0207428_1000074816 | 197 |
| 152 | 3300028380 | Ga0268265_10001624 | Ga0268265_100016248 | 197 |
| 153 | 3300028381 | Ga0268264_10000423 | Ga0268264_1000042341 | 197 |
| 154 | 3300034816 | Ga0373930_0047884 | Ga0373930_0047884_247_840 | 197 |
| 155 | 3300035089 | Ga0373944_0021963 | Ga0373944_0021963_868_1461 | 197 |
| 156 | 3300035091 | Ga0373951_0002305 | Ga0373951_0002305_2070_2663 | 197 |
| 157 | 3300035111 | Ga0373923_0120539 | Ga0373923_0120539_548_1141 | 197 |
| 158 | 3300035113 | Ga0373936_0018914 | Ga0373936_0018914_527_1120 | 197 |
| 159 | 3300035114 | Ga0373939_0072232 | Ga0373939_0072232_204_797 | 197 |
| 160 | 3300035116 | Ga0373945_0013502 | Ga0373945_0013502_500_1093 | 197 |
| 161 | 3300035171 | Ga0373946_0083831 | Ga0373946_0083831_482_1075 | 197 |
| 162 | 3300035691 | Ga0373931_0002594 | Ga0373931_0002594_3242_3835 | 197 |
| 163 | 3300035692 | Ga0373935_0027700 | Ga0373935_0027700_2508_3101 | 197 |
| 164 | 3300042876 | Ga0451577_0115421 | Ga0451577_0115421_440_1033 | 197 |
| 165 | 3300044712 | Ga0453684_0019085 | Ga0453684_0019085_800_1516 | 197 |
| 166 | 3300044712 | Ga0453684_0569900 | Ga0453684_0569900_374_967 | 197 |
| 167 | 3300045051 | Ga0451576_0000220 | Ga0451576_0000220_123419_124012 | 197 |
| 168 | 3300045051 | Ga0451576_0152782 | Ga0451576_0152782_520_1113 | 197 |
| 169 | 3300045976 | Ga0466967_0233665 | Ga0466967_0233665_577_1170 | 197 |
| 170 | 3300046455 | Ga0495603_0006622 | Ga0495603_0006622_1251_1844 | 197 |
| 171 | 3300046475 | Ga0495639_0001898 | Ga0495639_0001898_3793_4386 | 197 |
| 172 | 3300046526 | Ga0495666_0009661 | Ga0495666_0009661_2267_2860 | 197 |
| 173 | 3300046528 | Ga0495642_0064653 | Ga0495642_0064653_191_784 | 197 |
| 174 | 3300046531 | Ga0495665_0024216 | Ga0495665_0024216_242_835 | 197 |
| 175 | 3300046535 | Ga0495586_0001299 | Ga0495586_0001299_5731_6324 | 197 |
| 176 | 3300046681 | Ga0495647_0000143 | Ga0495647_0000143_5074_5667 | 197 |
| 177 | 3300046683 | Ga0495658_0002373 | Ga0495658_0002373_5571_6164 | 197 |
| 178 | 3300046684 | Ga0495669_0004659 | Ga0495669_0004659_3167_3760 | 197 |
| 179 | 3300047315 | Ga0495581_0042946 | Ga0495581_0042946_1571_2164 | 197 |
| 180 | 3300047321 | Ga0495676_0022759 | Ga0495676_0022759_3801_4394 | 197 |
| 181 | 3300049582 | Ga0501048_0519852 | Ga0501048_0519852_183_785 | 197 |
| 182 | 3300049587 | Ga0501071_0364536 | Ga0501071_0364536_294_899 | 197 |
| 183 | 3300050507 | nmdc:mga05p37_467_c2 | nmdc:mga05p37_467_c2_16999_17592 | 197 |
| 184 | 3300050508 | nmdc:mga09592_9873_c1 | nmdc:mga09592_9873_c1_4342_4935 | 197 |
| 185 | 3300050509 | nmdc:mga0qj67_357597_c1 | nmdc:mga0qj67_357597_c1_38_631 | 197 |
| 186 | 3300050510 | nmdc:mga06r32_27893_c1 | nmdc:mga06r32_27893_c1_3402_3995 | 197 |
| 187 | 3300050511 | nmdc:mga08y16_8490_c1 | nmdc:mga08y16_8490_c1_3436_4029 | 197 |
| 188 | 3300050513 | nmdc:mga0rr50_4790_c1 | nmdc:mga0rr50_4790_c1_4667_5260 | 197 |
| 189 | 3300050515 | nmdc:mga0a205_20391_c1 | nmdc:mga0a205_20391_c1_4259_4852 | 197 |
| 190 | 3300031250 | Ga0265331_10080403 | Ga0265331_100804032 | 198 |
| 191 | 3300044673 | Ga0453683_0059499 | Ga0453683_0059499_1659_2270 | 199 |
| 192 | 3300045051 | Ga0451576_0057736 | Ga0451576_0057736_2641_3252 | 199 |
| 193 | 3300049573 | Ga0501037_0211427 | Ga0501037_0211427_46_687 | 200 |
| 194 | 3300049584 | Ga0501068_0163897 | Ga0501068_0163897_721_1362 | 200 |
| 195 | 3300049586 | Ga0501070_0181714 | Ga0501070_0181714_480_1121 | 200 |
| 196 | 3300049742 | Ga0501080_0113002 | Ga0501080_0113002_454_1095 | 200 |
| 197 | 3300054114 | Ga0501084_0089303 | Ga0501084_0089303_951_1592 | 200 |
| 198 | 3300028666 | Ga0265336_10067824 | Ga0265336_100678242 | 201 |
| 199 | 3300029957 | Ga0265324_10002313 | Ga0265324_1000231311 | 201 |
| 200 | 3300031235 | Ga0265330_10008022 | Ga0265330_100080222 | 201 |
| 201 | 3300031238 | Ga0265332_10011352 | Ga0265332_100113523 | 201 |
| 202 | 3300031250 | Ga0265331_10051689 | Ga0265331_100516892 | 201 |
| 203 | 3300031250 | Ga0265331_10082944 | Ga0265331_100829442 | 201 |
| 204 | 3300031711 | Ga0265314_10004039 | Ga0265314_1000403911 | 201 |
| 205 | 3300042876 | Ga0451577_0020031 | Ga0451577_0020031_1582_2199 | 201 |
| 206 | 3300044673 | Ga0453683_0528827 | Ga0453683_0528827_102_719 | 201 |
| 207 | 3300044712 | Ga0453684_0001529 | Ga0453684_0001529_54631_55248 | 201 |
| 208 | 3300044712 | Ga0453684_0451583 | Ga0453684_0451583_730_1371 | 201 |
| 209 | 3300045051 | Ga0451576_0001977 | Ga0451576_0001977_22953_23570 | 201 |
| 210 | 3300029957 | Ga0265324_10108466 | Ga0265324_101084661 | 202 |
| 211 | 3300031241 | Ga0265325_10245744 | Ga0265325_102457441 | 202 |
| 212 | 3300031251 | Ga0265327_10004904 | Ga0265327_1000490413 | 202 |
| 213 | 3300031251 | Ga0265327_10014344 | Ga0265327_100143442 | 202 |
| 214 | 3300031344 | Ga0265316_10038233 | Ga0265316_100382332 | 202 |
| 215 | 3300035086 | Ga0373934_0000310 | Ga0373934_0000310_9399_10025 | 202 |
| 216 | 3300035091 | Ga0373951_0074918 | Ga0373951_0074918_13_624 | 202 |
| 217 | 3300035119 | Ga0373956_0000428 | Ga0373956_0000428_9765_10391 | 202 |
| 218 | 3300035120 | Ga0373957_0002458 | Ga0373957_0002458_2655_3281 | 202 |
| 219 | 3300035691 | Ga0373931_0137448 | Ga0373931_0137448_329_940 | 202 |
| 220 | 3300035724 | Ga0373933_0000632 | Ga0373933_0000632_7545_8171 | 202 |
| 221 | 3300036401 | Ga0373937_0000371 | Ga0373937_0000371_40495_41121 | 202 |
| 222 | 3300044712 | Ga0453684_0027336 | Ga0453684_0027336_7419_8030 | 202 |
| 223 | 3300046462 | Ga0495651_0000056 | Ga0495651_0000056_66676_67302 | 202 |
| 224 | 3300047444 | Ga0495675_0298845 | Ga0495675_0298845_129_755 | 202 |
| 225 | 3300048909 | Ga0496106_0527343 | Ga0496106_0527343_210_821 | 202 |
| 226 | 3300050509 | nmdc:mga0qj67_815940_c1 | nmdc:mga0qj67_815940_c1_62_706 | 202 |
| 227 | 3300007788 | Ga0099795_10042452 | Ga0099795_100424522 | 203 |
| 228 | 3300025912 | Ga0207707_10108181 | Ga0207707_101081812 | 203 |
| 229 | 3300028666 | Ga0265336_10002226 | Ga0265336_100022267 | 203 |
| 230 | 3300029957 | Ga0265324_10000002 | Ga0265324_1000000238 | 203 |
| 231 | 3300029957 | Ga0265324_10138185 | Ga0265324_101381852 | 203 |
| 232 | 3300031239 | Ga0265328_10024132 | Ga0265328_100241323 | 203 |
| 233 | 3300031241 | Ga0265325_10002066 | Ga0265325_100020665 | 203 |
| 234 | 3300031250 | Ga0265331_10003938 | Ga0265331_100039385 | 203 |
| 235 | 3300031250 | Ga0265331_10005696 | Ga0265331_100056966 | 203 |
| 236 | 3300031251 | Ga0265327_10001224 | Ga0265327_1000122429 | 203 |
| 237 | 3300031344 | Ga0265316_10118384 | Ga0265316_101183843 | 203 |
| 238 | 3300031711 | Ga0265314_10017586 | Ga0265314_100175862 | 203 |
| 239 | 3300035083 | Ga0373926_0007026 | Ga0373926_0007026_3046_3675 | 203 |
| 240 | 3300035086 | Ga0373934_0017274 | Ga0373934_0017274_364_993 | 203 |
| 241 | 3300035113 | Ga0373936_0067176 | Ga0373936_0067176_29_658 | 203 |
| 242 | 3300035116 | Ga0373945_0017953 | Ga0373945_0017953_1732_2361 | 203 |
| 243 | 3300035118 | Ga0373954_0008567 | Ga0373954_0008567_3251_3877 | 203 |
| 244 | 3300035119 | Ga0373956_0076394 | Ga0373956_0076394_871_1500 | 203 |
| 245 | 3300035170 | Ga0373943_0015943 | Ga0373943_0015943_1099_1728 | 203 |
| 246 | 3300035172 | Ga0373955_0005800 | Ga0373955_0005800_1071_1700 | 203 |
| 247 | 3300035692 | Ga0373935_0453649 | Ga0373935_0453649_264_893 | 203 |
| 248 | 3300035695 | Ga0373927_0070922 | Ga0373927_0070922_673_1302 | 203 |
| 249 | 3300036401 | Ga0373937_0368152 | Ga0373937_0368152_320_949 | 203 |
| 250 | 3300037068 | Ga0373925_0056418 | Ga0373925_0056418_1319_1948 | 203 |
| 251 | 3300042876 | Ga0451577_0000013 | Ga0451577_0000013_388502_389140 | 203 |
| 252 | 3300042876 | Ga0451577_0002441 | Ga0451577_0002441_9820_10470 | 203 |
| 253 | 3300042876 | Ga0451577_0009089 | Ga0451577_0009089_8863_9513 | 203 |
| 254 | 3300042876 | Ga0451577_0101326 | Ga0451577_0101326_502_1116 | 203 |
| 255 | 3300042876 | Ga0451577_0336192 | Ga0451577_0336192_285_923 | 203 |
| 256 | 3300044673 | Ga0453683_0000059 | Ga0453683_0000059_24971_25609 | 203 |
| 257 | 3300044712 | Ga0453684_0000040 | Ga0453684_0000040_8679_9368 | 203 |
| 258 | 3300044712 | Ga0453684_0000085 | Ga0453684_0000085_8678_9316 | 203 |
| 259 | 3300044712 | Ga0453684_0057667 | Ga0453684_0057667_3479_4129 | 203 |
| 260 | 3300044712 | Ga0453684_0062868 | Ga0453684_0062868_638_1252 | 203 |
| 261 | 3300045051 | Ga0451576_0000018 | Ga0451576_0000018_161550_162188 | 203 |
| 262 | 3300045051 | Ga0451576_0002261 | Ga0451576_0002261_16612_17262 | 203 |
| 263 | 3300045051 | Ga0451576_0002688 | Ga0451576_0002688_12926_13576 | 203 |
| 264 | 3300045051 | Ga0451576_0119767 | Ga0451576_0119767_1842_2492 | 203 |
| 265 | 3300046454 | Ga0495592_0001655 | Ga0495592_0001655_9705_10334 | 203 |
| 266 | 3300046454 | Ga0495592_0012915 | Ga0495592_0012915_4195_4824 | 203 |
| 267 | 3300046461 | Ga0495641_0010479 | Ga0495641_0010479_4384_5013 | 203 |
| 268 | 3300046463 | Ga0495653_0074900 | Ga0495653_0074900_1526_2155 | 203 |
| 269 | 3300046472 | Ga0495580_0126246 | Ga0495580_0126246_365_994 | 203 |
| 270 | 3300046475 | Ga0495639_0002795 | Ga0495639_0002795_6473_7102 | 203 |
| 271 | 3300046511 | Ga0495608_0023227 | Ga0495608_0023227_1361_1990 | 203 |
| 272 | 3300046514 | Ga0495618_0165241 | Ga0495618_0165241_367_996 | 203 |
| 273 | 3300046516 | Ga0495628_0053758 | Ga0495628_0053758_1923_2552 | 203 |
| 274 | 3300046516 | Ga0495628_0136003 | Ga0495628_0136003_640_1269 | 203 |
| 275 | 3300046517 | Ga0495630_0000139 | Ga0495630_0000139_5106_5735 | 203 |
| 276 | 3300046526 | Ga0495666_0011157 | Ga0495666_0011157_3166_3795 | 203 |
| 277 | 3300046529 | Ga0495652_0009814 | Ga0495652_0009814_4884_5513 | 203 |
| 278 | 3300046529 | Ga0495652_0028583 | Ga0495652_0028583_1192_1821 | 203 |
| 279 | 3300046529 | Ga0495652_0120977 | Ga0495652_0120977_1390_2019 | 203 |
| 280 | 3300046533 | Ga0495640_0096765 | Ga0495640_0096765_770_1399 | 203 |
| 281 | 3300046535 | Ga0495586_0122644 | Ga0495586_0122644_112_741 | 203 |
| 282 | 3300046536 | Ga0495587_0251266 | Ga0495587_0251266_144_770 | 203 |
| 283 | 3300046543 | Ga0495645_0000629 | Ga0495645_0000629_14206_14835 | 203 |
| 284 | 3300046559 | Ga0495667_0130713 | Ga0495667_0130713_958_1587 | 203 |
| 285 | 3300046642 | Ga0495634_0142375 | Ga0495634_0142375_845_1474 | 203 |
| 286 | 3300046663 | Ga0495635_0126449 | Ga0495635_0126449_1099_1728 | 203 |
| 287 | 3300046675 | Ga0495657_0024434 | Ga0495657_0024434_2708_3337 | 203 |
| 288 | 3300046678 | Ga0495599_0001044 | Ga0495599_0001044_9681_10310 | 203 |
| 289 | 3300046678 | Ga0495599_0010627 | Ga0495599_0010627_2045_2674 | 203 |
| 290 | 3300046678 | Ga0495599_0031240 | Ga0495599_0031240_1225_1851 | 203 |
| 291 | 3300046678 | Ga0495599_0145848 | Ga0495599_0145848_701_1330 | 203 |
| 292 | 3300046681 | Ga0495647_0009032 | Ga0495647_0009032_2368_2997 | 203 |
| 293 | 3300046690 | Ga0495624_0073876 | Ga0495624_0073876_625_1254 | 203 |
| 294 | 3300046809 | Ga0495600_0003884 | Ga0495600_0003884_414_1043 | 203 |
| 295 | 3300047318 | Ga0495636_0006545 | Ga0495636_0006545_3590_4216 | 203 |
| 296 | 3300047322 | Ga0495680_0112853 | Ga0495680_0112853_143_772 | 203 |
| 297 | 3300047444 | Ga0495675_0015904 | Ga0495675_0015904_90_719 | 203 |
| 298 | 3300047471 | Ga0495684_0035836 | Ga0495684_0035836_265_894 | 203 |
| 299 | 3300053077 | Ga0495601_0001562 | Ga0495601_0001562_3435_4064 | 203 |
| 300 | 3300053077 | Ga0495601_0022367 | Ga0495601_0022367_455_1084 | 203 |
| 301 | 3300053077 | Ga0495601_0173980 | Ga0495601_0173980_570_1199 | 203 |
| 302 | 3300053084 | Ga0495595_0043204 | Ga0495595_0043204_1347_1976 | 203 |
| 303 | 3300007265 | Ga0099794_10388081 | Ga0099794_103880811 | 204 |
| 304 | 3300006173 | Ga0070716_100046932 | Ga0070716_1000469322 | 205 |
| 305 | 3300007076 | Ga0075435_100929358 | Ga0075435_1009293582 | 205 |
| 306 | 3300025939 | Ga0207665_10066919 | Ga0207665_100669192 | 205 |
| 307 | 3300010159 | Ga0099796_10017691 | Ga0099796_100176912 | 206 |
| 308 | 3300025941 | Ga0207711_10133706 | Ga0207711_101337063 | 207 |
| 309 | 3300005441 | Ga0070700_100018135 | Ga0070700_1000181352 | 209 |
| 310 | 3300006163 | Ga0070715_10078672 | Ga0070715_100786722 | 209 |
| 311 | 3300009098 | Ga0105245_10037385 | Ga0105245_100373853 | 209 |
| 312 | 3300009148 | Ga0105243_10819947 | Ga0105243_108199472 | 209 |
| 313 | 3300009176 | Ga0105242_10064586 | Ga0105242_100645862 | 209 |
| 314 | 3300013296 | Ga0157374_10376850 | Ga0157374_103768503 | 209 |
| 315 | 3300025934 | Ga0207686_10077623 | Ga0207686_100776232 | 209 |
| 316 | 3300025935 | Ga0207709_10619799 | Ga0207709_106197992 | 209 |
| 317 | 3300026089 | Ga0207648_10017632 | Ga0207648_100176322 | 209 |
| 318 | 3300035117 | Ga0373953_0231002 | Ga0373953_0231002_99_776 | 209 |
| 319 | 3300036401 | Ga0373937_0029221 | Ga0373937_0029221_2312_2989 | 209 |
| 320 | 3300046536 | Ga0495587_0326772 | Ga0495587_0326772_108_785 | 209 |
| 321 | 3300046559 | Ga0495667_0011307 | Ga0495667_0011307_4892_5569 | 209 |
| 322 | 3300047317 | Ga0495604_0087524 | Ga0495604_0087524_1259_1936 | 209 |
| 323 | 3300049571 | Ga0501034_0025211 | Ga0501034_0025211_240_923 | 210 |
| 324 | 3300049588 | Ga0501072_0025395 | Ga0501072_0025395_1115_1798 | 210 |
| 325 | 3300036401 | Ga0373937_0582742 | Ga0373937_0582742_124_810 | 211 |
| 326 | 3300049572 | Ga0501036_0184516 | Ga0501036_0184516_429_1088 | 211 |
| 327 | 3300006237 | Ga0097621_100012183 | Ga0097621_1000121832 | 212 |
| 328 | 3300009551 | Ga0105238_10044789 | Ga0105238_100447893 | 213 |
| 329 | 3300035119 | Ga0373956_0243232 | Ga0373956_0243232_64_789 | 213 |
| 330 | 3300005330 | Ga0070690_100363366 | Ga0070690_1003633661 | 215 |
| 331 | 3300005459 | Ga0068867_100980218 | Ga0068867_1009802181 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o1j-assembly1.cif.gz_A | lytic transglycosylase in action | 0.8104 | 85 | 201 |
| 6h5f-assembly1.cif.gz_A | ltga disordered helix | 0.8097 | 85 | 190 |
| 6fbt-assembly1.cif.gz_A | the x-ray structure of lytic transglycosylase slt from pseudomonas aeruginosa in complex with the reaction product nag-anhnampentapeptide | 0.7734 | 85 | 190 |
| 4oxv-assembly1.cif.gz_A | crystal structure of mltf from pseudomonas aeruginosa complexed with valine | 0.7714 | 71 | 196 |
| 1qte-assembly1.cif.gz_A | crystal structure of the 70 kda soluble lytic transglycosylase slt70 from escherichia coli at 1.90 a resolution in complex with a 1,6-anhydromurotripeptide | 0.7522 | 95 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEZ7_97_250_1.10.530.10 | Mainly Alpha;Orthogonal Bundle;Lysozyme; | 0.8201 | 81 | 178 | 1.10.530.10 |
| 1slyA03 | Mainly Alpha;Orthogonal Bundle;Lysozyme; | 0.766 | 95 | 207 | 1.10.530.10 |
| af_A0A1D6QSC1_388_533_1.10.530.10 | Mainly Alpha;Orthogonal Bundle;Lysozyme; | 0.7506 | 85 | 195 | 1.10.530.10 |
| 4cfoB02 | Mainly Alpha;Orthogonal Bundle;Lysozyme; | 0.7175 | 82 | 191 | 1.10.530.10 |
| af_A0A178WGK2_281_420_1.10.530.10 | Mainly Alpha;Orthogonal Bundle;Lysozyme; | 0.7027 | 81 | 198 | 1.10.530.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C1DPK5-F1-model_v4 | Lytic transglycosylase domain-containing protein | 0.9833 | 30 | 197 |
|
| AF-A0A536ZLX0-F1-model_v4 | Lytic transglycosylase domain-containing protein | 0.9787 | 22 | 196 |
|
| AF-A0A1F4BE54-F1-model_v4 | Transglycosylase | 0.9779 | 17 | 196 |
|
| AF-A0A537AJ55-F1-model_v4 | Lytic transglycosylase domain-containing protein | 0.977 | 52 | 197 |
|
| AF-A0A523GN10-F1-model_v4 | Lytic transglycosylase domain-containing protein | 0.9766 | 122 | 196 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar