F410551

General Info

Members Datasets Scaffolds Average Seq Length
331 141 662 198

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10012412|Ga0265760_100124123
Length 211
Sequence LTSGQGSHKTESVSALHKITGDDLRLQVFSRLFDMPTKRSQPAQRKPRADAERNRERILEVAKEAFTRSGANTSLDDIAKQAGVGPGTLYRHFPTREELLQAVYRSEMEKLAAAERKFAQSMPPIKALRAWLLLFVDAIETKQIIAPALNTLIGDPKKVFAASSGDIRRDLDPMDLLRALVGVANVATGPDWQQSAKRLVDILIIGSRPIR

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
140 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
141 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 0.3
Rhizosphere 96.98
Stem 0
Stem Tuber 0
Unclassified 24.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10012412 3300031090 Bacteria 2436
2 LJNas_1000123 3300000546 Bacteria 12121
3 Ga0065707_10152106 3300005295 Bacteria 1647
4 Ga0070676_10006900 3300005328 Bacteria 6079
5 Ga0070677_10112857 3300005333 Bacteria 1216
6 Ga0068869_100019413 3300005334 Bacteria 4644
7 Ga0068869_100071315 3300005334 Plasmid 2572
8 Ga0070666_10146028 3300005335 Unclassified 1648
9 Ga0070680_100020035 3300005336 Bacteria 5303
10 Ga0070682_100229225 3300005337 Bacteria 1327
11 Ga0068868_100004001 3300005338 Bacteria 10289
12 Ga0070660_100153623 3300005339 Bacteria 1852
13 Ga0070668_100022968 3300005347 Bacteria 4716
14 Ga0070668_100705326 3300005347 Bacteria 890
15 Ga0070675_100061455 3300005354 Unclassified 3102
16 Ga0070671_100006589 3300005355 Bacteria 9282
17 Ga0070671_100080060 3300005355 Bacteria 2731
18 Ga0070671_100503036 3300005355 Unclassified 1042
19 Ga0070688_100090605 3300005365 Unclassified 1997
20 Ga0070667_100186012 3300005367 Unclassified 1838
21 Ga0070709_10035927 3300005434 Bacteria 3014
22 Ga0070709_10083657 3300005434 Bacteria 2088
23 Ga0070709_10086638 3300005434 Bacteria 2056
24 Ga0070709_10188516 3300005434 Bacteria 1453
25 Ga0070709_10312433 3300005434 Bacteria 1151
26 Ga0070714_100060477 3300005435 Bacteria 3251
27 Ga0070714_101118100 3300005435 Unclassified 768
28 Ga0070713_100018483 3300005436 Bacteria 5297
29 Ga0070713_100055513 3300005436 Bacteria 3292
30 Ga0070713_100104726 3300005436 Bacteria 2456
31 Ga0070713_100159043 3300005436 Bacteria 2015
32 Ga0070713_100229761 3300005436 Bacteria 1686
33 Ga0070713_100390842 3300005436 Unclassified 1298
34 Ga0070710_10072910 3300005437 Bacteria 1984
35 Ga0070710_10624447 3300005437 Unclassified 752
36 Ga0070711_100000154 3300005439 Bacteria 36893
37 Ga0070711_100019879 3300005439 Bacteria 4318
38 Ga0070711_100428976 3300005439 Bacteria 1079
39 Ga0070711_100527996 3300005439 Bacteria 976
40 Ga0070694_100021577 3300005444 Bacteria 4117
41 Ga0070708_100012574 3300005445 Bacteria 6910
42 Ga0070708_100081789 3300005445 Bacteria 2925
43 Ga0070708_100259147 3300005445 Bacteria 1635
44 Ga0070708_100542596 3300005445 Unclassified 1097
45 Ga0070678_100083989 3300005456 Unclassified 2422
46 Ga0070678_101250252 3300005456 Bacteria 690
47 Ga0070662_100005630 3300005457 Bacteria 8010
48 Ga0068867_100020762 3300005459 Bacteria 4682
49 Ga0068867_100075447 3300005459 Bacteria 2529
50 Ga0070685_10757216 3300005466 Bacteria 713
51 Ga0070706_100017485 3300005467 Bacteria 6618
52 Ga0070706_100064855 3300005467 Bacteria 3377
53 Ga0070706_100166407 3300005467 Bacteria 2059
54 Ga0070706_100303418 3300005467 Bacteria 1489
55 Ga0070706_100454703 3300005467 Unclassified 1191
56 Ga0070706_100652596 3300005467 Unclassified 977
57 Ga0070707_100032550 3300005468 Plasmid 4969
58 Ga0070707_100072541 3300005468 Bacteria 3318
59 Ga0070707_100255677 3300005468 Bacteria 1704
60 Ga0070707_100624382 3300005468 Unclassified 1040
61 Ga0070698_100026599 3300005471 Bacteria 6022
62 Ga0070698_100148821 3300005471 Bacteria 2290
63 Ga0070698_100354169 3300005471 Unclassified 1400
64 Ga0070698_101080358 3300005471 Bacteria 751
65 Ga0070699_100126155 3300005518 Bacteria 2253
66 Ga0070699_100270412 3300005518 Bacteria 1521
67 Ga0070679_100097454 3300005530 Bacteria 2928
68 Ga0070697_100012855 3300005536 Bacteria 6559
69 Ga0070697_100017212 3300005536 Bacteria 5684
70 Ga0070697_100077541 3300005536 Bacteria 2734
71 Ga0070697_100131158 3300005536 Bacteria 2102
72 Ga0070697_100277384 3300005536 Bacteria 1438
73 Ga0070697_100565126 3300005536 Unclassified 998
74 Ga0070697_100602599 3300005536 Unclassified 965
75 Ga0068853_101312808 3300005539 Unclassified 699
76 Ga0070695_100069171 3300005545 Bacteria 2307
77 Ga0070695_100413281 3300005545 Bacteria 1026
78 Ga0070696_100092063 3300005546 Unclassified 2160
79 Ga0070696_100204386 3300005546 Unclassified 1476
80 Ga0070665_100011193 3300005548 Bacteria 9072
81 Ga0070665_100085214 3300005548 Bacteria 3165
82 Ga0070665_100175098 3300005548 Bacteria 2146
83 Ga0070665_100206778 3300005548 Bacteria 1964
84 Ga0070704_100070597 3300005549 Unclassified 2535
85 Ga0070704_101122841 3300005549 Unclassified 715
86 Ga0068855_100002133 3300005563 Bacteria 24480
87 Ga0068855_100010911 3300005563 Bacteria 10968
88 Ga0068855_100462514 3300005563 Bacteria 1383
89 Ga0068855_100498444 3300005563 Bacteria 1323
90 Ga0070664_100000167 3300005564 Bacteria 45686
91 Ga0068857_100000125 3300005577 Bacteria 46141
92 Ga0068857_100235208 3300005577 Bacteria 1676
93 Ga0068856_100636249 3300005614 Unclassified 1087
94 Ga0068856_100718769 3300005614 Unclassified 1019
95 Ga0068852_100000027 3300005616 Bacteria 113819
96 Ga0068859_100016446 3300005617 Bacteria 7430
97 Ga0068859_100087403 3300005617 Unclassified 3165
98 Ga0068859_100535538 3300005617 Bacteria 1266
99 Ga0068859_101092068 3300005617 Unclassified 877
100 Ga0068864_100000279 3300005618 Bacteria 45714
101 Ga0068864_100782243 3300005618 Bacteria 937
102 Ga0068866_10097169 3300005718 Bacteria 1617
103 Ga0068861_100015197 3300005719 Bacteria 5419
104 Ga0068861_100304986 3300005719 Bacteria 1381
105 Ga0068863_100009339 3300005841 Bacteria 9571
106 Ga0068863_100998685 3300005841 Unclassified 839
107 Ga0068858_100002856 3300005842 Bacteria 17365
108 Ga0068858_100036181 3300005842 Unclassified 4577
109 Ga0068858_100183241 3300005842 Bacteria 1978
110 Ga0068860_100019276 3300005843 Bacteria 6622
111 Ga0068860_100030467 3300005843 Bacteria 5189
112 Ga0068860_100073919 3300005843 Bacteria 3240
113 Ga0068862_100001789 3300005844 Bacteria 19444
114 Ga0068862_100128724 3300005844 Unclassified 2238
115 Ga0068862_100634241 3300005844 Unclassified 1029
116 Ga0081540_1009210 3300005983 Bacteria 6808
117 Ga0070717_10007438 3300006028 Bacteria 8136
118 Ga0070717_10014049 3300006028 Bacteria 6154
119 Ga0070717_10055955 3300006028 Plasmid 3257
120 Ga0070717_10056787 3300006028 Bacteria 3235
121 Ga0070717_10061644 3300006028 Plasmid 3109
122 Ga0070717_10098765 3300006028 Unclassified 2475
123 Ga0070717_10132085 3300006028 Unclassified 2148
124 Ga0070717_10242069 3300006028 Bacteria 1591
125 Ga0070717_10363592 3300006028 Unclassified 1296
126 Ga0070715_10068555 3300006163 Bacteria 1578
127 Ga0070715_10312606 3300006163 Bacteria 845
128 Ga0070716_100001017 3300006173 Bacteria 12283
129 Ga0070716_100044937 3300006173 Bacteria 2477
130 Ga0070716_100117900 3300006173 Bacteria 1656
131 Ga0070716_100144799 3300006173 Bacteria 1521
132 Ga0070716_100240855 3300006173 Bacteria 1226
133 Ga0070716_100435976 3300006173 Bacteria 951
134 Ga0070716_100845257 3300006173 Unclassified 712
135 Ga0070712_100000126 3300006175 Bacteria 40420
136 Ga0070712_100004804 3300006175 Bacteria 8352
137 Ga0070712_100111642 3300006175 Bacteria 2041
138 Ga0070712_100225533 3300006175 Unclassified 1485
139 Ga0070712_100312367 3300006175 Bacteria 1276
140 Ga0070712_100415692 3300006175 Bacteria 1114
141 Ga0070712_100466498 3300006175 Unclassified 1054
142 Ga0070712_100586795 3300006175 Unclassified 942
143 Ga0097621_100032326 3300006237 Plasmid 4158
144 Ga0097621_100059554 3300006237 Bacteria 3127
145 Ga0097621_100110399 3300006237 Bacteria 2323
146 Ga0097621_100142675 3300006237 Bacteria 2048
147 Ga0097621_100159642 3300006237 Bacteria 1937
148 Ga0075428_100532613 3300006844 Bacteria 1256
149 Ga0075431_100915870 3300006847 Bacteria 846
150 Ga0075433_10014177 3300006852 Bacteria 6505
151 Ga0075433_10202462 3300006852 Unclassified 1765
152 Ga0075434_100007371 3300006871 Bacteria 10183
153 Ga0075434_100035270 3300006871 Bacteria 4944
154 Ga0075434_100269120 3300006871 Bacteria 1723
155 Ga0075434_100560696 3300006871 Bacteria 1162
156 Ga0068865_100028264 3300006881 Plasmid 3712
157 Ga0068865_100030435 3300006881 Bacteria 3591
158 Ga0097620_100016446 3300006931 Bacteria 7430
159 Ga0097620_100087406 3300006931 Unclassified 3165
160 Ga0097620_100535512 3300006931 Bacteria 1266
161 Ga0097620_101092065 3300006931 Unclassified 877
162 Ga0075435_100049043 3300007076 Bacteria 3394
163 Ga0075435_100053864 3300007076 Bacteria 3246
164 Ga0075435_100205863 3300007076 Unclassified 1668
165 Ga0099795_10014577 3300007788 Bacteria 2441
166 Ga0099795_10028467 3300007788 Bacteria 1900
167 Ga0105250_10107985 3300009092 Bacteria 1138
168 Ga0105240_10000222 3300009093 Bacteria 113825
169 Ga0105240_10018239 3300009093 Bacteria 9432
170 Ga0105240_10046438 3300009093 Bacteria 5503
171 Ga0105240_10189424 3300009093 Bacteria 2420
172 Ga0105240_10510670 3300009093 Bacteria 1335
173 Ga0105240_11633050 3300009093 Unclassified 674
174 Ga0111539_10148331 3300009094 Bacteria 2746
175 Ga0105245_10000076 3300009098 Bacteria 102308
176 Ga0105245_10154877 3300009098 Bacteria 2170
177 Ga0105245_10217092 3300009098 Bacteria 1843
178 Ga0105245_10290994 3300009098 Unclassified 1600
179 Ga0105245_11247702 3300009098 Bacteria 792
180 Ga0114129_10560983 3300009147 Bacteria 1484
181 Ga0105241_10587725 3300009174 Unclassified 1004
182 Ga0105242_10078475 3300009176 Bacteria 2756
183 Ga0105242_10185597 3300009176 Unclassified 1838
184 Ga0105242_10212609 3300009176 Bacteria 1724
185 Ga0105242_10217003 3300009176 Bacteria 1707
186 Ga0105242_10235130 3300009176 Bacteria 1644
187 Ga0105242_10510519 3300009176 Bacteria 1145
188 Ga0105242_10541556 3300009176 Unclassified 1114
189 Ga0105248_10039849 3300009177 Bacteria 5265
190 Ga0105248_10061056 3300009177 Bacteria 4231
191 Ga0105248_10123196 3300009177 Unclassified 2925
192 Ga0105248_10153582 3300009177 Bacteria 2597
193 Ga0105248_10258598 3300009177 Bacteria 1960
194 Ga0105248_10627447 3300009177 Bacteria 1213
195 Ga0105248_11318015 3300009177 Unclassified 817
196 Ga0105237_10041192 3300009545 Plasmid 4659
197 Ga0105237_10193327 3300009545 Bacteria 2034
198 Ga0105237_10285674 3300009545 Bacteria 1652
199 Ga0105238_10091112 3300009551 Bacteria 3037
200 Ga0105238_10215746 3300009551 Bacteria 1895
201 Ga0105238_10248105 3300009551 Unclassified 1758
202 Ga0105249_11132039 3300009553 Bacteria 853
203 Ga0099796_10087878 3300010159 Bacteria 1151
204 Ga0105239_10004498 3300010375 Bacteria 16639
205 Ga0105239_10097506 3300010375 Plasmid 3249
206 Ga0105239_10315870 3300010375 Bacteria 1761
207 Ga0105239_10340206 3300010375 Bacteria 1693
208 Ga0105239_10485027 3300010375 Unclassified 1404
209 Ga0105246_10025793 3300011119 Bacteria 3832
210 Ga0105246_10374857 3300011119 Bacteria 1174
211 Ga0157373_10092039 3300013100 Bacteria 2136
212 Ga0157373_10162338 3300013100 Bacteria 1572
213 Ga0157373_10604211 3300013100 Bacteria 799
214 Ga0157371_10052648 3300013102 Bacteria 2891
215 Ga0157371_10095130 3300013102 Unclassified 2111
216 Ga0157370_10000012 3300013104 Bacteria 201181
217 Ga0157370_10005629 3300013104 Bacteria 14019
218 Ga0157369_10000112 3300013105 Bacteria 114309
219 Ga0157369_10004808 3300013105 Bacteria 15867
220 Ga0157369_10212459 3300013105 Bacteria 2027
221 Ga0157374_10027561 3300013296 Bacteria 5128
222 Ga0157374_10064478 3300013296 Bacteria 3437
223 Ga0157374_10100895 3300013296 Bacteria 2767
224 Ga0157374_10340932 3300013296 Unclassified 1488
225 Ga0157378_10018682 3300013297 Bacteria 6094
226 Ga0157378_10080264 3300013297 Plasmid 2947
227 Ga0157378_10128460 3300013297 Bacteria 2343
228 Ga0157378_10358055 3300013297 Unclassified 1427
229 Ga0157378_10406841 3300013297 Bacteria 1342
230 Ga0157378_10417203 3300013297 Unclassified 1326
231 Ga0157378_10499219 3300013297 Unclassified 1215
232 Ga0163162_10002235 3300013306 Bacteria 18186
233 Ga0163162_10017404 3300013306 Bacteria 7030
234 Ga0163162_10071131 3300013306 Unclassified 3531
235 Ga0163162_10092214 3300013306 Bacteria 3113
236 Ga0163162_10134291 3300013306 Bacteria 2585
237 Ga0163162_10150784 3300013306 Bacteria 2442
238 Ga0163162_10197476 3300013306 Bacteria 2141
239 Ga0163162_10740304 3300013306 Unclassified 1103
240 Ga0163162_11061231 3300013306 Unclassified 917
241 Ga0163162_11075285 3300013306 Unclassified 911
242 Ga0163162_11353757 3300013306 Unclassified 809
243 Ga0157372_10000111 3300013307 Bacteria 86033
244 Ga0157372_10162660 3300013307 Bacteria 2580
245 Ga0157372_10237311 3300013307 Unclassified 2115
246 Ga0157375_10003606 3300013308 Bacteria 13436
247 Ga0157375_10040322 3300013308 Bacteria 4500
248 Ga0157375_10045823 3300013308 Unclassified 4258
249 Ga0157375_10259920 3300013308 Bacteria 1898
250 Ga0157375_10673223 3300013308 Bacteria 1190
251 Ga0163163_10000331 3300014325 Bacteria 45717
252 Ga0163163_10058588 3300014325 Bacteria 3808
253 Ga0163163_10067332 3300014325 Unclassified 3560
254 Ga0163163_10237606 3300014325 Unclassified 1872
255 Ga0157377_10017555 3300014745 Bacteria 3702
256 Ga0157377_10140629 3300014745 Bacteria 1483
257 Ga0157379_10045057 3300014968 Bacteria 3938
258 Ga0157379_10050045 3300014968 Bacteria 3729
259 Ga0157379_10122411 3300014968 Unclassified 2341
260 Ga0157379_10362058 3300014968 Bacteria 1329
261 Ga0157379_10480809 3300014968 Bacteria 1149
262 Ga0157379_10757266 3300014968 Bacteria 914
263 Ga0157376_10227036 3300014969 Bacteria 1732
264 Ga0157376_10275071 3300014969 Bacteria 1583
265 Ga0157376_10484811 3300014969 Bacteria 1212
266 Ga0157376_10755468 3300014969 Unclassified 982
267 Ga0157376_10970326 3300014969 Unclassified 871
268 Ga0213872_10006514 3300021361 Bacteria 5845
269 Ga0213872_10033144 3300021361 Unclassified 2366
270 Ga0213876_10118551 3300021384 Bacteria 1405
271 Ga0224572_1001164 3300024225 Bacteria 3743
272 Ga0224572_1027217 3300024225 Bacteria 1096
273 Ga0207699_10116357 3300025906 Bacteria 1722
274 Ga0207684_10836972 3300025910 Unclassified 776
275 Ga0207695_10000028 3300025913 Bacteria 551835
276 Ga0207671_10182927 3300025914 Bacteria 1631
277 Ga0207693_10000102 3300025915 Bacteria 76687
278 Ga0207663_10002436 3300025916 Bacteria 8939
279 Ga0207663_10154143 3300025916 Bacteria 1615
280 Ga0207663_10254909 3300025916 Bacteria 1293
281 Ga0207652_10187823 3300025921 Bacteria 1858
282 Ga0207646_10507644 3300025922 Bacteria 1086
283 Ga0207694_10198393 3300025924 Bacteria 1632
284 Ga0207687_10000104 3300025927 Bacteria 61420
285 Ga0207700_10002423 3300025928 Bacteria 10714
286 Ga0207700_10022362 3300025928 Unclassified 4338
287 Ga0207700_10064793 3300025928 Bacteria 2785
288 Ga0207700_10593742 3300025928 Bacteria 985
289 Ga0207664_10068889 3300025929 Bacteria 2844
290 Ga0207664_10344664 3300025929 Unclassified 1318
291 Ga0207704_10306630 3300025938 Bacteria 1219
292 Ga0207665_10002541 3300025939 Bacteria 12272
293 Ga0207665_10021863 3300025939 Unclassified 4206
294 Ga0207665_10230429 3300025939 Bacteria 1361
295 Ga0207665_10487275 3300025939 Bacteria 951
296 Ga0207667_10004376 3300025949 Bacteria 17293
297 Ga0207640_10415945 3300025981 Bacteria 1099
298 Ga0207702_11091707 3300026078 Bacteria 792
299 Ga0207698_10000021 3300026142 Bacteria 133280
300 Ga0209179_1042686 3300027512 Bacteria 958
301 Ga0265338_10188875 3300028800 Bacteria 1563
302 Ga0265325_10012294 3300031241 Unclassified 4898
303 Ga0265316_10293655 3300031344 Unclassified 1185
304 Ga0265316_10373232 3300031344 Bacteria 1030
305 Ga0265313_10037953 3300031595 Unclassified 2404
306 Ga0373940_0029188 3300035088 Bacteria 1460
307 Ga0373935_0028474 3300035692 Unclassified 3454
308 Ga0373927_0035267 3300035695 Bacteria 3254
309 Ga0373947_0091373 3300035725 Unclassified 1899
310 Ga0436365_0002005 3300039437 Bacteria 5025
311 Ga0436365_0455316 3300039437 Bacteria 31213
312 Ga0436360_0707774 3300039438 Bacteria 3167
313 Ga0436361_0067167 3300039447 Bacteria 5080
314 Ga0436361_0409396 3300039447 Bacteria 31269
315 Ga0436363_0292722 3300039450 Unclassified 849
316 Ga0436363_1376049 3300039450 Unclassified 1962
317 Ga0436362_0013324 3300039453 Bacteria 1176
318 Ga0495651_0435386 3300046462 Unclassified 850
319 Ga0495653_0035493 3300046463 Bacteria 3935
320 Ga0495580_0092130 3300046472 Bacteria 2109
321 Ga0495630_0059786 3300046517 Bacteria 2860
322 Ga0495586_0177670 3300046535 Bacteria 1204
323 Ga0495646_0367112 3300046680 Unclassified 752
324 Ga0495600_0428859 3300046809 Unclassified 820
325 Ga0495686_0000178 3300047472 Bacteria 121468
326 Ga0496104_0000054 3300048907 Bacteria 132314
327 Ga0496126_0005395 3300048929 Bacteria 14598
328 nmdc:mga0rr50_482875_c1 3300050513 Unclassified 1052
329 Ga0500555_000212 3300053103 Bacteria 27048
330 Ga0500618_010353 3300053125 Bacteria 2505
331 Ga0500645_000577 3300053730 Bacteria 23731
332 Ga0265760_10012412
333 LJNas_1000123
334 Ga0065707_10152106
335 Ga0070676_10006900
336 Ga0070677_10112857
337 Ga0068869_100019413
338 Ga0068869_100071315
339 Ga0070666_10146028
340 Ga0070680_100020035
341 Ga0070682_100229225
342 Ga0068868_100004001
343 Ga0070660_100153623
344 Ga0070668_100022968
345 Ga0070668_100705326
346 Ga0070675_100061455
347 Ga0070671_100006589
348 Ga0070671_100080060
349 Ga0070671_100503036
350 Ga0070688_100090605
351 Ga0070667_100186012
352 Ga0070709_10035927
353 Ga0070709_10083657
354 Ga0070709_10086638
355 Ga0070709_10188516
356 Ga0070709_10312433
357 Ga0070714_100060477
358 Ga0070714_101118100
359 Ga0070713_100018483
360 Ga0070713_100055513
361 Ga0070713_100104726
362 Ga0070713_100159043
363 Ga0070713_100229761
364 Ga0070713_100390842
365 Ga0070710_10072910
366 Ga0070710_10624447
367 Ga0070711_100000154
368 Ga0070711_100019879
369 Ga0070711_100428976
370 Ga0070711_100527996
371 Ga0070694_100021577
372 Ga0070708_100012574
373 Ga0070708_100081789
374 Ga0070708_100259147
375 Ga0070708_100542596
376 Ga0070678_100083989
377 Ga0070678_101250252
378 Ga0070662_100005630
379 Ga0068867_100020762
380 Ga0068867_100075447
381 Ga0070685_10757216
382 Ga0070706_100017485
383 Ga0070706_100064855
384 Ga0070706_100166407
385 Ga0070706_100303418
386 Ga0070706_100454703
387 Ga0070706_100652596
388 Ga0070707_100032550
389 Ga0070707_100072541
390 Ga0070707_100255677
391 Ga0070707_100624382
392 Ga0070698_100026599
393 Ga0070698_100148821
394 Ga0070698_100354169
395 Ga0070698_101080358
396 Ga0070699_100126155
397 Ga0070699_100270412
398 Ga0070679_100097454
399 Ga0070697_100012855
400 Ga0070697_100017212
401 Ga0070697_100077541
402 Ga0070697_100131158
403 Ga0070697_100277384
404 Ga0070697_100565126
405 Ga0070697_100602599
406 Ga0068853_101312808
407 Ga0070695_100069171
408 Ga0070695_100413281
409 Ga0070696_100092063
410 Ga0070696_100204386
411 Ga0070665_100011193
412 Ga0070665_100085214
413 Ga0070665_100175098
414 Ga0070665_100206778
415 Ga0070704_100070597
416 Ga0070704_101122841
417 Ga0068855_100002133
418 Ga0068855_100010911
419 Ga0068855_100462514
420 Ga0068855_100498444
421 Ga0070664_100000167
422 Ga0068857_100000125
423 Ga0068857_100235208
424 Ga0068856_100636249
425 Ga0068856_100718769
426 Ga0068852_100000027
427 Ga0068859_100016446
428 Ga0068859_100087403
429 Ga0068859_100535538
430 Ga0068859_101092068
431 Ga0068864_100000279
432 Ga0068864_100782243
433 Ga0068866_10097169
434 Ga0068861_100015197
435 Ga0068861_100304986
436 Ga0068863_100009339
437 Ga0068863_100998685
438 Ga0068858_100002856
439 Ga0068858_100036181
440 Ga0068858_100183241
441 Ga0068860_100019276
442 Ga0068860_100030467
443 Ga0068860_100073919
444 Ga0068862_100001789
445 Ga0068862_100128724
446 Ga0068862_100634241
447 Ga0081540_1009210
448 Ga0070717_10007438
449 Ga0070717_10014049
450 Ga0070717_10055955
451 Ga0070717_10056787
452 Ga0070717_10061644
453 Ga0070717_10098765
454 Ga0070717_10132085
455 Ga0070717_10242069
456 Ga0070717_10363592
457 Ga0070715_10068555
458 Ga0070715_10312606
459 Ga0070716_100001017
460 Ga0070716_100044937
461 Ga0070716_100117900
462 Ga0070716_100144799
463 Ga0070716_100240855
464 Ga0070716_100435976
465 Ga0070716_100845257
466 Ga0070712_100000126
467 Ga0070712_100004804
468 Ga0070712_100111642
469 Ga0070712_100225533
470 Ga0070712_100312367
471 Ga0070712_100415692
472 Ga0070712_100466498
473 Ga0070712_100586795
474 Ga0097621_100032326
475 Ga0097621_100059554
476 Ga0097621_100110399
477 Ga0097621_100142675
478 Ga0097621_100159642
479 Ga0075428_100532613
480 Ga0075431_100915870
481 Ga0075433_10014177
482 Ga0075433_10202462
483 Ga0075434_100007371
484 Ga0075434_100035270
485 Ga0075434_100269120
486 Ga0075434_100560696
487 Ga0068865_100028264
488 Ga0068865_100030435
489 Ga0097620_100016446
490 Ga0097620_100087406
491 Ga0097620_100535512
492 Ga0097620_101092065
493 Ga0075435_100049043
494 Ga0075435_100053864
495 Ga0075435_100205863
496 Ga0099795_10014577
497 Ga0099795_10028467
498 Ga0105250_10107985
499 Ga0105240_10000222
500 Ga0105240_10018239
501 Ga0105240_10046438
502 Ga0105240_10189424
503 Ga0105240_10510670
504 Ga0105240_11633050
505 Ga0111539_10148331
506 Ga0105245_10000076
507 Ga0105245_10154877
508 Ga0105245_10217092
509 Ga0105245_10290994
510 Ga0105245_11247702
511 Ga0114129_10560983
512 Ga0105241_10587725
513 Ga0105242_10078475
514 Ga0105242_10185597
515 Ga0105242_10212609
516 Ga0105242_10217003
517 Ga0105242_10235130
518 Ga0105242_10510519
519 Ga0105242_10541556
520 Ga0105248_10039849
521 Ga0105248_10061056
522 Ga0105248_10123196
523 Ga0105248_10153582
524 Ga0105248_10258598
525 Ga0105248_10627447
526 Ga0105248_11318015
527 Ga0105237_10041192
528 Ga0105237_10193327
529 Ga0105237_10285674
530 Ga0105238_10091112
531 Ga0105238_10215746
532 Ga0105238_10248105
533 Ga0105249_11132039
534 Ga0099796_10087878
535 Ga0105239_10004498
536 Ga0105239_10097506
537 Ga0105239_10315870
538 Ga0105239_10340206
539 Ga0105239_10485027
540 Ga0105246_10025793
541 Ga0105246_10374857
542 Ga0157373_10092039
543 Ga0157373_10162338
544 Ga0157373_10604211
545 Ga0157371_10052648
546 Ga0157371_10095130
547 Ga0157370_10000012
548 Ga0157370_10005629
549 Ga0157369_10000112
550 Ga0157369_10004808
551 Ga0157369_10212459
552 Ga0157374_10027561
553 Ga0157374_10064478
554 Ga0157374_10100895
555 Ga0157374_10340932
556 Ga0157378_10018682
557 Ga0157378_10080264
558 Ga0157378_10128460
559 Ga0157378_10358055
560 Ga0157378_10406841
561 Ga0157378_10417203
562 Ga0157378_10499219
563 Ga0163162_10002235
564 Ga0163162_10017404
565 Ga0163162_10071131
566 Ga0163162_10092214
567 Ga0163162_10134291
568 Ga0163162_10150784
569 Ga0163162_10197476
570 Ga0163162_10740304
571 Ga0163162_11061231
572 Ga0163162_11075285
573 Ga0163162_11353757
574 Ga0157372_10000111
575 Ga0157372_10162660
576 Ga0157372_10237311
577 Ga0157375_10003606
578 Ga0157375_10040322
579 Ga0157375_10045823
580 Ga0157375_10259920
581 Ga0157375_10673223
582 Ga0163163_10000331
583 Ga0163163_10058588
584 Ga0163163_10067332
585 Ga0163163_10237606
586 Ga0157377_10017555
587 Ga0157377_10140629
588 Ga0157379_10045057
589 Ga0157379_10050045
590 Ga0157379_10122411
591 Ga0157379_10362058
592 Ga0157379_10480809
593 Ga0157379_10757266
594 Ga0157376_10227036
595 Ga0157376_10275071
596 Ga0157376_10484811
597 Ga0157376_10755468
598 Ga0157376_10970326
599 Ga0213872_10006514
600 Ga0213872_10033144
601 Ga0213876_10118551
602 Ga0224572_1001164
603 Ga0224572_1027217
604 Ga0207699_10116357
605 Ga0207684_10836972
606 Ga0207695_10000028
607 Ga0207671_10182927
608 Ga0207693_10000102
609 Ga0207663_10002436
610 Ga0207663_10154143
611 Ga0207663_10254909
612 Ga0207652_10187823
613 Ga0207646_10507644
614 Ga0207694_10198393
615 Ga0207687_10000104
616 Ga0207700_10002423
617 Ga0207700_10022362
618 Ga0207700_10064793
619 Ga0207700_10593742
620 Ga0207664_10068889
621 Ga0207664_10344664
622 Ga0207704_10306630
623 Ga0207665_10002541
624 Ga0207665_10021863
625 Ga0207665_10230429
626 Ga0207665_10487275
627 Ga0207667_10004376
628 Ga0207640_10415945
629 Ga0207702_11091707
630 Ga0207698_10000021
631 Ga0209179_1042686
632 Ga0265338_10188875
633 Ga0265325_10012294
634 Ga0265316_10293655
635 Ga0265316_10373232
636 Ga0265313_10037953
637 Ga0373940_0029188
638 Ga0373935_0028474
639 Ga0373927_0035267
640 Ga0373947_0091373
641 Ga0436365_0002005
642 Ga0436365_0455316
643 Ga0436360_0707774
644 Ga0436361_0067167
645 Ga0436361_0409396
646 Ga0436363_0292722
647 Ga0436363_1376049
648 Ga0436362_0013324
649 Ga0495651_0435386
650 Ga0495653_0035493
651 Ga0495580_0092130
652 Ga0495630_0059786
653 Ga0495586_0177670
654 Ga0495646_0367112
655 Ga0495600_0428859
656 Ga0495686_0000178
657 Ga0496104_0000054
658 Ga0496126_0005395
659 nmdc:mga0rr50_482875_c1
660 Ga0500555_000212
661 Ga0500618_010353
662 Ga0500645_000577

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

58

103

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q24-assembly1.cif.gz_B crystal structure of tetr transcriptional regulator sco0520 from streptomyces coelicolor 0.8601 21 194
2q24-assembly1.cif.gz_B crystal structure of tetr transcriptional regulator sco0520 from streptomyces coelicolor 0.8512 21 194
2qwt-assembly1.cif.gz_A crystal structure of the tetr transcription regulatory protein from mycobacterium vanbaalenii 0.8462 13 192
2qwt-assembly1.cif.gz_A crystal structure of the tetr transcription regulatory protein from mycobacterium vanbaalenii 0.8371 13 192
3f0c-assembly1.cif.gz_A-2 crystal structure of transcriptional regulator from cytophaga hutchinsonii atcc 33406 0.7973 22 192
ID Description Score Start End Superfamily
1jumE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.961 20 65 1.10.10.60
1t33B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9603 15 68 1.10.10.60
1jupE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9553 20 65 1.10.10.60
3cdlA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9167 21 66 1.10.10.60
1t33B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9121 15 68 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A0M0EDX3-F1-model_v4 ParB/Sulfiredoxin domain-containing protein 0.9589 59 194
AF-A0A177G546-F1-model_v4 Transcriptional regulator, TetR family 0.9545 74 194
AF-A0A225DPY0-F1-model_v4 Transcriptional regulator, TetR family 0.9505 67 194
AF-A0A3P0X9A6-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9479 7 193 GO:0000976
GO:0003700
AF-A0A7V8F7I6-F1-model_v4 HTH tetR-type domain-containing protein 0.9426 11 192 GO:0000976
GO:0003700

Map