F410412

General Info

Members Datasets Scaffolds Average Seq Length
331 225 662 387

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100023538|Ga0070708_1000235386
Length 410
Sequence VETKLADFIKDSADGRDADSILRACVHCGFCTATCPTYQLLGDELDGPRGRIYLIKQLLEGADVSSKTQLHLDRCLTCRSCETVCPSGVRYGRLVDIGRRVLEKKVRRPAGERVRRWLLRKGLSHRSLFAFALGAGRLAGPLLPASLSAKVPPARAVKSWPAPRHARKMLALAGCVQPALAPNIDAALARALDRVEISLLCAPGGGCCGAISEHLGAHEEAATFARRNIDAWWPHIEQGAEAIVVTASGCGVTVKDYGHLLRDDPQYADKARRVGELARDPVEVIANEWKRFAPLVAMDHGPQRVAFQSPCTLQHGQQLNGRVEEILEAIGLELAPVADGHLCCGSAGTYSILQPVLSQQLRINKLEALEASQPDLIATANIGCLSHLASGTQRPVRHWVEIFDARLRTR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
109 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
111 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
129 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
130 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
179 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
180 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
224 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
225 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0.91
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 3.93
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100023538 3300005445 Bacteria 5240
2 Ga0065165_1001411 3300005262 Bacteria 26128
3 Ga0070690_100002482 3300005330 Bacteria 9917
4 Ga0070680_100046974 3300005336 Bacteria 3514
5 Ga0070680_100138830 3300005336 Bacteria 2037
6 Ga0070660_100131862 3300005339 Bacteria 2000
7 Ga0070689_100009635 3300005340 Bacteria 6856
8 Ga0070691_10027274 3300005341 Bacteria 2665
9 Ga0070687_100160320 3300005343 Bacteria 1329
10 Ga0070692_10010501 3300005345 Bacteria 4217
11 Ga0070671_100069231 3300005355 Bacteria 2943
12 Ga0070673_100000554 3300005364 Bacteria 20127
13 Ga0070688_100002590 3300005365 Bacteria 9162
14 Ga0070659_100059008 3300005366 Bacteria 3029
15 Ga0070714_100141307 3300005435 Bacteria 2162
16 Ga0070713_100000033 3300005436 Bacteria 86758
17 Ga0070713_100010376 3300005436 Bacteria 6730
18 Ga0070713_100136928 3300005436 Bacteria 2165
19 Ga0070711_100003952 3300005439 Bacteria 8712
20 Ga0070711_100012292 3300005439 Bacteria 5341
21 Ga0070694_100024106 3300005444 Bacteria 3925
22 Ga0070694_100132029 3300005444 Bacteria 1805
23 Ga0070708_100010873 3300005445 Bacteria 7393
24 Ga0070708_100179305 3300005445 Bacteria 1979
25 Ga0070678_100000529 3300005456 Bacteria 18554
26 Ga0070662_100054586 3300005457 Bacteria 2896
27 Ga0070681_10004378 3300005458 Bacteria 13439
28 Ga0068867_100075100 3300005459 Bacteria 2535
29 Ga0070685_10004212 3300005466 Bacteria 7259
30 Ga0070706_100007796 3300005467 Bacteria 10002
31 Ga0070707_100014299 3300005468 Bacteria 7441
32 Ga0070707_100066627 3300005468 Bacteria 3461
33 Ga0070707_100320187 3300005468 Bacteria 1507
34 Ga0070679_100178954 3300005530 Bacteria 2093
35 Ga0070684_100028467 3300005535 Bacteria 4727
36 Ga0070697_100056443 3300005536 Bacteria 3195
37 Ga0068853_100073704 3300005539 Bacteria 2977
38 Ga0070686_100044306 3300005544 Bacteria 2796
39 Ga0070695_100020748 3300005545 Bacteria 4014
40 Ga0070695_100021283 3300005545 Bacteria 3966
41 Ga0070695_100055718 3300005545 Bacteria 2549
42 Ga0070696_100047051 3300005546 Bacteria 2992
43 Ga0070693_100001775 3300005547 Bacteria 9830
44 Ga0070665_100001423 3300005548 Bacteria 28047
45 Ga0070704_100005189 3300005549 Bacteria 7575
46 Ga0070704_100014436 3300005549 Bacteria 4934
47 Ga0070704_100067128 3300005549 Bacteria 2589
48 Ga0070704_100095245 3300005549 Bacteria 2229
49 Ga0068854_100013464 3300005578 Bacteria 5370
50 Ga0068859_100030571 3300005617 Bacteria 5405
51 Ga0068859_100110169 3300005617 Bacteria 2815
52 Ga0068859_100224355 3300005617 Bacteria 1967
53 Ga0068851_10070876 3300005834 Bacteria 1803
54 Ga0068858_100002960 3300005842 Bacteria 17060
55 Ga0068858_100005418 3300005842 Bacteria 12499
56 Ga0081539_10013939 3300005985 Bacteria 6000
57 Ga0070715_10004140 3300006163 Bacteria 4719
58 Ga0070716_100009690 3300006173 Bacteria 4807
59 Ga0075428_100265643 3300006844 Bacteria 1847
60 Ga0075430_100006457 3300006846 Bacteria 9879
61 Ga0075430_100007784 3300006846 Bacteria 9050
62 Ga0075430_100187251 3300006846 Bacteria 1721
63 Ga0075431_100003154 3300006847 Bacteria 15937
64 Ga0075431_100024770 3300006847 Bacteria 6152
65 Ga0075431_100075471 3300006847 Bacteria 3479
66 Ga0075433_10026954 3300006852 Bacteria 4870
67 Ga0075429_100001574 3300006880 Bacteria 18753
68 Ga0075436_100013222 3300006914 Bacteria 5657
69 Ga0097620_100030568 3300006931 Bacteria 5405
70 Ga0097620_100110175 3300006931 Bacteria 2815
71 Ga0097620_100224350 3300006931 Bacteria 1967
72 Ga0075435_100010201 3300007076 Bacteria 6863
73 Ga0075435_100158718 3300007076 Bacteria 1904
74 Ga0111539_10166113 3300009094 Bacteria 2580
75 Ga0105245_10006465 3300009098 Bacteria 10309
76 Ga0105245_10028814 3300009098 Bacteria 4901
77 Ga0114129_10003249 3300009147 Bacteria 22815
78 Ga0105243_10008541 3300009148 Bacteria 7860
79 Ga0105241_10006652 3300009174 Bacteria 8515
80 Ga0105241_10127263 3300009174 Bacteria 2058
81 Ga0105242_10002265 3300009176 Bacteria 15195
82 Ga0105242_10048084 3300009176 Bacteria 3465
83 Ga0105237_10100710 3300009545 Bacteria 2881
84 Ga0105239_10362964 3300010375 Bacteria 1636
85 Ga0157370_10031496 3300013104 Bacteria 5185
86 Ga0157369_10059310 3300013105 Bacteria 4126
87 Ga0157374_10007484 3300013296 Bacteria 9312
88 Ga0163162_10154790 3300013306 Bacteria 2412
89 Ga0157372_10313157 3300013307 Bacteria 1827
90 Ga0163163_10012487 3300014325 Bacteria 7741
91 Ga0163163_10087414 3300014325 Bacteria 3128
92 Ga0157379_10232647 3300014968 Bacteria 1671
93 Ga0163161_10111329 3300017792 Bacteria 2047
94 Ga0207656_10024839 3300025321 Bacteria 2428
95 Ga0207653_10018768 3300025885 Bacteria 2177
96 Ga0207692_10007560 3300025898 Bacteria 4456
97 Ga0207642_10003141 3300025899 Bacteria 5179
98 Ga0207685_10026300 3300025905 Bacteria 2022
99 Ga0207684_10208663 3300025910 Bacteria 1685
100 Ga0207693_10000459 3300025915 Bacteria 37224
101 Ga0207693_10002535 3300025915 Bacteria 15879
102 Ga0207693_10090818 3300025915 Bacteria 2394
103 Ga0207663_10009213 3300025916 Bacteria 5207
104 Ga0207663_10032256 3300025916 Bacteria 3108
105 Ga0207660_10011320 3300025917 Bacteria 5803
106 Ga0207657_10017839 3300025919 Bacteria 6793
107 Ga0207652_10025062 3300025921 Bacteria 4956
108 Ga0207646_10007101 3300025922 Bacteria 11455
109 Ga0207650_10006408 3300025925 Bacteria 8017
110 Ga0207687_10000309 3300025927 Bacteria 33181
111 Ga0207687_10047904 3300025927 Bacteria 2964
112 Ga0207700_10000099 3300025928 Bacteria 53179
113 Ga0207700_10012549 3300025928 Bacteria 5471
114 Ga0207700_10028269 3300025928 Bacteria 3940
115 Ga0207664_10000714 3300025929 Bacteria 22576
116 Ga0207644_10150644 3300025931 Bacteria 1799
117 Ga0207686_10003076 3300025934 Bacteria 8981
118 Ga0207686_10004418 3300025934 Bacteria 7542
119 Ga0207686_10011383 3300025934 Bacteria 4871
120 Ga0207709_10010407 3300025935 Bacteria 5121
121 Ga0207665_10004333 3300025939 Bacteria 9423
122 Ga0207665_10032243 3300025939 Bacteria 3469
123 Ga0207711_10000626 3300025941 Bacteria 35493
124 Ga0207689_10016572 3300025942 Bacteria 6234
125 Ga0207679_10200796 3300025945 Bacteria 1665
126 Ga0207651_10009453 3300025960 Bacteria 5341
127 Ga0207640_10105297 3300025981 Bacteria 1987
128 Ga0207658_10022977 3300025986 Bacteria 4347
129 Ga0207703_10001401 3300026035 Bacteria 21959
130 Ga0207703_10159680 3300026035 Bacteria 1973
131 Ga0207678_10068323 3300026067 Bacteria 3049
132 Ga0207708_10054020 3300026075 Bacteria 3061
133 Ga0207708_10114550 3300026075 Bacteria 2096
134 Ga0207676_10000174 3300026095 Bacteria 56439
135 Ga0207674_10002729 3300026116 Bacteria 22016
136 Ga0210000_1002225 3300027462 Bacteria 2750
137 Ga0268266_10026138 3300028379 Bacteria 4968
138 Ga0307509_10000072 3300031507 Bacteria 140566
139 Ga0307408_100125247 3300031548 Bacteria 1997
140 Ga0316579_10006502 3300031691 Bacteria 4770
141 Ga0316576_10001183 3300031727 Bacteria 13724
142 Ga0316578_10014657 3300031728 Bacteria 4194
143 Ga0316578_10040567 3300031728 Bacteria 2692
144 Ga0307516_10000048 3300031730 Bacteria 130378
145 Ga0316577_10010477 3300031733 Bacteria 5007
146 Ga0316577_10032095 3300031733 Bacteria 2934
147 Ga0307409_100272691 3300031995 Bacteria 1559
148 Ga0307416_100101553 3300032002 Bacteria 2505
149 Ga0316585_10000506 3300032137 Bacteria 9294
150 Ga0316596_1000145 3300033541 Bacteria 9744
151 Ga0316596_1001051 3300033541 Bacteria 5350
152 Ga0316596_1011650 3300033541 Bacteria 2153
153 Ga0373926_0063841 3300035083 Bacteria 1345
154 Ga0373929_0007868 3300035085 Bacteria 1956
155 Ga0373923_0001391 3300035111 Bacteria 6894
156 Ga0373954_0002083 3300035118 Bacteria 8302
157 Ga0373956_0002839 3300035119 Bacteria 7010
158 Ga0373957_0002929 3300035120 Bacteria 4946
159 Ga0316574_0006939 3300035398 Bacteria 6167
160 Ga0373927_0045547 3300035695 Bacteria 2837
161 Ga0373933_0095174 3300035724 Bacteria 1842
162 Ga0373947_0015016 3300035725 Bacteria 4445
163 Ga0373947_0109021 3300035725 Bacteria 1747
164 Ga0373937_0025662 3300036401 Bacteria 5322
165 Ga0316582_0001127 3300036647 Bacteria 11355
166 Ga0316584_0053003 3300036712 Bacteria 3034
167 Ga0316584_0062583 3300036712 Bacteria 2786
168 Ga0316584_0105792 3300036712 Bacteria 2105
169 Ga0316584_0150417 3300036712 Bacteria 1733
170 Ga0316584_0176364 3300036712 Bacteria 1583
171 Ga0395899_0076968 3300037312 Bacteria 2434
172 Ga0316581_0002548 3300037588 Bacteria 4383
173 Ga0395901_0207214 3300038443 Bacteria 2053
174 Ga0395901_0208463 3300038443 Bacteria 2046
175 Ga0451577_0000423 3300042876 Bacteria 76127
176 Ga0451577_0033563 3300042876 Bacteria 4627
177 Ga0453684_0001178 3300044712 Bacteria 81121
178 Ga0453684_0098640 3300044712 Bacteria 3581
179 Ga0495617_000104 3300046452 Bacteria 61298
180 Ga0495627_000543 3300046453 Bacteria 31140
181 Ga0495591_000127 3300046458 Bacteria 83271
182 Ga0495650_0008840 3300046471 Bacteria 5817
183 Ga0495605_0000039 3300046474 Bacteria 196802
184 Ga0495605_0000445 3300046474 Bacteria 37241
185 Ga0495605_0009627 3300046474 Bacteria 5427
186 Ga0495639_0016771 3300046475 Bacteria 3180
187 Ga0495662_0003666 3300046476 Bacteria 7745
188 Ga0495584_0000606 3300046491 Bacteria 24016
189 Ga0495585_0017045 3300046492 Bacteria 4203
190 Ga0495596_0013181 3300046500 Bacteria 3515
191 Ga0495607_0005143 3300046501 Bacteria 9449
192 Ga0495607_0009384 3300046501 Bacteria 6625
193 Ga0495607_0009619 3300046501 Bacteria 6532
194 Ga0495583_0003792 3300046506 Bacteria 11229
195 Ga0495606_0099055 3300046507 Bacteria 1777
196 Ga0495610_0000452 3300046512 Bacteria 42500
197 Ga0495616_0001515 3300046513 Bacteria 16011
198 Ga0495616_0005843 3300046513 Bacteria 7512
199 Ga0495616_0084719 3300046513 Bacteria 1510
200 Ga0495628_0001069 3300046516 Bacteria 25113
201 Ga0495628_0048347 3300046516 Bacteria 3372
202 Ga0495631_0002553 3300046518 Bacteria 10204
203 Ga0495632_0000430 3300046519 Bacteria 39988
204 Ga0495632_0008224 3300046519 Bacteria 6435
205 Ga0495637_0000029 3300046520 Bacteria 143929
206 Ga0495643_0001353 3300046522 Bacteria 22990
207 Ga0495643_0029351 3300046522 Bacteria 3077
208 Ga0495643_0068814 3300046522 Bacteria 1862
209 Ga0495644_0010998 3300046523 Bacteria 3487
210 Ga0495648_0000795 3300046524 Bacteria 33423
211 Ga0495648_0020083 3300046524 Bacteria 4673
212 Ga0495648_0043252 3300046524 Bacteria 2826
213 Ga0495642_0007952 3300046528 Bacteria 4058
214 Ga0495652_0004248 3300046529 Bacteria 13763
215 Ga0495654_0014660 3300046530 Bacteria 4168
216 Ga0495640_0017185 3300046533 Bacteria 5397
217 Ga0495586_0008225 3300046535 Bacteria 5559
218 Ga0495586_0027062 3300046535 Bacteria 3069
219 Ga0495609_0119801 3300046538 Bacteria 1132
220 Ga0495621_0001536 3300046539 Bacteria 6007
221 Ga0495597_0000731 3300046542 Bacteria 26231
222 Ga0495597_0001876 3300046542 Bacteria 14363
223 Ga0495645_0000056 3300046543 Bacteria 81955
224 Ga0495668_0000536 3300046616 Bacteria 47214
225 Ga0495668_0001803 3300046616 Bacteria 19533
226 Ga0495611_0000913 3300046648 Bacteria 15999
227 Ga0495625_0021919 3300046660 Bacteria 4907
228 Ga0495625_0141418 3300046660 Bacteria 1623
229 Ga0495635_0235694 3300046663 Bacteria 1235
230 Ga0495659_0006154 3300046664 Bacteria 3794
231 Ga0495661_0000855 3300046665 Bacteria 28339
232 Ga0495661_0002286 3300046665 Bacteria 14807
233 Ga0495661_0016191 3300046665 Bacteria 4950
234 Ga0495661_0080959 3300046665 Bacteria 1872
235 Ga0495599_0001586 3300046678 Bacteria 13109
236 Ga0495669_0000722 3300046684 Bacteria 14346
237 Ga0495669_0005187 3300046684 Bacteria 5420
238 Ga0495669_0020169 3300046684 Bacteria 2882
239 Ga0495670_0003757 3300046691 Bacteria 7465
240 Ga0495670_0018550 3300046691 Bacteria 3425
241 Ga0495671_0000931 3300046692 Bacteria 20676
242 Ga0495649_0000243 3300046694 Bacteria 48016
243 Ga0495589_0000133 3300046794 Bacteria 68226
244 Ga0495589_0000457 3300046794 Bacteria 29897
245 Ga0495589_0001411 3300046794 Bacteria 13927
246 Ga0495589_0012701 3300046794 Bacteria 4354
247 Ga0495660_0000224 3300046810 Bacteria 56313
248 Ga0495674_0219308 3300047319 Bacteria 1573
249 Ga0495672_0000175 3300047320 Bacteria 93127
250 Ga0495672_0000970 3300047320 Bacteria 29803
251 Ga0495680_0087569 3300047322 Bacteria 2342
252 Ga0495683_0000379 3300047323 Bacteria 36310
253 Ga0495687_000146 3300047443 Bacteria 107228
254 Ga0495687_000693 3300047443 Bacteria 38036
255 Ga0495677_0000131 3300047445 Bacteria 36370
256 Ga0495677_0001505 3300047445 Bacteria 9372
257 Ga0495677_0002765 3300047445 Bacteria 6843
258 Ga0495679_016629 3300047446 Bacteria 2656
259 Ga0495679_018180 3300047446 Bacteria 2500
260 Ga0495685_019169 3300047447 Bacteria 2350
261 Ga0495681_0001208 3300047470 Bacteria 19632
262 Ga0495681_0007746 3300047470 Bacteria 6809
263 Ga0495686_0002429 3300047472 Bacteria 17615
264 Ga0495602_0041426 3300048088 Bacteria 4207
265 Ga0495626_0000058 3300048091 Bacteria 147007
266 Ga0495626_0003451 3300048091 Bacteria 10131
267 Ga0495626_0010714 3300048091 Bacteria 4875
268 Ga0495626_0049406 3300048091 Bacteria 1947
269 Ga0496102_0000582 3300048905 Bacteria 38683
270 Ga0496102_0126215 3300048905 Bacteria 2392
271 Ga0496104_0002267 3300048907 Bacteria 16584
272 Ga0496104_0023063 3300048907 Bacteria 5719
273 Ga0496105_0001702 3300048908 Bacteria 15692
274 Ga0496105_0166507 3300048908 Bacteria 1808
275 Ga0496106_0035168 3300048909 Bacteria 3746
276 Ga0496106_0112244 3300048909 Bacteria 2124
277 Ga0496107_0075128 3300048910 Bacteria 2460
278 Ga0496107_0167371 3300048910 Bacteria 1630
279 Ga0496110_0000454 3300048913 Bacteria 27858
280 Ga0496114_0002592 3300048917 Bacteria 13803
281 Ga0496115_0009594 3300048918 Bacteria 7195
282 Ga0496124_0068425 3300048927 Bacteria 2951
283 Ga0496124_0106248 3300048927 Bacteria 2266
284 Ga0495682_0003738 3300049460 Bacteria 6697
285 Ga0501036_0056705 3300049572 Bacteria 3319
286 Ga0501038_0190807 3300049574 Bacteria 1649
287 Ga0501040_0005014 3300049576 Bacteria 8560
288 Ga0501041_0041507 3300049577 Bacteria 2795
289 Ga0501042_0020636 3300049578 Bacteria 4587
290 Ga0501042_0135309 3300049578 Bacteria 1777
291 Ga0501048_0148147 3300049582 Bacteria 1660
292 Ga0501069_0013806 3300049585 Bacteria 4310
293 Ga0501070_0000550 3300049586 Bacteria 34331
294 Ga0501071_0062514 3300049587 Bacteria 2698
295 Ga0501072_0003923 3300049588 Bacteria 11255
296 Ga0501072_0136069 3300049588 Bacteria 1959
297 Ga0501073_0052427 3300049589 Bacteria 2856
298 Ga0501074_0002724 3300049590 Bacteria 12360
299 Ga0501074_0248593 3300049590 Bacteria 1265
300 Ga0501075_0003869 3300049591 Bacteria 10085
301 Ga0501075_0021452 3300049591 Bacteria 4709
302 Ga0501076_0000214 3300049592 Bacteria 35092
303 Ga0501076_0008589 3300049592 Bacteria 7492
304 Ga0501079_0004806 3300049741 Bacteria 10012
305 Ga0501080_0001497 3300049742 Bacteria 19712
306 Ga0501080_0012925 3300049742 Bacteria 7663
307 Ga0501080_0042004 3300049742 Bacteria 4259
308 Ga0501081_0001801 3300049743 Bacteria 13288
309 Ga0501081_0025195 3300049743 Bacteria 4000
310 Ga0501083_0009066 3300049744 Bacteria 7025
311 Ga0501083_0073088 3300049744 Bacteria 2279
312 Ga0501045_0010406 3300049824 Bacteria 6515
313 Ga0501045_0017493 3300049824 Bacteria 5091
314 nmdc:mga05p37_73571_c1 3300050507 Bacteria 4206
315 nmdc:mga09592_39_c1 3300050508 Bacteria 71520
316 nmdc:mga0qj67_191521_c1 3300050509 Bacteria 1662
317 nmdc:mga0qj67_6716_c1 3300050509 Bacteria 8449
318 nmdc:mga06r32_10590_c1 3300050510 Bacteria 8315
319 nmdc:mga06r32_13589_c1 3300050510 Bacteria 7380
320 nmdc:mga06r32_58356_c1 3300050510 Bacteria 3709
321 nmdc:mga0a205_25705_c1 3300050515 Bacteria 5611
322 nmdc:mga0a205_46115_c1 3300050515 Bacteria 4203
323 Ga0495601_0159424 3300053077 Bacteria 1474
324 Ga0495612_0019543 3300053078 Bacteria 2712
325 Ga0501084_0029707 3300054114 Bacteria 4573
326 Ga0501084_0062094 3300054114 Bacteria 3128
327 Ga0501082_0215768 3300060353 Bacteria 1669
328 Ga0530510_0009639 3300061734 Bacteria 6775
329 2574431100 2574179768 Bacteria 4907129
330 2891636250 2891633521 Bacteria 4602265
331 639786123 639633007 Bacteria 4376040
332 Ga0070708_100023538
333 Ga0065165_1001411
334 Ga0070690_100002482
335 Ga0070680_100046974
336 Ga0070680_100138830
337 Ga0070660_100131862
338 Ga0070689_100009635
339 Ga0070691_10027274
340 Ga0070687_100160320
341 Ga0070692_10010501
342 Ga0070671_100069231
343 Ga0070673_100000554
344 Ga0070688_100002590
345 Ga0070659_100059008
346 Ga0070714_100141307
347 Ga0070713_100000033
348 Ga0070713_100010376
349 Ga0070713_100136928
350 Ga0070711_100003952
351 Ga0070711_100012292
352 Ga0070694_100024106
353 Ga0070694_100132029
354 Ga0070708_100010873
355 Ga0070708_100179305
356 Ga0070678_100000529
357 Ga0070662_100054586
358 Ga0070681_10004378
359 Ga0068867_100075100
360 Ga0070685_10004212
361 Ga0070706_100007796
362 Ga0070707_100014299
363 Ga0070707_100066627
364 Ga0070707_100320187
365 Ga0070679_100178954
366 Ga0070684_100028467
367 Ga0070697_100056443
368 Ga0068853_100073704
369 Ga0070686_100044306
370 Ga0070695_100020748
371 Ga0070695_100021283
372 Ga0070695_100055718
373 Ga0070696_100047051
374 Ga0070693_100001775
375 Ga0070665_100001423
376 Ga0070704_100005189
377 Ga0070704_100014436
378 Ga0070704_100067128
379 Ga0070704_100095245
380 Ga0068854_100013464
381 Ga0068859_100030571
382 Ga0068859_100110169
383 Ga0068859_100224355
384 Ga0068851_10070876
385 Ga0068858_100002960
386 Ga0068858_100005418
387 Ga0081539_10013939
388 Ga0070715_10004140
389 Ga0070716_100009690
390 Ga0075428_100265643
391 Ga0075430_100006457
392 Ga0075430_100007784
393 Ga0075430_100187251
394 Ga0075431_100003154
395 Ga0075431_100024770
396 Ga0075431_100075471
397 Ga0075433_10026954
398 Ga0075429_100001574
399 Ga0075436_100013222
400 Ga0097620_100030568
401 Ga0097620_100110175
402 Ga0097620_100224350
403 Ga0075435_100010201
404 Ga0075435_100158718
405 Ga0111539_10166113
406 Ga0105245_10006465
407 Ga0105245_10028814
408 Ga0114129_10003249
409 Ga0105243_10008541
410 Ga0105241_10006652
411 Ga0105241_10127263
412 Ga0105242_10002265
413 Ga0105242_10048084
414 Ga0105237_10100710
415 Ga0105239_10362964
416 Ga0157370_10031496
417 Ga0157369_10059310
418 Ga0157374_10007484
419 Ga0163162_10154790
420 Ga0157372_10313157
421 Ga0163163_10012487
422 Ga0163163_10087414
423 Ga0157379_10232647
424 Ga0163161_10111329
425 Ga0207656_10024839
426 Ga0207653_10018768
427 Ga0207692_10007560
428 Ga0207642_10003141
429 Ga0207685_10026300
430 Ga0207684_10208663
431 Ga0207693_10000459
432 Ga0207693_10002535
433 Ga0207693_10090818
434 Ga0207663_10009213
435 Ga0207663_10032256
436 Ga0207660_10011320
437 Ga0207657_10017839
438 Ga0207652_10025062
439 Ga0207646_10007101
440 Ga0207650_10006408
441 Ga0207687_10000309
442 Ga0207687_10047904
443 Ga0207700_10000099
444 Ga0207700_10012549
445 Ga0207700_10028269
446 Ga0207664_10000714
447 Ga0207644_10150644
448 Ga0207686_10003076
449 Ga0207686_10004418
450 Ga0207686_10011383
451 Ga0207709_10010407
452 Ga0207665_10004333
453 Ga0207665_10032243
454 Ga0207711_10000626
455 Ga0207689_10016572
456 Ga0207679_10200796
457 Ga0207651_10009453
458 Ga0207640_10105297
459 Ga0207658_10022977
460 Ga0207703_10001401
461 Ga0207703_10159680
462 Ga0207678_10068323
463 Ga0207708_10054020
464 Ga0207708_10114550
465 Ga0207676_10000174
466 Ga0207674_10002729
467 Ga0210000_1002225
468 Ga0268266_10026138
469 Ga0307509_10000072
470 Ga0307408_100125247
471 Ga0316579_10006502
472 Ga0316576_10001183
473 Ga0316578_10014657
474 Ga0316578_10040567
475 Ga0307516_10000048
476 Ga0316577_10010477
477 Ga0316577_10032095
478 Ga0307409_100272691
479 Ga0307416_100101553
480 Ga0316585_10000506
481 Ga0316596_1000145
482 Ga0316596_1001051
483 Ga0316596_1011650
484 Ga0373926_0063841
485 Ga0373929_0007868
486 Ga0373923_0001391
487 Ga0373954_0002083
488 Ga0373956_0002839
489 Ga0373957_0002929
490 Ga0316574_0006939
491 Ga0373927_0045547
492 Ga0373933_0095174
493 Ga0373947_0015016
494 Ga0373947_0109021
495 Ga0373937_0025662
496 Ga0316582_0001127
497 Ga0316584_0053003
498 Ga0316584_0062583
499 Ga0316584_0105792
500 Ga0316584_0150417
501 Ga0316584_0176364
502 Ga0395899_0076968
503 Ga0316581_0002548
504 Ga0395901_0207214
505 Ga0395901_0208463
506 Ga0451577_0000423
507 Ga0451577_0033563
508 Ga0453684_0001178
509 Ga0453684_0098640
510 Ga0495617_000104
511 Ga0495627_000543
512 Ga0495591_000127
513 Ga0495650_0008840
514 Ga0495605_0000039
515 Ga0495605_0000445
516 Ga0495605_0009627
517 Ga0495639_0016771
518 Ga0495662_0003666
519 Ga0495584_0000606
520 Ga0495585_0017045
521 Ga0495596_0013181
522 Ga0495607_0005143
523 Ga0495607_0009384
524 Ga0495607_0009619
525 Ga0495583_0003792
526 Ga0495606_0099055
527 Ga0495610_0000452
528 Ga0495616_0001515
529 Ga0495616_0005843
530 Ga0495616_0084719
531 Ga0495628_0001069
532 Ga0495628_0048347
533 Ga0495631_0002553
534 Ga0495632_0000430
535 Ga0495632_0008224
536 Ga0495637_0000029
537 Ga0495643_0001353
538 Ga0495643_0029351
539 Ga0495643_0068814
540 Ga0495644_0010998
541 Ga0495648_0000795
542 Ga0495648_0020083
543 Ga0495648_0043252
544 Ga0495642_0007952
545 Ga0495652_0004248
546 Ga0495654_0014660
547 Ga0495640_0017185
548 Ga0495586_0008225
549 Ga0495586_0027062
550 Ga0495609_0119801
551 Ga0495621_0001536
552 Ga0495597_0000731
553 Ga0495597_0001876
554 Ga0495645_0000056
555 Ga0495668_0000536
556 Ga0495668_0001803
557 Ga0495611_0000913
558 Ga0495625_0021919
559 Ga0495625_0141418
560 Ga0495635_0235694
561 Ga0495659_0006154
562 Ga0495661_0000855
563 Ga0495661_0002286
564 Ga0495661_0016191
565 Ga0495661_0080959
566 Ga0495599_0001586
567 Ga0495669_0000722
568 Ga0495669_0005187
569 Ga0495669_0020169
570 Ga0495670_0003757
571 Ga0495670_0018550
572 Ga0495671_0000931
573 Ga0495649_0000243
574 Ga0495589_0000133
575 Ga0495589_0000457
576 Ga0495589_0001411
577 Ga0495589_0012701
578 Ga0495660_0000224
579 Ga0495674_0219308
580 Ga0495672_0000175
581 Ga0495672_0000970
582 Ga0495680_0087569
583 Ga0495683_0000379
584 Ga0495687_000146
585 Ga0495687_000693
586 Ga0495677_0000131
587 Ga0495677_0001505
588 Ga0495677_0002765
589 Ga0495679_016629
590 Ga0495679_018180
591 Ga0495685_019169
592 Ga0495681_0001208
593 Ga0495681_0007746
594 Ga0495686_0002429
595 Ga0495602_0041426
596 Ga0495626_0000058
597 Ga0495626_0003451
598 Ga0495626_0010714
599 Ga0495626_0049406
600 Ga0496102_0000582
601 Ga0496102_0126215
602 Ga0496104_0002267
603 Ga0496104_0023063
604 Ga0496105_0001702
605 Ga0496105_0166507
606 Ga0496106_0035168
607 Ga0496106_0112244
608 Ga0496107_0075128
609 Ga0496107_0167371
610 Ga0496110_0000454
611 Ga0496114_0002592
612 Ga0496115_0009594
613 Ga0496124_0068425
614 Ga0496124_0106248
615 Ga0495682_0003738
616 Ga0501036_0056705
617 Ga0501038_0190807
618 Ga0501040_0005014
619 Ga0501041_0041507
620 Ga0501042_0020636
621 Ga0501042_0135309
622 Ga0501048_0148147
623 Ga0501069_0013806
624 Ga0501070_0000550
625 Ga0501071_0062514
626 Ga0501072_0003923
627 Ga0501072_0136069
628 Ga0501073_0052427
629 Ga0501074_0002724
630 Ga0501074_0248593
631 Ga0501075_0003869
632 Ga0501075_0021452
633 Ga0501076_0000214
634 Ga0501076_0008589
635 Ga0501079_0004806
636 Ga0501080_0001497
637 Ga0501080_0012925
638 Ga0501080_0042004
639 Ga0501081_0001801
640 Ga0501081_0025195
641 Ga0501083_0009066
642 Ga0501083_0073088
643 Ga0501045_0010406
644 Ga0501045_0017493
645 nmdc:mga05p37_73571_c1
646 nmdc:mga09592_39_c1
647 nmdc:mga0qj67_191521_c1
648 nmdc:mga0qj67_6716_c1
649 nmdc:mga06r32_10590_c1
650 nmdc:mga06r32_13589_c1
651 nmdc:mga06r32_58356_c1
652 nmdc:mga0a205_25705_c1
653 nmdc:mga0a205_46115_c1
654 Ga0495601_0159424
655 Ga0495612_0019543
656 Ga0501084_0029707
657 Ga0501084_0062094
658 Ga0501082_0215768
659 Ga0530510_0009639
660 2574431100
661 2891636250
662 639786123

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13237

Fer4_10

4Fe-4S dicluster domain

19

86

0.97

PF02754

CCG

Cysteine-rich domain

169

255

0.94

PF13484

Fer4_16

4Fe-4S double cluster binding domain

24

88

0.89

PF12838

Fer4_7

4Fe-4S dicluster domain

24

89

0.86

PF02754

CCG

Cysteine-rich domain

305

389

0.85

PF13534

Fer4_17

4Fe-4S dicluster domain

24

90

0.85

PF13183

Fer4_8

4Fe-4S dicluster domain

21

89

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.8321 140 380
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.8218 141 380
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.6844 141 380
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.6843 140 380
3kwl-assembly1.cif.gz_A crystal structure of a hypothetical protein from helicobacter pylori 0.6319 64 380
ID Description Score Start End Superfamily
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9811 143 227 3.40.30.10
af_P52074_302_386_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9791 279 361 3.40.30.10
af_P52074_302_386_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9455 279 361 3.40.30.10
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9372 143 227 3.40.30.10
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9349 279 361 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3D0DXF3-F1-model_v4 Glycolate oxidase iron-sulfur subunit 0.984 146 385 GO:0016491
GO:0046872
GO:0051539
AF-A0A2C9BM63-F1-model_v4 deleted 0.9813 142 368
AF-A0A3D0DXF3-F1-model_v4 Glycolate oxidase iron-sulfur subunit 0.9758 146 385 GO:0016491
GO:0046872
GO:0051539
AF-A0A536U873-F1-model_v4 Glycolate oxidase subunit GlcF 0.9747 277 380 GO:0016491
GO:0046872
GO:0051539
AF-A0A3D6AIR7-F1-model_v4 Cysteine-rich domain-containing protein 0.9741 198 380 GO:0016491
GO:0046872
GO:0051539

Map