F410400

General Info

Members Datasets Scaffolds Average Seq Length
331 198 662 234

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100098462|Ga0070714_1000984621
Length 246
Sequence MTACEPHPMTSQPIGLPVENTGAAPRPGPVTLKGRYGRLEKLRPDHWSDLWAVFAGHDRIWTYISTDGPFADPAEFAAFIAKRAAADDPYAYAIVDLQDRAVGYFTLLRIVPQHRVIEVGHVLYSPSLQRTPLGTEAQYLLARYVFETLGYRRYEWKCDALNAASRRAALRYGFVYEGTFRQNMIAKGRNRDVTWFSMLDSEWPSRKRAFERWLSPENFDVQGVQKVSLAALNAAAGGQDEQQVAR

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
42 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
76 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
77 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
78 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
89 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
189 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
190 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
191 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.6
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 0
Rhizoplane 3.63
Rhizosphere 92.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100098462 3300005435 Bacteria 2573
2 JGI25404J52841_10000358 3300003659 Bacteria 6161
3 Ga0070676_10072681 3300005328 Bacteria 2068
4 Ga0070690_100088287 3300005330 Bacteria 2038
5 Ga0070670_100099847 3300005331 Bacteria 2498
6 Ga0070680_100062751 3300005336 Bacteria 3043
7 Ga0070660_100240298 3300005339 Bacteria 1475
8 Ga0070689_100005089 3300005340 Bacteria 8948
9 Ga0070671_100000237 3300005355 Bacteria 37130
10 Ga0070673_100025015 3300005364 Bacteria 4387
11 Ga0070667_100112764 3300005367 Bacteria 2359
12 Ga0070714_100339068 3300005435 Bacteria 1409
13 Ga0070713_100120806 3300005436 Bacteria 2297
14 Ga0070713_100166040 3300005436 Bacteria 1974
15 Ga0070662_100069591 3300005457 Bacteria 2591
16 Ga0070698_100169964 3300005471 Bacteria 2121
17 Ga0070665_100037344 3300005548 Bacteria 4885
18 Ga0068855_100264102 3300005563 Bacteria 1917
19 Ga0068856_100469909 3300005614 Bacteria 1278
20 Ga0068859_100709963 3300005617 Bacteria 1096
21 Ga0068858_100585051 3300005842 Bacteria 1082
22 Ga0081455_10053792 3300005937 Bacteria 3437
23 Ga0081455_10094624 3300005937 Bacteria 2413
24 Ga0081538_10087228 3300005981 Bacteria 1630
25 Ga0081540_1001034 3300005983 Bacteria 24931
26 Ga0075365_10014030 3300006038 Bacteria 4811
27 Ga0075365_10326986 3300006038 Bacteria 1080
28 Ga0070712_100014504 3300006175 Bacteria 5057
29 Ga0070712_100035840 3300006175 Bacteria 3371
30 Ga0070712_100090790 3300006175 Bacteria 2237
31 Ga0070712_100096432 3300006175 Bacteria 2177
32 Ga0070712_100124509 3300006175 Bacteria 1944
33 Ga0075428_100845105 3300006844 Bacteria 972
34 Ga0075430_100195229 3300006846 Bacteria 1682
35 Ga0075431_100018201 3300006847 Bacteria 7149
36 Ga0075434_100385913 3300006871 Bacteria 1421
37 Ga0097620_100710068 3300006931 Bacteria 1096
38 Ga0075435_100325152 3300007076 Bacteria 1316
39 Ga0099794_10018011 3300007265 Bacteria 3159
40 Ga0111539_10369466 3300009094 Bacteria 1669
41 Ga0105245_10166097 3300009098 Bacteria 2098
42 Ga0105245_10270866 3300009098 Bacteria 1656
43 Ga0105243_10783184 3300009148 Bacteria 938
44 Ga0105248_10366126 3300009177 Bacteria 1623
45 Ga0105246_10287637 3300011119 Bacteria 1321
46 Ga0157370_10162900 3300013104 Bacteria 2075
47 Ga0157375_10458202 3300013308 Bacteria 1441
48 Ga0163163_10029813 3300014325 Bacteria 5250
49 Ga0163163_10126836 3300014325 Bacteria 2590
50 Ga0157379_10061412 3300014968 Bacteria 3360
51 Ga0224572_1007131 3300024225 Bacteria 2039
52 Ga0224572_1008372 3300024225 Bacteria 1910
53 Ga0228598_1007546 3300024227 Bacteria 2211
54 Ga0228598_1015415 3300024227 Bacteria 1509
55 Ga0207692_10066884 3300025898 Bacteria 1880
56 Ga0207645_10362596 3300025907 Bacteria 971
57 Ga0207693_10009374 3300025915 Bacteria 7984
58 Ga0207693_10012513 3300025915 Bacteria 6854
59 Ga0207693_10032686 3300025915 Bacteria 4106
60 Ga0207693_10100901 3300025915 Bacteria 2263
61 Ga0207693_10207263 3300025915 Bacteria 1541
62 Ga0207663_10206942 3300025916 Bacteria 1419
63 Ga0207660_10559686 3300025917 Bacteria 930
64 Ga0207694_10380469 3300025924 Bacteria 1172
65 Ga0207650_10030348 3300025925 Bacteria 3893
66 Ga0207700_10142464 3300025928 Bacteria 1971
67 Ga0207664_10173799 3300025929 Bacteria 1845
68 Ga0207664_10449349 3300025929 Bacteria 1150
69 Ga0207644_10014185 3300025931 Bacteria 5330
70 Ga0207706_10038783 3300025933 Bacteria 4225
71 Ga0207670_10002773 3300025936 Bacteria 9232
72 Ga0207711_10287671 3300025941 Bacteria 1514
73 Ga0207711_10295865 3300025941 Bacteria 1492
74 Ga0207661_10085746 3300025944 Bacteria 2612
75 Ga0207667_10335207 3300025949 Bacteria 1544
76 Ga0207651_10232889 3300025960 Bacteria 1496
77 Ga0207640_10184831 3300025981 Bacteria 1566
78 Ga0207658_10071333 3300025986 Bacteria 2630
79 Ga0207703_10153578 3300026035 Bacteria 2010
80 Ga0207703_10261069 3300026035 Bacteria 1566
81 Ga0207702_10166758 3300026078 Bacteria 2016
82 Ga0207674_10580403 3300026116 Bacteria 1083
83 Ga0207428_10533489 3300027907 Bacteria 850
84 Ga0268266_10053965 3300028379 Bacteria 3454
85 Ga0265338_10038967 3300028800 Bacteria 4492
86 Ga0265760_10015759 3300031090 Bacteria 2168
87 Ga0265760_10029379 3300031090 Bacteria 1616
88 Ga0265332_10156382 3300031238 Bacteria 953
89 Ga0265325_10001708 3300031241 Bacteria 15269
90 Ga0265325_10004418 3300031241 Bacteria 8892
91 Ga0265340_10117244 3300031247 Bacteria 1227
92 Ga0265339_10000091 3300031249 Bacteria 75937
93 Ga0265316_10004461 3300031344 Bacteria 13928
94 Ga0265313_10000176 3300031595 Bacteria 68037
95 Ga0265313_10000260 3300031595 Bacteria 57581
96 Ga0265313_10159099 3300031595 Bacteria 960
97 Ga0265314_10003737 3300031711 Bacteria 14574
98 Ga0373926_0008286 3300035083 Bacteria 3458
99 Ga0373934_0024077 3300035086 Bacteria 2354
100 Ga0373934_0031645 3300035086 Bacteria 2072
101 Ga0373944_0003210 3300035089 Bacteria 4200
102 Ga0373944_0038845 3300035089 Bacteria 1463
103 Ga0373923_0012826 3300035111 Bacteria 3110
104 Ga0373923_0027798 3300035111 Bacteria 2259
105 Ga0373923_0037460 3300035111 Bacteria 1984
106 Ga0373923_0078139 3300035111 Bacteria 1432
107 Ga0373936_0057541 3300035113 Bacteria 1581
108 Ga0373945_0007196 3300035116 Bacteria 3602
109 Ga0373953_0003117 3300035117 Bacteria 5110
110 Ga0373954_0006503 3300035118 Bacteria 5095
111 Ga0373954_0096710 3300035118 Bacteria 1422
112 Ga0373956_0001924 3300035119 Bacteria 8571
113 Ga0373956_0230772 3300035119 Bacteria 879
114 Ga0373957_0012276 3300035120 Bacteria 2880
115 Ga0373957_0022935 3300035120 Bacteria 2228
116 Ga0373943_0433129 3300035170 Bacteria 762
117 Ga0373946_0132693 3300035171 Bacteria 1147
118 Ga0373955_0007053 3300035172 Bacteria 5147
119 Ga0373955_0008419 3300035172 Bacteria 4790
120 Ga0373961_0074678 3300035241 Bacteria 1055
121 Ga0373924_0020722 3300035410 Bacteria 2558
122 Ga0373924_0068386 3300035410 Bacteria 1495
123 Ga0373935_0004317 3300035692 Bacteria 8341
124 Ga0373935_0047859 3300035692 Bacteria 2705
125 Ga0373927_0007289 3300035695 Bacteria 7502
126 Ga0373933_0002515 3300035724 Bacteria 10296
127 Ga0373933_0023829 3300035724 Bacteria 3500
128 Ga0373947_0002242 3300035725 Bacteria 11693
129 Ga0373947_0034726 3300035725 Bacteria 2983
130 Ga0373937_0001146 3300036401 Bacteria 22227
131 Ga0373937_0089746 3300036401 Bacteria 2846
132 Ga0373937_0112784 3300036401 Bacteria 2529
133 Ga0373937_0522387 3300036401 Bacteria 1128
134 Ga0373925_0000957 3300037068 Bacteria 26248
135 Ga0373925_0161457 3300037068 Bacteria 1765
136 Ga0395905_0087942 3300037471 Bacteria 2913
137 Ga0436360_1175220 3300039438 Bacteria 1548
138 Ga0436361_0841184 3300039447 Bacteria 2152
139 Ga0466963_0063621 3300044694 Bacteria 2470
140 Ga0466964_0256842 3300044706 Bacteria 864
141 Ga0453684_0387952 3300044712 Bacteria 1567
142 Ga0466957_0239474 3300044842 Bacteria 1203
143 Ga0466959_0036483 3300045049 Bacteria 3633
144 Ga0495592_0008218 3300046454 Bacteria 7837
145 Ga0495592_0066632 3300046454 Bacteria 2634
146 Ga0495592_0066979 3300046454 Bacteria 2626
147 Ga0495592_0255599 3300046454 Bacteria 1156
148 Ga0495603_0098678 3300046455 Bacteria 1706
149 Ga0495629_0010732 3300046459 Bacteria 6663
150 Ga0495629_0043295 3300046459 Bacteria 3161
151 Ga0495629_0355091 3300046459 Bacteria 999
152 Ga0495651_0003394 3300046462 Bacteria 12218
153 Ga0495651_0023607 3300046462 Bacteria 4781
154 Ga0495651_0158643 3300046462 Bacteria 1623
155 Ga0495651_0256644 3300046462 Bacteria 1191
156 Ga0495653_0012696 3300046463 Bacteria 6881
157 Ga0495580_0053605 3300046472 Bacteria 2845
158 Ga0495582_0085362 3300046473 Bacteria 1756
159 Ga0495639_0066440 3300046475 Bacteria 1660
160 Ga0495662_0014128 3300046476 Bacteria 3885
161 Ga0495662_0053318 3300046476 Bacteria 1953
162 Ga0495662_0092771 3300046476 Bacteria 1473
163 Ga0495664_0005349 3300046477 Bacteria 7045
164 Ga0495608_0002249 3300046511 Bacteria 13939
165 Ga0495608_0066020 3300046511 Bacteria 2369
166 Ga0495608_0093693 3300046511 Bacteria 1940
167 Ga0495618_0001172 3300046514 Bacteria 17756
168 Ga0495618_0001619 3300046514 Bacteria 15047
169 Ga0495618_0098313 3300046514 Bacteria 1872
170 Ga0495628_0036636 3300046516 Bacteria 3935
171 Ga0495630_0008748 3300046517 Bacteria 7273
172 Ga0495630_0062990 3300046517 Bacteria 2786
173 Ga0495666_0040017 3300046526 Bacteria 2274
174 Ga0495666_0084550 3300046526 Bacteria 1499
175 Ga0495652_0024740 3300046529 Bacteria 5314
176 Ga0495652_0028155 3300046529 Bacteria 4948
177 Ga0495640_0005042 3300046533 Bacteria 10490
178 Ga0495640_0010221 3300046533 Bacteria 7262
179 Ga0495587_0009385 3300046536 Bacteria 6272
180 Ga0495587_0030207 3300046536 Bacteria 3287
181 Ga0495645_0010106 3300046543 Bacteria 6612
182 Ga0495645_0309808 3300046543 Bacteria 1028
183 Ga0495667_0014053 3300046559 Bacteria 5404
184 Ga0495667_0019175 3300046559 Bacteria 4616
185 Ga0495667_0164294 3300046559 Bacteria 1427
186 Ga0495667_0403122 3300046559 Bacteria 861
187 Ga0495634_0006047 3300046642 Bacteria 9235
188 Ga0495635_0000394 3300046663 Bacteria 27871
189 Ga0495635_0005384 3300046663 Bacteria 8903
190 Ga0495657_0038032 3300046675 Bacteria 3313
191 Ga0495657_0063526 3300046675 Bacteria 2435
192 Ga0495657_0255981 3300046675 Bacteria 1053
193 Ga0495599_0005526 3300046678 Bacteria 7574
194 Ga0495599_0040489 3300046678 Bacteria 2926
195 Ga0495623_0003882 3300046679 Bacteria 9855
196 Ga0495623_0071455 3300046679 Bacteria 2159
197 Ga0495646_0207341 3300046680 Bacteria 1065
198 Ga0495647_0004254 3300046681 Bacteria 4637
199 Ga0495658_0241597 3300046683 Bacteria 1134
200 Ga0495613_0063318 3300046689 Bacteria 2706
201 Ga0495613_0161199 3300046689 Bacteria 1595
202 Ga0495600_0001574 3300046809 Bacteria 12692
203 Ga0495581_0220955 3300047315 Bacteria 1108
204 Ga0495604_0000150 3300047317 Bacteria 60582
205 Ga0495674_0040455 3300047319 Bacteria 4169
206 Ga0495674_0040811 3300047319 Bacteria 4148
207 Ga0495674_0192107 3300047319 Bacteria 1696
208 Ga0495676_0016306 3300047321 Bacteria 6598
209 Ga0495676_0039309 3300047321 Bacteria 3919
210 Ga0495680_0000699 3300047322 Bacteria 37651
211 Ga0495680_0029839 3300047322 Bacteria 4461
212 Ga0495680_0135948 3300047322 Bacteria 1802
213 Ga0495680_0386261 3300047322 Bacteria 969
214 Ga0495675_0007130 3300047444 Bacteria 6878
215 Ga0495675_0206072 3300047444 Bacteria 1195
216 Ga0495675_0285255 3300047444 Bacteria 984
217 Ga0495684_0011394 3300047471 Bacteria 6866
218 Ga0495684_0287200 3300047471 Bacteria 1185
219 Ga0495593_0019894 3300047673 Bacteria 3761
220 Ga0495593_0024774 3300047673 Bacteria 3322
221 Ga0495602_0018808 3300048088 Bacteria 6881
222 Ga0495602_0063342 3300048088 Bacteria 3204
223 Ga0496101_0499797 3300048904 Bacteria 961
224 Ga0496102_0109018 3300048905 Bacteria 2579
225 Ga0496104_0623708 3300048907 Bacteria 988
226 Ga0496105_0761811 3300048908 Bacteria 739
227 Ga0496106_0236086 3300048909 Bacteria 1461
228 Ga0496109_0008201 3300048912 Bacteria 8863
229 Ga0496111_0072275 3300048914 Bacteria 2511
230 Ga0496111_0116610 3300048914 Bacteria 1969
231 Ga0496111_0330341 3300048914 Bacteria 1129
232 Ga0496112_0033728 3300048915 Bacteria 4977
233 Ga0496112_0099967 3300048915 Bacteria 2870
234 Ga0496115_0312392 3300048918 Bacteria 1287
235 Ga0501032_0017280 3300049569 Bacteria 5065
236 Ga0501032_0042716 3300049569 Bacteria 3074
237 Ga0501032_0391233 3300049569 Bacteria 893
238 Ga0501033_0025608 3300049570 Bacteria 4444
239 Ga0501034_0053494 3300049571 Bacteria 4064
240 Ga0501034_0056835 3300049571 Bacteria 3935
241 Ga0501034_0165115 3300049571 Bacteria 2183
242 Ga0501034_0173826 3300049571 Bacteria 2120
243 Ga0501036_0000559 3300049572 Bacteria 26726
244 Ga0501036_0024418 3300049572 Bacteria 5095
245 Ga0501036_0262173 3300049572 Bacteria 1447
246 Ga0501036_0288602 3300049572 Bacteria 1373
247 Ga0501037_0019159 3300049573 Bacteria 5043
248 Ga0501038_0035281 3300049574 Bacteria 4391
249 Ga0501038_0100107 3300049574 Bacteria 2415
250 Ga0501039_0021404 3300049575 Bacteria 4962
251 Ga0501039_0082126 3300049575 Bacteria 2509
252 Ga0501040_0160287 3300049576 Bacteria 1590
253 Ga0501040_0339323 3300049576 Bacteria 1076
254 Ga0501042_0290037 3300049578 Bacteria 1182
255 Ga0501043_0021804 3300049579 Bacteria 5023
256 Ga0501043_0641722 3300049579 Bacteria 780
257 Ga0501046_0021830 3300049580 Bacteria 5277
258 Ga0501046_0030399 3300049580 Bacteria 4383
259 Ga0501047_0067396 3300049581 Bacteria 3449
260 Ga0501047_0114085 3300049581 Bacteria 2584
261 Ga0501047_0150860 3300049581 Bacteria 2200
262 Ga0501047_0331583 3300049581 Bacteria 1360
263 Ga0501047_0395860 3300049581 Bacteria 1215
264 Ga0501068_0042908 3300049584 Bacteria 2720
265 Ga0501068_0135901 3300049584 Bacteria 1539
266 Ga0501070_0049766 3300049586 Bacteria 3479
267 Ga0501070_0079845 3300049586 Bacteria 2707
268 Ga0501070_0108921 3300049586 Bacteria 2289
269 Ga0501070_0263096 3300049586 Bacteria 1409
270 Ga0501071_0013118 3300049587 Bacteria 5640
271 Ga0501072_0075492 3300049588 Bacteria 2666
272 Ga0501072_0637390 3300049588 Bacteria 839
273 Ga0501073_0037427 3300049589 Bacteria 3445
274 Ga0501073_0037567 3300049589 Bacteria 3437
275 Ga0501073_0254799 3300049589 Bacteria 1211
276 Ga0501074_0354322 3300049590 Bacteria 1041
277 Ga0501076_0220457 3300049592 Bacteria 1550
278 Ga0501077_0146112 3300049593 Bacteria 1500
279 Ga0501079_0323954 3300049741 Bacteria 1206
280 Ga0501079_0627873 3300049741 Bacteria 846
281 Ga0501080_0016328 3300049742 Bacteria 6855
282 Ga0501080_0043335 3300049742 Bacteria 4190
283 Ga0501080_0347032 3300049742 Bacteria 1341
284 Ga0501083_0059035 3300049744 Bacteria 2566
285 Ga0501035_0004040 3300049822 Bacteria 13976
286 Ga0501035_0076704 3300049822 Bacteria 2955
287 Ga0501044_0036318 3300049823 Bacteria 5155
288 Ga0501044_0170044 3300049823 Bacteria 2151
289 Ga0501044_0216257 3300049823 Bacteria 1868
290 Ga0501044_0235346 3300049823 Bacteria 1777
291 Ga0501044_0610119 3300049823 Bacteria 983
292 Ga0501045_0113072 3300049824 Bacteria 2014
293 nmdc:mga00v17_222194_c1 3300050491 Bacteria 1223
294 nmdc:mga0yw44_258774_c1 3300050492 Bacteria 1159
295 nmdc:mga0yw44_278227_c1 3300050492 Bacteria 1118
296 nmdc:mga0yw44_412320_c1 3300050492 Bacteria 914
297 nmdc:mga0yw44_501_c1 3300050492 Bacteria 13990
298 nmdc:mga0qj67_134267_c1 3300050509 Bacteria 2005
299 nmdc:mga0qj67_26592_c1 3300050509 Bacteria 4479
300 nmdc:mga06r32_137077_c1 3300050510 Bacteria 2422
301 nmdc:mga06r32_148841_c1 3300050510 Bacteria 2319
302 nmdc:mga06r32_51265_c1 3300050510 Bacteria 3949
303 nmdc:mga0rr50_191243_c1 3300050513 Bacteria 1677
304 nmdc:mga08x19_640295_c1 3300050514 Bacteria 754
305 Ga0495601_0010394 3300053077 Bacteria 5537
306 Ga0495601_0058164 3300053077 Bacteria 2449
307 Ga0495612_0000175 3300053078 Bacteria 26975
308 Ga0495612_0003729 3300053078 Bacteria 6330
309 Ga0495612_0007681 3300053078 Bacteria 4404
310 Ga0495595_0000221 3300053084 Bacteria 22745
311 Ga0495595_0048634 3300053084 Bacteria 1958
312 Ga0495595_0336305 3300053084 Bacteria 761
313 Ga0495619_0001997 3300053085 Bacteria 13578
314 Ga0495619_0023782 3300053085 Bacteria 3927
315 Ga0495619_0147817 3300053085 Bacteria 1620
316 Ga0500643_008074 3300053087 Bacteria 4171
317 Ga0500593_011777 3300053117 Bacteria 3695
318 Ga0500595_000010 3300053119 Bacteria 275806
319 Ga0500573_0077827 3300053140 Bacteria 1887
320 Ga0500616_0000001 3300053153 Bacteria 1986011
321 Ga0500645_000051 3300053730 Bacteria 98521
322 Ga0501084_0111778 3300054114 Bacteria 2296
323 Ga0501084_0190485 3300054114 Bacteria 1730
324 Ga0501084_0217383 3300054114 Bacteria 1612
325 Ga0501084_0340971 3300054114 Bacteria 1266
326 Ga0501082_0015911 3300060353 Bacteria 6470
327 Ga0501082_0412547 3300060353 Bacteria 1179
328 Ga0501082_0627345 3300060353 Bacteria 940
329 Ga0466962_0025693 3300061719 Bacteria 2827
330 Ga0530510_0039405 3300061734 Bacteria 3411
331 2643758844 2643221547 Bacteria 4740017
332 Ga0070714_100098462
333 JGI25404J52841_10000358
334 Ga0070676_10072681
335 Ga0070690_100088287
336 Ga0070670_100099847
337 Ga0070680_100062751
338 Ga0070660_100240298
339 Ga0070689_100005089
340 Ga0070671_100000237
341 Ga0070673_100025015
342 Ga0070667_100112764
343 Ga0070714_100339068
344 Ga0070713_100120806
345 Ga0070713_100166040
346 Ga0070662_100069591
347 Ga0070698_100169964
348 Ga0070665_100037344
349 Ga0068855_100264102
350 Ga0068856_100469909
351 Ga0068859_100709963
352 Ga0068858_100585051
353 Ga0081455_10053792
354 Ga0081455_10094624
355 Ga0081538_10087228
356 Ga0081540_1001034
357 Ga0075365_10014030
358 Ga0075365_10326986
359 Ga0070712_100014504
360 Ga0070712_100035840
361 Ga0070712_100090790
362 Ga0070712_100096432
363 Ga0070712_100124509
364 Ga0075428_100845105
365 Ga0075430_100195229
366 Ga0075431_100018201
367 Ga0075434_100385913
368 Ga0097620_100710068
369 Ga0075435_100325152
370 Ga0099794_10018011
371 Ga0111539_10369466
372 Ga0105245_10166097
373 Ga0105245_10270866
374 Ga0105243_10783184
375 Ga0105248_10366126
376 Ga0105246_10287637
377 Ga0157370_10162900
378 Ga0157375_10458202
379 Ga0163163_10029813
380 Ga0163163_10126836
381 Ga0157379_10061412
382 Ga0224572_1007131
383 Ga0224572_1008372
384 Ga0228598_1007546
385 Ga0228598_1015415
386 Ga0207692_10066884
387 Ga0207645_10362596
388 Ga0207693_10009374
389 Ga0207693_10012513
390 Ga0207693_10032686
391 Ga0207693_10100901
392 Ga0207693_10207263
393 Ga0207663_10206942
394 Ga0207660_10559686
395 Ga0207694_10380469
396 Ga0207650_10030348
397 Ga0207700_10142464
398 Ga0207664_10173799
399 Ga0207664_10449349
400 Ga0207644_10014185
401 Ga0207706_10038783
402 Ga0207670_10002773
403 Ga0207711_10287671
404 Ga0207711_10295865
405 Ga0207661_10085746
406 Ga0207667_10335207
407 Ga0207651_10232889
408 Ga0207640_10184831
409 Ga0207658_10071333
410 Ga0207703_10153578
411 Ga0207703_10261069
412 Ga0207702_10166758
413 Ga0207674_10580403
414 Ga0207428_10533489
415 Ga0268266_10053965
416 Ga0265338_10038967
417 Ga0265760_10015759
418 Ga0265760_10029379
419 Ga0265332_10156382
420 Ga0265325_10001708
421 Ga0265325_10004418
422 Ga0265340_10117244
423 Ga0265339_10000091
424 Ga0265316_10004461
425 Ga0265313_10000176
426 Ga0265313_10000260
427 Ga0265313_10159099
428 Ga0265314_10003737
429 Ga0373926_0008286
430 Ga0373934_0024077
431 Ga0373934_0031645
432 Ga0373944_0003210
433 Ga0373944_0038845
434 Ga0373923_0012826
435 Ga0373923_0027798
436 Ga0373923_0037460
437 Ga0373923_0078139
438 Ga0373936_0057541
439 Ga0373945_0007196
440 Ga0373953_0003117
441 Ga0373954_0006503
442 Ga0373954_0096710
443 Ga0373956_0001924
444 Ga0373956_0230772
445 Ga0373957_0012276
446 Ga0373957_0022935
447 Ga0373943_0433129
448 Ga0373946_0132693
449 Ga0373955_0007053
450 Ga0373955_0008419
451 Ga0373961_0074678
452 Ga0373924_0020722
453 Ga0373924_0068386
454 Ga0373935_0004317
455 Ga0373935_0047859
456 Ga0373927_0007289
457 Ga0373933_0002515
458 Ga0373933_0023829
459 Ga0373947_0002242
460 Ga0373947_0034726
461 Ga0373937_0001146
462 Ga0373937_0089746
463 Ga0373937_0112784
464 Ga0373937_0522387
465 Ga0373925_0000957
466 Ga0373925_0161457
467 Ga0395905_0087942
468 Ga0436360_1175220
469 Ga0436361_0841184
470 Ga0466963_0063621
471 Ga0466964_0256842
472 Ga0453684_0387952
473 Ga0466957_0239474
474 Ga0466959_0036483
475 Ga0495592_0008218
476 Ga0495592_0066632
477 Ga0495592_0066979
478 Ga0495592_0255599
479 Ga0495603_0098678
480 Ga0495629_0010732
481 Ga0495629_0043295
482 Ga0495629_0355091
483 Ga0495651_0003394
484 Ga0495651_0023607
485 Ga0495651_0158643
486 Ga0495651_0256644
487 Ga0495653_0012696
488 Ga0495580_0053605
489 Ga0495582_0085362
490 Ga0495639_0066440
491 Ga0495662_0014128
492 Ga0495662_0053318
493 Ga0495662_0092771
494 Ga0495664_0005349
495 Ga0495608_0002249
496 Ga0495608_0066020
497 Ga0495608_0093693
498 Ga0495618_0001172
499 Ga0495618_0001619
500 Ga0495618_0098313
501 Ga0495628_0036636
502 Ga0495630_0008748
503 Ga0495630_0062990
504 Ga0495666_0040017
505 Ga0495666_0084550
506 Ga0495652_0024740
507 Ga0495652_0028155
508 Ga0495640_0005042
509 Ga0495640_0010221
510 Ga0495587_0009385
511 Ga0495587_0030207
512 Ga0495645_0010106
513 Ga0495645_0309808
514 Ga0495667_0014053
515 Ga0495667_0019175
516 Ga0495667_0164294
517 Ga0495667_0403122
518 Ga0495634_0006047
519 Ga0495635_0000394
520 Ga0495635_0005384
521 Ga0495657_0038032
522 Ga0495657_0063526
523 Ga0495657_0255981
524 Ga0495599_0005526
525 Ga0495599_0040489
526 Ga0495623_0003882
527 Ga0495623_0071455
528 Ga0495646_0207341
529 Ga0495647_0004254
530 Ga0495658_0241597
531 Ga0495613_0063318
532 Ga0495613_0161199
533 Ga0495600_0001574
534 Ga0495581_0220955
535 Ga0495604_0000150
536 Ga0495674_0040455
537 Ga0495674_0040811
538 Ga0495674_0192107
539 Ga0495676_0016306
540 Ga0495676_0039309
541 Ga0495680_0000699
542 Ga0495680_0029839
543 Ga0495680_0135948
544 Ga0495680_0386261
545 Ga0495675_0007130
546 Ga0495675_0206072
547 Ga0495675_0285255
548 Ga0495684_0011394
549 Ga0495684_0287200
550 Ga0495593_0019894
551 Ga0495593_0024774
552 Ga0495602_0018808
553 Ga0495602_0063342
554 Ga0496101_0499797
555 Ga0496102_0109018
556 Ga0496104_0623708
557 Ga0496105_0761811
558 Ga0496106_0236086
559 Ga0496109_0008201
560 Ga0496111_0072275
561 Ga0496111_0116610
562 Ga0496111_0330341
563 Ga0496112_0033728
564 Ga0496112_0099967
565 Ga0496115_0312392
566 Ga0501032_0017280
567 Ga0501032_0042716
568 Ga0501032_0391233
569 Ga0501033_0025608
570 Ga0501034_0053494
571 Ga0501034_0056835
572 Ga0501034_0165115
573 Ga0501034_0173826
574 Ga0501036_0000559
575 Ga0501036_0024418
576 Ga0501036_0262173
577 Ga0501036_0288602
578 Ga0501037_0019159
579 Ga0501038_0035281
580 Ga0501038_0100107
581 Ga0501039_0021404
582 Ga0501039_0082126
583 Ga0501040_0160287
584 Ga0501040_0339323
585 Ga0501042_0290037
586 Ga0501043_0021804
587 Ga0501043_0641722
588 Ga0501046_0021830
589 Ga0501046_0030399
590 Ga0501047_0067396
591 Ga0501047_0114085
592 Ga0501047_0150860
593 Ga0501047_0331583
594 Ga0501047_0395860
595 Ga0501068_0042908
596 Ga0501068_0135901
597 Ga0501070_0049766
598 Ga0501070_0079845
599 Ga0501070_0108921
600 Ga0501070_0263096
601 Ga0501071_0013118
602 Ga0501072_0075492
603 Ga0501072_0637390
604 Ga0501073_0037427
605 Ga0501073_0037567
606 Ga0501073_0254799
607 Ga0501074_0354322
608 Ga0501076_0220457
609 Ga0501077_0146112
610 Ga0501079_0323954
611 Ga0501079_0627873
612 Ga0501080_0016328
613 Ga0501080_0043335
614 Ga0501080_0347032
615 Ga0501083_0059035
616 Ga0501035_0004040
617 Ga0501035_0076704
618 Ga0501044_0036318
619 Ga0501044_0170044
620 Ga0501044_0216257
621 Ga0501044_0235346
622 Ga0501044_0610119
623 Ga0501045_0113072
624 nmdc:mga00v17_222194_c1
625 nmdc:mga0yw44_258774_c1
626 nmdc:mga0yw44_278227_c1
627 nmdc:mga0yw44_412320_c1
628 nmdc:mga0yw44_501_c1
629 nmdc:mga0qj67_134267_c1
630 nmdc:mga0qj67_26592_c1
631 nmdc:mga06r32_137077_c1
632 nmdc:mga06r32_148841_c1
633 nmdc:mga06r32_51265_c1
634 nmdc:mga0rr50_191243_c1
635 nmdc:mga08x19_640295_c1
636 Ga0495601_0010394
637 Ga0495601_0058164
638 Ga0495612_0000175
639 Ga0495612_0003729
640 Ga0495612_0007681
641 Ga0495595_0000221
642 Ga0495595_0048634
643 Ga0495595_0336305
644 Ga0495619_0001997
645 Ga0495619_0023782
646 Ga0495619_0147817
647 Ga0500643_008074
648 Ga0500593_011777
649 Ga0500595_000010
650 Ga0500573_0077827
651 Ga0500616_0000001
652 Ga0500645_000051
653 Ga0501084_0111778
654 Ga0501084_0190485
655 Ga0501084_0217383
656 Ga0501084_0340971
657 Ga0501082_0015911
658 Ga0501082_0412547
659 Ga0501082_0627345
660 Ga0466962_0025693
661 Ga0530510_0039405
662 2643758844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

38

175

0.87

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

50

174

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.9426 22 230
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.8897 22 230
3pzj-assembly1.cif.gz_B crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.8849 19 203
3pzj-assembly1.cif.gz_B crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.876 19 203
2zxv-assembly6.cif.gz_D crystal structure of putative acetyltransferase from t. thermophilus hb8 0.8755 27 211
ID Description Score Start End Superfamily
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9426 22 230 3.40.630.30
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9211 21 231 3.40.630.30
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8897 22 230 3.40.630.30
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8851 21 231 3.40.630.30
3pzjB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8813 19 203 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A833GAH9-F1-model_v4 GNAT family N-acetyltransferase 0.9608 2 230 GO:0008999
GO:1990189
AF-A0A840AKV7-F1-model_v4 RimJ/RimL family protein N-acetyltransferase 0.9509 15 228 GO:0008999
GO:1990189
AF-A0A833GAH9-F1-model_v4 GNAT family N-acetyltransferase 0.9487 2 230 GO:0008999
GO:1990189
AF-A0A0K1FAV3-F1-model_v4 N-acetyltransferase domain-containing protein 0.9467 10 230 GO:0008999
GO:1990189
AF-A0A542JN42-F1-model_v4 deleted 0.9466 23 229

Map