F410388

General Info

Members Datasets Scaffolds Average Seq Length
331 202 662 227

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100037189|Ga0070671_1000371892
Length 240
Sequence LSSGRVLVVDDEPQIRRIMRTALTGAGYEIDDAKTGEEALEKIREFRPDLVLLDINMPGMGGLAACREIRADTSIAIIMLTVRDSEADKVDALDAGADDFVTKPFSTPELLARIRAALRRLPVSQSSPARLRVGQLEIDFTARTVTNGAKTAHLTPKELDLLRYLTQHANGAVAHRELLQAVWGPDYGDQVDYLRVFIKNLRKKIEINPEHPEYITTEPWVGYRFKGVFEPDDSTTKKVL

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 0.6
Rhizosphere 96.98
Stem 0
Stem Tuber 0
Unclassified 5.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100037189 3300005355 Bacteria 4037
2 Ga0065707_10209033 3300005295 Bacteria 1274
3 Ga0070658_10031185 3300005327 Bacteria 4280
4 Ga0068869_100007767 3300005334 Bacteria 6880
5 Ga0068868_100047846 3300005338 Bacteria 3353
6 Ga0070660_100038390 3300005339 Bacteria 3635
7 Ga0070689_100133585 3300005340 Bacteria 1991
8 Ga0070689_100317559 3300005340 Bacteria 1300
9 Ga0070687_100032507 3300005343 Bacteria 2567
10 Ga0070661_100104406 3300005344 Bacteria 2111
11 Ga0070669_100088763 3300005353 Bacteria 2315
12 Ga0070669_100209498 3300005353 Bacteria 1537
13 Ga0070675_100002157 3300005354 Bacteria 14553
14 Ga0070673_100049887 3300005364 Bacteria 3270
15 Ga0070673_100082017 3300005364 Bacteria 2616
16 Ga0070688_100026910 3300005365 Bacteria 3422
17 Ga0070659_100114383 3300005366 Bacteria 2180
18 Ga0070659_100383577 3300005366 Bacteria 1184
19 Ga0070709_10065374 3300005434 Bacteria 2329
20 Ga0070709_10476445 3300005434 Bacteria 944
21 Ga0070713_100005279 3300005436 Bacteria 8812
22 Ga0070710_10326510 3300005437 Bacteria 1009
23 Ga0070711_100034739 3300005439 Bacteria 3365
24 Ga0070711_100047448 3300005439 Bacteria 2933
25 Ga0070711_100580413 3300005439 Bacteria 933
26 Ga0070711_100749712 3300005439 Bacteria 825
27 Ga0070700_100134117 3300005441 Bacteria 1675
28 Ga0070708_100009650 3300005445 Bacteria 7786
29 Ga0070708_100181639 3300005445 Bacteria 1967
30 Ga0070708_100278846 3300005445 Bacteria 1573
31 Ga0070681_10002256 3300005458 Bacteria 17604
32 Ga0070681_10038360 3300005458 Bacteria 4804
33 Ga0070681_10670700 3300005458 Bacteria 952
34 Ga0068867_100324810 3300005459 Bacteria 1276
35 Ga0070685_10029987 3300005466 Bacteria 3026
36 Ga0070706_100032199 3300005467 Plasmid 4836
37 Ga0070706_100070346 3300005467 Unclassified 3236
38 Ga0070706_100143797 3300005467 Bacteria 2227
39 Ga0070707_100141997 3300005468 Bacteria 2337
40 Ga0070698_100033486 3300005471 Bacteria 5322
41 Ga0070699_100131169 3300005518 Bacteria 2209
42 Ga0070679_100085178 3300005530 Bacteria 3147
43 Ga0070684_100008598 3300005535 Bacteria 7997
44 Ga0070684_100095270 3300005535 Bacteria 2652
45 Ga0070697_100043411 3300005536 Unclassified 3641
46 Ga0068853_100421921 3300005539 Bacteria 1251
47 Ga0070672_100215505 3300005543 Bacteria 1609
48 Ga0070672_100298609 3300005543 Unclassified 1365
49 Ga0070686_100043239 3300005544 Bacteria 2826
50 Ga0070693_100183159 3300005547 Bacteria 1350
51 Ga0070704_100095631 3300005549 Bacteria 2225
52 Ga0068855_100016988 3300005563 Bacteria 8752
53 Ga0070664_100240810 3300005564 Bacteria 1624
54 Ga0068854_100133122 3300005578 Bacteria 1900
55 Ga0068856_100026196 3300005614 Bacteria 5686
56 Ga0068856_100078408 3300005614 Bacteria 3275
57 Ga0070702_100036793 3300005615 Bacteria 2714
58 Ga0070702_100373456 3300005615 Bacteria 1012
59 Ga0068852_100017402 3300005616 Bacteria 5639
60 Ga0068859_100027196 3300005617 Bacteria 5738
61 Ga0068859_100027895 3300005617 Bacteria 5662
62 Ga0068859_100281744 3300005617 Bacteria 1755
63 Ga0068866_10481391 3300005718 Bacteria 818
64 Ga0068851_10162629 3300005834 Bacteria 1227
65 Ga0068858_100010327 3300005842 Bacteria 8848
66 Ga0068858_100057969 3300005842 Bacteria 3580
67 Ga0068858_100099007 3300005842 Bacteria 2718
68 Ga0068858_100165130 3300005842 Bacteria 2086
69 Ga0068860_100045778 3300005843 Bacteria 4172
70 Ga0068862_100223055 3300005844 Bacteria 1707
71 Ga0070717_10001525 3300006028 Bacteria 16044
72 Ga0070717_10042377 3300006028 Bacteria 3712
73 Ga0070716_100104828 3300006173 Bacteria 1741
74 Ga0097621_100005594 3300006237 Bacteria 8860
75 Ga0068871_100226018 3300006358 Bacteria 1623
76 Ga0068871_100290918 3300006358 Bacteria 1431
77 Ga0068871_100446786 3300006358 Bacteria 1158
78 Ga0075428_100252322 3300006844 Bacteria 1901
79 Ga0075431_100005887 3300006847 Bacteria 12132
80 Ga0075434_100346168 3300006871 Bacteria 1507
81 Ga0075429_100885491 3300006880 Bacteria 781
82 Ga0068865_100007586 3300006881 Bacteria 6677
83 Ga0068865_100063187 3300006881 Unclassified 2601
84 Ga0097620_100027196 3300006931 Bacteria 5738
85 Ga0097620_100027895 3300006931 Bacteria 5662
86 Ga0097620_100281762 3300006931 Bacteria 1755
87 Ga0075435_100009010 3300007076 Bacteria 7198
88 Ga0105240_10214379 3300009093 Bacteria 2247
89 Ga0105240_10511699 3300009093 Bacteria 1334
90 Ga0105240_10683674 3300009093 Bacteria 1122
91 Ga0111539_10131315 3300009094 Bacteria 2932
92 Ga0105245_10056305 3300009098 Bacteria 3534
93 Ga0105245_10094168 3300009098 Plasmid 2761
94 Ga0105245_10121573 3300009098 Bacteria 2440
95 Ga0105245_10837826 3300009098 Bacteria 959
96 Ga0114129_10012766 3300009147 Bacteria 11957
97 Ga0105243_10010372 3300009148 Bacteria 7075
98 Ga0105243_10164313 3300009148 Bacteria 1917
99 Ga0105241_10011686 3300009174 Bacteria 6445
100 Ga0105241_10139946 3300009174 Bacteria 1969
101 Ga0105242_10010107 3300009176 Bacteria 7227
102 Ga0105242_10055665 3300009176 Bacteria 3235
103 Ga0105242_10108946 3300009176 Bacteria 2358
104 Ga0105242_10174245 3300009176 Bacteria 1893
105 Ga0105242_10187731 3300009176 Bacteria 1828
106 Ga0105248_10005934 3300009177 Bacteria 13425
107 Ga0105248_10140769 3300009177 Bacteria 2721
108 Ga0105248_10532205 3300009177 Bacteria 1325
109 Ga0105248_10947210 3300009177 Unclassified 972
110 Ga0105237_10150031 3300009545 Bacteria 2327
111 Ga0105237_10192664 3300009545 Bacteria 2038
112 Ga0105238_10004254 3300009551 Bacteria 14226
113 Ga0105238_10008111 3300009551 Bacteria 10503
114 Ga0105238_10073824 3300009551 Bacteria 3405
115 Ga0105238_10241034 3300009551 Unclassified 1786
116 Ga0105249_10044945 3300009553 Unclassified 4016
117 Ga0105249_10046937 3300009553 Bacteria 3933
118 Ga0105249_10064624 3300009553 Bacteria 3365
119 Ga0105249_10968209 3300009553 Bacteria 919
120 Ga0157370_10022126 3300013104 Bacteria 6328
121 Ga0157370_10125789 3300013104 Bacteria 2392
122 Ga0157369_10008113 3300013105 Bacteria 12035
123 Ga0157374_10007447 3300013296 Bacteria 9337
124 Ga0157374_10080821 3300013296 Bacteria 3084
125 Ga0157374_10442918 3300013296 Bacteria 1300
126 Ga0157378_10011529 3300013297 Bacteria 7739
127 Ga0157378_10020596 3300013297 Bacteria 5800
128 Ga0157378_10049091 3300013297 Bacteria 3754
129 Ga0157378_10416650 3300013297 Bacteria 1327
130 Ga0163162_10040187 3300013306 Bacteria 4677
131 Ga0163162_10176393 3300013306 Bacteria 2263
132 Ga0163162_10245876 3300013306 Bacteria 1921
133 Ga0163162_10275856 3300013306 Bacteria 1813
134 Ga0163162_10288439 3300013306 Unclassified 1773
135 Ga0157372_10207007 3300013307 Bacteria 2273
136 Ga0157372_10381951 3300013307 Bacteria 1641
137 Ga0157375_10004021 3300013308 Bacteria 12757
138 Ga0157375_10029348 3300013308 Bacteria 5171
139 Ga0157375_10285539 3300013308 Bacteria 1813
140 Ga0163163_10070631 3300014325 Bacteria 3478
141 Ga0163163_10127922 3300014325 Bacteria 2579
142 Ga0163163_10196783 3300014325 Bacteria 2064
143 Ga0157380_10043499 3300014326 Bacteria 3517
144 Ga0157377_10077513 3300014745 Bacteria 1935
145 Ga0157379_10123637 3300014968 Bacteria 2328
146 Ga0157376_10311986 3300014969 Unclassified 1492
147 Ga0157376_10490878 3300014969 Bacteria 1205
148 Ga0213875_10051748 3300021388 Bacteria 1924
149 Ga0207692_10082979 3300025898 Bacteria 1719
150 Ga0207645_10016150 3300025907 Bacteria 4946
151 Ga0207705_10021431 3300025909 Bacteria 4612
152 Ga0207684_10010618 3300025910 Bacteria 8093
153 Ga0207684_10047513 3300025910 Unclassified 3640
154 Ga0207654_10074858 3300025911 Bacteria 2022
155 Ga0207707_10002870 3300025912 Bacteria 15399
156 Ga0207707_10125819 3300025912 Bacteria 2241
157 Ga0207695_10005503 3300025913 Bacteria 16765
158 Ga0207695_10062081 3300025913 Bacteria 3860
159 Ga0207671_10257803 3300025914 Bacteria 1372
160 Ga0207693_10002694 3300025915 Bacteria 15394
161 Ga0207663_10139694 3300025916 Unclassified 1686
162 Ga0207663_10444477 3300025916 Bacteria 999
163 Ga0207662_10015068 3300025918 Bacteria 4345
164 Ga0207662_10115452 3300025918 Bacteria 1678
165 Ga0207657_10007196 3300025919 Bacteria 11424
166 Ga0207649_10188840 3300025920 Bacteria 1447
167 Ga0207652_10110152 3300025921 Bacteria 2441
168 Ga0207646_10141477 3300025922 Bacteria 2167
169 Ga0207681_10463704 3300025923 Bacteria 1032
170 Ga0207694_10002109 3300025924 Bacteria 16406
171 Ga0207694_10007542 3300025924 Bacteria 8245
172 Ga0207694_10056740 3300025924 Bacteria 3042
173 Ga0207694_10178587 3300025924 Unclassified 1721
174 Ga0207694_10241217 3300025924 Bacteria 1477
175 Ga0207659_10367912 3300025926 Bacteria 1196
176 Ga0207687_10013704 3300025927 Bacteria 5293
177 Ga0207687_10081154 3300025927 Bacteria 2343
178 Ga0207687_10099692 3300025927 Unclassified 2135
179 Ga0207700_10038337 3300025928 Bacteria 3478
180 Ga0207700_10052435 3300025928 Bacteria 3050
181 Ga0207644_10058387 3300025931 Bacteria 2789
182 Ga0207686_10037027 3300025934 Bacteria 2941
183 Ga0207686_10072726 3300025934 Bacteria 2217
184 Ga0207686_10085483 3300025934 Unclassified 2069
185 Ga0207686_10092122 3300025934 Bacteria 2003
186 Ga0207686_10373081 3300025934 Bacteria 1080
187 Ga0207709_10157533 3300025935 Bacteria 1580
188 Ga0207670_10107273 3300025936 Bacteria 2005
189 Ga0207670_10247597 3300025936 Bacteria 1376
190 Ga0207670_10429776 3300025936 Bacteria 1061
191 Ga0207669_10355703 3300025937 Bacteria 1133
192 Ga0207691_10009237 3300025940 Bacteria 9461
193 Ga0207691_10178376 3300025940 Bacteria 1857
194 Ga0207711_10002964 3300025941 Bacteria 14832
195 Ga0207711_10173624 3300025941 Bacteria 1957
196 Ga0207689_10076809 3300025942 Unclassified 2745
197 Ga0207689_10112504 3300025942 Bacteria 2238
198 Ga0207661_10211819 3300025944 Bacteria 1708
199 Ga0207667_10010701 3300025949 Bacteria 10703
200 Ga0207667_10011058 3300025949 Bacteria 10514
201 Ga0207651_10002065 3300025960 Bacteria 9456
202 Ga0207651_10006724 3300025960 Bacteria 6056
203 Ga0207712_10113664 3300025961 Bacteria 2035
204 Ga0207677_10159599 3300026023 Bacteria 1750
205 Ga0207677_10394513 3300026023 Bacteria 1172
206 Ga0207703_10019814 3300026035 Bacteria 5258
207 Ga0207703_10033430 3300026035 Bacteria 4077
208 Ga0207703_10830421 3300026035 Bacteria 883
209 Ga0207639_10074500 3300026041 Unclassified 2666
210 Ga0207708_10008869 3300026075 Bacteria 7443
211 Ga0207702_10013155 3300026078 Bacteria 6881
212 Ga0207702_10256055 3300026078 Bacteria 1646
213 Ga0207641_10191531 3300026088 Bacteria 1880
214 Ga0207648_10082416 3300026089 Bacteria 2805
215 Ga0207683_10311582 3300026121 Bacteria 1441
216 Ga0268265_10249240 3300028380 Bacteria 1572
217 Ga0268264_10278152 3300028381 Bacteria 1566
218 Ga0265325_10108867 3300031241 Bacteria 1349
219 Ga0265313_10011929 3300031595 Bacteria 5363
220 Ga0265313_10129762 3300031595 Bacteria 1093
221 Ga0265314_10002183 3300031711 Bacteria 20454
222 Ga0265314_10023989 3300031711 Bacteria 4635
223 Ga0373934_0048300 3300035086 Bacteria 1684
224 Ga0373953_0065856 3300035117 Bacteria 1488
225 Ga0373953_0077089 3300035117 Bacteria 1382
226 Ga0373954_0005283 3300035118 Bacteria 5579
227 Ga0373956_0037817 3300035119 Bacteria 2134
228 Ga0373957_0072946 3300035120 Bacteria 1345
229 Ga0373943_0148588 3300035170 Bacteria 1268
230 Ga0373946_0137814 3300035171 Bacteria 1128
231 Ga0373955_0004645 3300035172 Bacteria 6093
232 Ga0373955_0019924 3300035172 Bacteria 3363
233 Ga0373955_0039448 3300035172 Bacteria 2521
234 Ga0373961_0075521 3300035241 Bacteria 1051
235 Ga0373935_0062559 3300035692 Bacteria 2384
236 Ga0373935_0177962 3300035692 Bacteria 1459
237 Ga0373935_0319627 3300035692 Bacteria 1101
238 Ga0373927_0146482 3300035695 Bacteria 1546
239 Ga0373933_0025957 3300035724 Bacteria 3361
240 Ga0373933_0098982 3300035724 Bacteria 1807
241 Ga0373933_0121899 3300035724 Bacteria 1633
242 Ga0373933_0248608 3300035724 Bacteria 1145
243 Ga0373947_0095327 3300035725 Bacteria 1862
244 Ga0373947_0132018 3300035725 Bacteria 1595
245 Ga0373937_0000642 3300036401 Bacteria 30622
246 Ga0373937_0015831 3300036401 Bacteria 6682
247 Ga0373937_0022753 3300036401 Bacteria 5638
248 Ga0373937_0137780 3300036401 Bacteria 2282
249 Ga0373937_0153829 3300036401 Bacteria 2155
250 Ga0373937_0288502 3300036401 Bacteria 1550
251 Ga0373937_0526016 3300036401 Bacteria 1124
252 Ga0373925_0015512 3300037068 Bacteria 5510
253 Ga0373925_0054351 3300037068 Bacteria 2995
254 Ga0373925_0340613 3300037068 Bacteria 1216
255 Ga0436364_0776161 3300037853 Bacteria 995
256 Ga0436364_0788891 3300037853 Bacteria 2183
257 Ga0436364_1314924 3300037853 Bacteria 3578
258 Ga0436364_1357371 3300037853 Bacteria 3936
259 Ga0395901_0475547 3300038443 Bacteria 1275
260 Ga0436365_0827980 3300039437 Bacteria 960
261 Ga0436365_1270899 3300039437 Unclassified 1261
262 Ga0436362_0071506 3300039453 Bacteria 2978
263 Ga0451576_0167518 3300045051 Bacteria 2293
264 Ga0495629_0282213 3300046459 Bacteria 1139
265 Ga0495651_0036654 3300046462 Bacteria 3818
266 Ga0495653_0127546 3300046463 Bacteria 1805
267 Ga0495580_0004429 3300046472 Bacteria 11803
268 Ga0495580_0326604 3300046472 Bacteria 1042
269 Ga0495580_0368431 3300046472 Bacteria 972
270 Ga0495608_0058759 3300046511 Bacteria 2535
271 Ga0495608_0236686 3300046511 Bacteria 1142
272 Ga0495608_0255660 3300046511 Bacteria 1091
273 Ga0495628_0393818 3300046516 Bacteria 1013
274 Ga0495630_0218237 3300046517 Unclassified 1456
275 Ga0495652_0019881 3300046529 Bacteria 5974
276 Ga0495665_0066495 3300046531 Bacteria 1902
277 Ga0495586_0054796 3300046535 Bacteria 2162
278 Ga0495587_0035798 3300046536 Bacteria 2989
279 Ga0495645_0030773 3300046543 Bacteria 3911
280 Ga0495667_0036496 3300046559 Bacteria 3281
281 Ga0495667_0095582 3300046559 Bacteria 1924
282 Ga0495667_0222697 3300046559 Bacteria 1204
283 Ga0495667_0373548 3300046559 Bacteria 899
284 Ga0495635_0063362 3300046663 Bacteria 2539
285 Ga0495599_0000664 3300046678 Bacteria 19459
286 Ga0495599_0304887 3300046678 Bacteria 961
287 Ga0495623_0438562 3300046679 Bacteria 697
288 Ga0495613_0065861 3300046689 Bacteria 2647
289 Ga0495600_0128951 3300046809 Bacteria 1644
290 Ga0495674_0135691 3300047319 Bacteria 2071
291 Ga0495680_0031295 3300047322 Bacteria 4333
292 Ga0495680_0725497 3300047322 Bacteria 654
293 Ga0495675_0341082 3300047444 Bacteria 883
294 Ga0495684_0064165 3300047471 Bacteria 2791
295 Ga0495684_0183830 3300047471 Bacteria 1548
296 Ga0495684_0225666 3300047471 Bacteria 1372
297 Ga0495684_0541151 3300047471 Bacteria 794
298 Ga0495602_0002396 3300048088 Bacteria 19038
299 Ga0496113_0000006 3300048916 Bacteria 101670
300 Ga0496115_0566945 3300048918 Bacteria 906
301 Ga0501031_0007117 3300049568 Bacteria 7302
302 Ga0501032_0012616 3300049569 Bacteria 6031
303 Ga0501036_0000271 3300049572 Bacteria 35394
304 Ga0501037_0010024 3300049573 Bacteria 6950
305 Ga0501038_0003836 3300049574 Bacteria 13976
306 Ga0501039_0006530 3300049575 Bacteria 8857
307 Ga0501043_0003169 3300049579 Bacteria 13608
308 Ga0501046_0001715 3300049580 Bacteria 20916
309 Ga0501047_0470177 3300049581 Bacteria 1085
310 Ga0501048_0021073 3300049582 Bacteria 4774
311 Ga0501067_0084797 3300049583 Bacteria 1757
312 Ga0501068_0000546 3300049584 Bacteria 19075
313 Ga0501069_0000350 3300049585 Bacteria 20758
314 Ga0501072_0006853 3300049588 Bacteria 8647
315 Ga0501073_0000765 3300049589 Bacteria 22825
316 Ga0501077_0026917 3300049593 Bacteria 3651
317 Ga0501079_0172898 3300049741 Bacteria 1684
318 Ga0501080_0005676 3300049742 Bacteria 11156
319 Ga0501083_0009263 3300049744 Bacteria 6950
320 Ga0501035_0126324 3300049822 Bacteria 2232
321 Ga0501045_0121780 3300049824 Bacteria 1937
322 nmdc:mga05p37_55178_c1 3300050507 Bacteria 4888
323 nmdc:mga09592_767517_c1 3300050508 Bacteria 817
324 nmdc:mga06r32_24800_c1 3300050510 Bacteria 5573
325 nmdc:mga06r32_829235_c1 3300050510 Bacteria 884
326 nmdc:mga08y16_571168_c1 3300050511 Bacteria 1143
327 Ga0495595_0112035 3300053084 Bacteria 1324
328 Ga0495619_0221076 3300053085 Bacteria 1312
329 Ga0500568_0078394 3300053139 Bacteria 1256
330 Ga0501084_0017062 3300054114 Bacteria 6032
331 Ga0501082_0027385 3300060353 Bacteria 4906
332 Ga0070671_100037189
333 Ga0065707_10209033
334 Ga0070658_10031185
335 Ga0068869_100007767
336 Ga0068868_100047846
337 Ga0070660_100038390
338 Ga0070689_100133585
339 Ga0070689_100317559
340 Ga0070687_100032507
341 Ga0070661_100104406
342 Ga0070669_100088763
343 Ga0070669_100209498
344 Ga0070675_100002157
345 Ga0070673_100049887
346 Ga0070673_100082017
347 Ga0070688_100026910
348 Ga0070659_100114383
349 Ga0070659_100383577
350 Ga0070709_10065374
351 Ga0070709_10476445
352 Ga0070713_100005279
353 Ga0070710_10326510
354 Ga0070711_100034739
355 Ga0070711_100047448
356 Ga0070711_100580413
357 Ga0070711_100749712
358 Ga0070700_100134117
359 Ga0070708_100009650
360 Ga0070708_100181639
361 Ga0070708_100278846
362 Ga0070681_10002256
363 Ga0070681_10038360
364 Ga0070681_10670700
365 Ga0068867_100324810
366 Ga0070685_10029987
367 Ga0070706_100032199
368 Ga0070706_100070346
369 Ga0070706_100143797
370 Ga0070707_100141997
371 Ga0070698_100033486
372 Ga0070699_100131169
373 Ga0070679_100085178
374 Ga0070684_100008598
375 Ga0070684_100095270
376 Ga0070697_100043411
377 Ga0068853_100421921
378 Ga0070672_100215505
379 Ga0070672_100298609
380 Ga0070686_100043239
381 Ga0070693_100183159
382 Ga0070704_100095631
383 Ga0068855_100016988
384 Ga0070664_100240810
385 Ga0068854_100133122
386 Ga0068856_100026196
387 Ga0068856_100078408
388 Ga0070702_100036793
389 Ga0070702_100373456
390 Ga0068852_100017402
391 Ga0068859_100027196
392 Ga0068859_100027895
393 Ga0068859_100281744
394 Ga0068866_10481391
395 Ga0068851_10162629
396 Ga0068858_100010327
397 Ga0068858_100057969
398 Ga0068858_100099007
399 Ga0068858_100165130
400 Ga0068860_100045778
401 Ga0068862_100223055
402 Ga0070717_10001525
403 Ga0070717_10042377
404 Ga0070716_100104828
405 Ga0097621_100005594
406 Ga0068871_100226018
407 Ga0068871_100290918
408 Ga0068871_100446786
409 Ga0075428_100252322
410 Ga0075431_100005887
411 Ga0075434_100346168
412 Ga0075429_100885491
413 Ga0068865_100007586
414 Ga0068865_100063187
415 Ga0097620_100027196
416 Ga0097620_100027895
417 Ga0097620_100281762
418 Ga0075435_100009010
419 Ga0105240_10214379
420 Ga0105240_10511699
421 Ga0105240_10683674
422 Ga0111539_10131315
423 Ga0105245_10056305
424 Ga0105245_10094168
425 Ga0105245_10121573
426 Ga0105245_10837826
427 Ga0114129_10012766
428 Ga0105243_10010372
429 Ga0105243_10164313
430 Ga0105241_10011686
431 Ga0105241_10139946
432 Ga0105242_10010107
433 Ga0105242_10055665
434 Ga0105242_10108946
435 Ga0105242_10174245
436 Ga0105242_10187731
437 Ga0105248_10005934
438 Ga0105248_10140769
439 Ga0105248_10532205
440 Ga0105248_10947210
441 Ga0105237_10150031
442 Ga0105237_10192664
443 Ga0105238_10004254
444 Ga0105238_10008111
445 Ga0105238_10073824
446 Ga0105238_10241034
447 Ga0105249_10044945
448 Ga0105249_10046937
449 Ga0105249_10064624
450 Ga0105249_10968209
451 Ga0157370_10022126
452 Ga0157370_10125789
453 Ga0157369_10008113
454 Ga0157374_10007447
455 Ga0157374_10080821
456 Ga0157374_10442918
457 Ga0157378_10011529
458 Ga0157378_10020596
459 Ga0157378_10049091
460 Ga0157378_10416650
461 Ga0163162_10040187
462 Ga0163162_10176393
463 Ga0163162_10245876
464 Ga0163162_10275856
465 Ga0163162_10288439
466 Ga0157372_10207007
467 Ga0157372_10381951
468 Ga0157375_10004021
469 Ga0157375_10029348
470 Ga0157375_10285539
471 Ga0163163_10070631
472 Ga0163163_10127922
473 Ga0163163_10196783
474 Ga0157380_10043499
475 Ga0157377_10077513
476 Ga0157379_10123637
477 Ga0157376_10311986
478 Ga0157376_10490878
479 Ga0213875_10051748
480 Ga0207692_10082979
481 Ga0207645_10016150
482 Ga0207705_10021431
483 Ga0207684_10010618
484 Ga0207684_10047513
485 Ga0207654_10074858
486 Ga0207707_10002870
487 Ga0207707_10125819
488 Ga0207695_10005503
489 Ga0207695_10062081
490 Ga0207671_10257803
491 Ga0207693_10002694
492 Ga0207663_10139694
493 Ga0207663_10444477
494 Ga0207662_10015068
495 Ga0207662_10115452
496 Ga0207657_10007196
497 Ga0207649_10188840
498 Ga0207652_10110152
499 Ga0207646_10141477
500 Ga0207681_10463704
501 Ga0207694_10002109
502 Ga0207694_10007542
503 Ga0207694_10056740
504 Ga0207694_10178587
505 Ga0207694_10241217
506 Ga0207659_10367912
507 Ga0207687_10013704
508 Ga0207687_10081154
509 Ga0207687_10099692
510 Ga0207700_10038337
511 Ga0207700_10052435
512 Ga0207644_10058387
513 Ga0207686_10037027
514 Ga0207686_10072726
515 Ga0207686_10085483
516 Ga0207686_10092122
517 Ga0207686_10373081
518 Ga0207709_10157533
519 Ga0207670_10107273
520 Ga0207670_10247597
521 Ga0207670_10429776
522 Ga0207669_10355703
523 Ga0207691_10009237
524 Ga0207691_10178376
525 Ga0207711_10002964
526 Ga0207711_10173624
527 Ga0207689_10076809
528 Ga0207689_10112504
529 Ga0207661_10211819
530 Ga0207667_10010701
531 Ga0207667_10011058
532 Ga0207651_10002065
533 Ga0207651_10006724
534 Ga0207712_10113664
535 Ga0207677_10159599
536 Ga0207677_10394513
537 Ga0207703_10019814
538 Ga0207703_10033430
539 Ga0207703_10830421
540 Ga0207639_10074500
541 Ga0207708_10008869
542 Ga0207702_10013155
543 Ga0207702_10256055
544 Ga0207641_10191531
545 Ga0207648_10082416
546 Ga0207683_10311582
547 Ga0268265_10249240
548 Ga0268264_10278152
549 Ga0265325_10108867
550 Ga0265313_10011929
551 Ga0265313_10129762
552 Ga0265314_10002183
553 Ga0265314_10023989
554 Ga0373934_0048300
555 Ga0373953_0065856
556 Ga0373953_0077089
557 Ga0373954_0005283
558 Ga0373956_0037817
559 Ga0373957_0072946
560 Ga0373943_0148588
561 Ga0373946_0137814
562 Ga0373955_0004645
563 Ga0373955_0019924
564 Ga0373955_0039448
565 Ga0373961_0075521
566 Ga0373935_0062559
567 Ga0373935_0177962
568 Ga0373935_0319627
569 Ga0373927_0146482
570 Ga0373933_0025957
571 Ga0373933_0098982
572 Ga0373933_0121899
573 Ga0373933_0248608
574 Ga0373947_0095327
575 Ga0373947_0132018
576 Ga0373937_0000642
577 Ga0373937_0015831
578 Ga0373937_0022753
579 Ga0373937_0137780
580 Ga0373937_0153829
581 Ga0373937_0288502
582 Ga0373937_0526016
583 Ga0373925_0015512
584 Ga0373925_0054351
585 Ga0373925_0340613
586 Ga0436364_0776161
587 Ga0436364_0788891
588 Ga0436364_1314924
589 Ga0436364_1357371
590 Ga0395901_0475547
591 Ga0436365_0827980
592 Ga0436365_1270899
593 Ga0436362_0071506
594 Ga0451576_0167518
595 Ga0495629_0282213
596 Ga0495651_0036654
597 Ga0495653_0127546
598 Ga0495580_0004429
599 Ga0495580_0326604
600 Ga0495580_0368431
601 Ga0495608_0058759
602 Ga0495608_0236686
603 Ga0495608_0255660
604 Ga0495628_0393818
605 Ga0495630_0218237
606 Ga0495652_0019881
607 Ga0495665_0066495
608 Ga0495586_0054796
609 Ga0495587_0035798
610 Ga0495645_0030773
611 Ga0495667_0036496
612 Ga0495667_0095582
613 Ga0495667_0222697
614 Ga0495667_0373548
615 Ga0495635_0063362
616 Ga0495599_0000664
617 Ga0495599_0304887
618 Ga0495623_0438562
619 Ga0495613_0065861
620 Ga0495600_0128951
621 Ga0495674_0135691
622 Ga0495680_0031295
623 Ga0495680_0725497
624 Ga0495675_0341082
625 Ga0495684_0064165
626 Ga0495684_0183830
627 Ga0495684_0225666
628 Ga0495684_0541151
629 Ga0495602_0002396
630 Ga0496113_0000006
631 Ga0496115_0566945
632 Ga0501031_0007117
633 Ga0501032_0012616
634 Ga0501036_0000271
635 Ga0501037_0010024
636 Ga0501038_0003836
637 Ga0501039_0006530
638 Ga0501043_0003169
639 Ga0501046_0001715
640 Ga0501047_0470177
641 Ga0501048_0021073
642 Ga0501067_0084797
643 Ga0501068_0000546
644 Ga0501069_0000350
645 Ga0501072_0006853
646 Ga0501073_0000765
647 Ga0501077_0026917
648 Ga0501079_0172898
649 Ga0501080_0005676
650 Ga0501083_0009263
651 Ga0501035_0126324
652 Ga0501045_0121780
653 nmdc:mga05p37_55178_c1
654 nmdc:mga09592_767517_c1
655 nmdc:mga06r32_24800_c1
656 nmdc:mga06r32_829235_c1
657 nmdc:mga08y16_571168_c1
658 Ga0495595_0112035
659 Ga0495619_0221076
660 Ga0500568_0078394
661 Ga0501084_0017062
662 Ga0501082_0027385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

6

115

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.975 1 118
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9722 3 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9715 3 118
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9708 1 121
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9706 3 118
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9807 3 79 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9757 1 79 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9713 3 83 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9695 1 120 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9695 1 77 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3L7SVK7-F1-model_v4 DNA-binding response regulator 0.8222 2 224 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1H9CR76-F1-model_v4 Stage 0 sporulation protein A homolog 0.8187 1 225 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1H9CR76-F1-model_v4 Stage 0 sporulation protein A homolog 0.8154 1 225 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7Y9MWZ9-F1-model_v4 DNA-binding response OmpR family regulator 0.8065 1 223 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2T6LGT8-F1-model_v4 Two-component system OmpR family response regulator 0.8019 2 223 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map