F410372

General Info

Members Datasets Scaffolds Average Seq Length
331 214 662 133

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100387235|Ga0070683_1003872352
Length 148
Sequence MSDHVSSLHPNVRFSRFVFRLAAFVGLVEVVPLYFSEGVISRTLPPAITHPEFYYGFIGVVVAWQIAYLLISEDPVRYYPLFPAVFLEKLLYPAALAILSIGGRVQSPAVLLGGAIDLVLLTLFIAAWVKLSKVPADPWAIASASRWW

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
193 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
194 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
199 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
202 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.11
Rhizosphere 96.68
Stem 0
Stem Tuber 0
Unclassified 29.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100387235 3300005329 Bacteria 1332
2 SwRhRL3b_contig_135704 2162886006 Bacteria 1853
3 SwRhRL2b_contig_1242406 2162886007 Bacteria 5390
4 Ga0065704_10071794 3300005289 Bacteria 9917
5 Ga0065715_10226863 3300005293 Bacteria 1249
6 Ga0065715_10865327 3300005293 Unclassified 586
7 Ga0065707_10000547 3300005295 Bacteria 25445
8 Ga0065707_10361272 3300005295 Bacteria 903
9 Ga0070676_10008129 3300005328 Bacteria 5644
10 Ga0070683_100267534 3300005329 Bacteria 1626
11 Ga0070690_100223869 3300005330 Bacteria 1319
12 Ga0070690_100336721 3300005330 Bacteria 1091
13 Ga0068869_100017240 3300005334 Bacteria 4891
14 Ga0070680_100019375 3300005336 Bacteria 5391
15 Ga0070680_100153569 3300005336 Unclassified 1933
16 Ga0070680_100387937 3300005336 Bacteria 1190
17 Ga0070689_100118789 3300005340 Bacteria 2110
18 Ga0070691_10163978 3300005341 Bacteria 1147
19 Ga0070669_100080659 3300005353 Archaea 2422
20 Ga0070674_100148412 3300005356 Bacteria 1767
21 Ga0070709_10220394 3300005434 Bacteria 1353
22 Ga0070709_10350360 3300005434 Bacteria 1091
23 Ga0070709_10964623 3300005434 Unclassified 677
24 Ga0070714_101733187 3300005435 Bacteria 610
25 Ga0070714_102514368 3300005435 Bacteria 500
26 Ga0070713_100077907 3300005436 Bacteria 2820
27 Ga0070713_100303510 3300005436 Bacteria 1470
28 Ga0070713_100728627 3300005436 Unclassified 948
29 Ga0070710_10748906 3300005437 Unclassified 694
30 Ga0070700_100072982 3300005441 Unclassified 2196
31 Ga0070694_100214443 3300005444 Bacteria 1441
32 Ga0070694_100493524 3300005444 Bacteria 973
33 Ga0070662_100047163 3300005457 Bacteria 3098
34 Ga0070681_10104647 3300005458 Bacteria 2772
35 Ga0070681_10202191 3300005458 Bacteria 1904
36 Ga0070681_10323510 3300005458 Bacteria 1452
37 Ga0070681_10425781 3300005458 Unclassified 1239
38 Ga0068867_100336764 3300005459 Bacteria 1255
39 Ga0070698_100066477 3300005471 Bacteria 3628
40 Ga0070698_101101283 3300005471 Bacteria 743
41 Ga0070699_100223292 3300005518 Bacteria 1679
42 Ga0070684_100007482 3300005535 Bacteria 8494
43 Ga0070697_100003964 3300005536 Bacteria 11371
44 Ga0070672_100577587 3300005543 Unclassified 978
45 Ga0070672_100788963 3300005543 Unclassified 835
46 Ga0070686_101043276 3300005544 Bacteria 672
47 Ga0070686_101829719 3300005544 Unclassified 517
48 Ga0070695_100055313 3300005545 Bacteria 2557
49 Ga0070696_100942284 3300005546 Bacteria 718
50 Ga0070665_100001149 3300005548 Bacteria 32554
51 Ga0068855_100012208 3300005563 Bacteria 10384
52 Ga0068855_100164250 3300005563 Bacteria 2518
53 Ga0070664_101309446 3300005564 Unclassified 684
54 Ga0070664_102032535 3300005564 Bacteria 545
55 Ga0068854_100282563 3300005578 Bacteria 1337
56 Ga0068852_100403862 3300005616 Bacteria 1344
57 Ga0068859_100184757 3300005617 Bacteria 2168
58 Ga0068859_100708656 3300005617 Bacteria 1097
59 Ga0068864_100364562 3300005618 Bacteria 1366
60 Ga0068866_10075200 3300005718 Bacteria 1798
61 Ga0068861_100072885 3300005719 Bacteria 2666
62 Ga0068861_100671776 3300005719 Bacteria 959
63 Ga0068870_10118953 3300005840 Unclassified 1519
64 Ga0068863_100749663 3300005841 Unclassified 972
65 Ga0068858_100310248 3300005842 Bacteria 1506
66 Ga0068858_100357057 3300005842 Bacteria 1400
67 Ga0068862_100050974 3300005844 Unclassified 3539
68 Ga0070717_10271819 3300006028 Bacteria 1501
69 Ga0070717_10494750 3300006028 Bacteria 1105
70 Ga0070716_100232223 3300006173 Bacteria 1246
71 Ga0070716_100427182 3300006173 Unclassified 960
72 Ga0070716_101395503 3300006173 Unclassified 569
73 Ga0075428_100001312 3300006844 Bacteria 26332
74 Ga0075428_100008337 3300006844 Bacteria 11489
75 Ga0075428_100024417 3300006844 Bacteria 6689
76 Ga0075430_100026314 3300006846 Bacteria 4950
77 Ga0075430_100057471 3300006846 Bacteria 3272
78 Ga0075430_100890171 3300006846 Unclassified 733
79 Ga0075430_101106940 3300006846 Unclassified 652
80 Ga0075431_100000002 3300006847 Bacteria 153069
81 Ga0075431_100115941 3300006847 Bacteria 2765
82 Ga0075433_10000242 3300006852 Bacteria 31475
83 Ga0075433_10623696 3300006852 Unclassified 946
84 Ga0075434_100778793 3300006871 Bacteria 973
85 Ga0075429_100011383 3300006880 Bacteria 7704
86 Ga0075429_100053503 3300006880 Unclassified 3513
87 Ga0075429_100171694 3300006880 Bacteria 1899
88 Ga0075429_101068806 3300006880 Bacteria 705
89 Ga0068865_100042390 3300006881 Bacteria 3103
90 Ga0068865_102093884 3300006881 Unclassified 514
91 Ga0097620_100184755 3300006931 Bacteria 2168
92 Ga0097620_100708542 3300006931 Bacteria 1097
93 Ga0105240_10008209 3300009093 Bacteria 14964
94 Ga0105240_10084441 3300009093 Bacteria 3893
95 Ga0105240_10154201 3300009093 Bacteria 2734
96 Ga0105240_10685585 3300009093 Bacteria 1120
97 Ga0111539_10031766 3300009094 Bacteria 6415
98 Ga0111539_10040005 3300009094 Bacteria 5646
99 Ga0111539_10058522 3300009094 Unclassified 4572
100 Ga0105245_10076069 3300009098 Unclassified 3057
101 Ga0105247_10294836 3300009101 Bacteria 1123
102 Ga0114129_10002358 3300009147 Bacteria 26209
103 Ga0114129_10081690 3300009147 Bacteria 4492
104 Ga0114129_10142229 3300009147 Bacteria 3288
105 Ga0114129_10544423 3300009147 Bacteria 1510
106 Ga0114129_12328380 3300009147 Unclassified 642
107 Ga0105242_10881718 3300009176 Unclassified 893
108 Ga0105248_10006236 3300009177 Bacteria 13071
109 Ga0105248_11018023 3300009177 Unclassified 936
110 Ga0105237_10200245 3300009545 Bacteria 1996
111 Ga0105237_11465203 3300009545 Unclassified 689
112 Ga0105237_11492453 3300009545 Unclassified 683
113 Ga0105238_10016644 3300009551 Bacteria 7448
114 Ga0105249_10211297 3300009553 Bacteria 1904
115 Ga0105249_11976131 3300009553 Unclassified 656
116 Ga0105239_10123543 3300010375 Bacteria 2876
117 Ga0105239_10678644 3300010375 Unclassified 1177
118 Ga0105246_10240993 3300011119 Bacteria 1429
119 Ga0105246_10318985 3300011119 Unclassified 1262
120 Ga0157370_10095408 3300013104 Bacteria 2790
121 Ga0157370_11148137 3300013104 Bacteria 701
122 Ga0157369_10088976 3300013105 Bacteria 3296
123 Ga0157369_10149856 3300013105 Bacteria 2465
124 Ga0157374_10071430 3300013296 Bacteria 3273
125 Ga0157378_11436855 3300013297 Unclassified 733
126 Ga0157378_12441975 3300013297 Unclassified 575
127 Ga0163162_10160730 3300013306 Bacteria 2368
128 Ga0157372_10068009 3300013307 Bacteria 4005
129 Ga0157372_10125052 3300013307 Bacteria 2956
130 Ga0157372_10368480 3300013307 Bacteria 1674
131 Ga0157375_10014395 3300013308 Bacteria 7054
132 Ga0157380_10244314 3300014326 Bacteria 1620
133 Ga0157376_10395486 3300014969 Bacteria 1335
134 Ga0157376_10543881 3300014969 Bacteria 1148
135 Ga0213875_10340196 3300021388 Unclassified 712
136 Ga0207642_10120989 3300025899 Unclassified 1350
137 Ga0207710_10176209 3300025900 Bacteria 1047
138 Ga0207645_10013189 3300025907 Bacteria 5578
139 Ga0207643_10159833 3300025908 Bacteria 1355
140 Ga0207707_10358262 3300025912 Unclassified 1256
141 Ga0207707_10728682 3300025912 Unclassified 831
142 Ga0207695_10010454 3300025913 Bacteria 11349
143 Ga0207695_10025077 3300025913 Bacteria 6688
144 Ga0207695_10401094 3300025913 Bacteria 1256
145 Ga0207671_10650739 3300025914 Unclassified 839
146 Ga0207671_10804377 3300025914 Unclassified 745
147 Ga0207671_11354352 3300025914 Unclassified 553
148 Ga0207693_10103418 3300025915 Bacteria 2234
149 Ga0207693_11248779 3300025915 Unclassified 558
150 Ga0207663_11159899 3300025916 Bacteria 622
151 Ga0207660_10089657 3300025917 Bacteria 2276
152 Ga0207660_10213310 3300025917 Bacteria 1512
153 Ga0207662_10014359 3300025918 Bacteria 4442
154 Ga0207646_10050626 3300025922 Bacteria 3716
155 Ga0207681_10037607 3300025923 Archaea 3200
156 Ga0207681_10662556 3300025923 Bacteria 866
157 Ga0207694_10086678 3300025924 Bacteria 2466
158 Ga0207694_10958493 3300025924 Bacteria 724
159 Ga0207687_10002758 3300025927 Bacteria 11910
160 Ga0207700_10051864 3300025928 Bacteria 3064
161 Ga0207700_10154126 3300025928 Bacteria 1902
162 Ga0207700_10261224 3300025928 Bacteria 1483
163 Ga0207700_10386688 3300025928 Bacteria 1224
164 Ga0207700_11455929 3300025928 Unclassified 608
165 Ga0207700_11858771 3300025928 Unclassified 528
166 Ga0207664_11202394 3300025929 Bacteria 676
167 Ga0207664_11472567 3300025929 Bacteria 602
168 Ga0207644_10044799 3300025931 Bacteria 3145
169 Ga0207706_10003646 3300025933 Bacteria 14712
170 Ga0207686_11348008 3300025934 Bacteria 586
171 Ga0207670_10083473 3300025936 Unclassified 2241
172 Ga0207704_10014146 3300025938 Bacteria 4020
173 Ga0207665_10109044 3300025939 Bacteria 1943
174 Ga0207665_10340220 3300025939 Bacteria 1131
175 Ga0207711_10002742 3300025941 Bacteria 15525
176 Ga0207689_10042646 3300025942 Bacteria 3752
177 Ga0207661_10471210 3300025944 Unclassified 1145
178 Ga0207679_11845574 3300025945 Bacteria 552
179 Ga0207667_10034924 3300025949 Bacteria 5396
180 Ga0207667_10041502 3300025949 Bacteria 4893
181 Ga0207712_10100675 3300025961 Bacteria 2147
182 Ga0207712_11325873 3300025961 Unclassified 643
183 Ga0207668_11666088 3300025972 Bacteria 576
184 Ga0207640_10953527 3300025981 Unclassified 752
185 Ga0207677_10027633 3300026023 Bacteria 3577
186 Ga0207703_10181392 3300026035 Bacteria 1858
187 Ga0207703_10294975 3300026035 Bacteria 1477
188 Ga0207678_10559477 3300026067 Unclassified 1001
189 Ga0207708_10025201 3300026075 Unclassified 4499
190 Ga0207641_10417177 3300026088 Bacteria 1292
191 Ga0207648_10636549 3300026089 Unclassified 985
192 Ga0207676_10161273 3300026095 Bacteria 1943
193 Ga0207675_100050360 3300026118 Unclassified 3886
194 Ga0207675_100741814 3300026118 Unclassified 993
195 Ga0207675_100893361 3300026118 Bacteria 905
196 Ga0207698_10967632 3300026142 Bacteria 861
197 Ga0207698_12322640 3300026142 Unclassified 548
198 Ga0207428_10058773 3300027907 Bacteria 3050
199 Ga0268266_10002752 3300028379 Bacteria 18379
200 Ga0268265_10068948 3300028380 Bacteria 2745
201 Ga0265338_10411966 3300028800 Unclassified 962
202 Ga0265339_10184348 3300031249 Unclassified 1038
203 Ga0307408_100027308 3300031548 Bacteria 3932
204 Ga0307408_100042717 3300031548 Bacteria 3222
205 Ga0307408_100084180 3300031548 Bacteria 2385
206 Ga0307408_100466796 3300031548 Bacteria 1098
207 Ga0307408_100593318 3300031548 Bacteria 983
208 Ga0307405_10165033 3300031731 Bacteria 1573
209 Ga0307405_10367120 3300031731 Bacteria 1116
210 Ga0307413_10380644 3300031824 Bacteria 1099
211 Ga0307410_10004352 3300031852 Bacteria 7307
212 Ga0307410_10036199 3300031852 Bacteria 3212
213 Ga0307410_10430882 3300031852 Unclassified 1072
214 Ga0307406_10179988 3300031901 Unclassified 1538
215 Ga0307412_11531528 3300031911 Unclassified 607
216 Ga0307416_100254408 3300032002 Bacteria 1712
217 Ga0307416_100753781 3300032002 Bacteria 1066
218 Ga0307416_101823140 3300032002 Unclassified 712
219 Ga0307416_101857640 3300032002 Bacteria 706
220 Ga0307414_10074403 3300032004 Bacteria 2461
221 Ga0307411_10077006 3300032005 Unclassified 2282
222 Ga0307411_10338432 3300032005 Bacteria 1222
223 Ga0373930_0111928 3300034816 Bacteria 658
224 Ga0373934_0004816 3300035086 Bacteria 4992
225 Ga0373940_0011398 3300035088 Bacteria 2110
226 Ga0373923_0048138 3300035111 Bacteria 1779
227 Ga0373953_0013086 3300035117 Bacteria 2954
228 Ga0373956_0024983 3300035119 Bacteria 2579
229 Ga0373956_0100662 3300035119 Unclassified 1340
230 Ga0373957_0138477 3300035120 Unclassified 994
231 Ga0373955_0039108 3300035172 Unclassified 2530
232 Ga0373955_0101393 3300035172 Bacteria 1653
233 Ga0373955_0789478 3300035172 Unclassified 584
234 Ga0373935_0042951 3300035692 Bacteria 2844
235 Ga0373935_0050481 3300035692 Bacteria 2640
236 Ga0373927_0043676 3300035695 Unclassified 2901
237 Ga0373933_0118653 3300035724 Unclassified 1655
238 Ga0373933_0213181 3300035724 Unclassified 1238
239 Ga0373947_1262212 3300035725 Unclassified 503
240 Ga0373937_0000027 3300036401 Bacteria 123975
241 Ga0373937_0075305 3300036401 Bacteria 3115
242 Ga0373937_0344439 3300036401 Unclassified 1411
243 Ga0373925_0001738 3300037068 Bacteria 18280
244 Ga0395898_1712531 3300037466 Unclassified 551
245 Ga0436364_0831802 3300037853 Bacteria 1179
246 Ga0436365_0264327 3300039437 Bacteria 1129
247 Ga0451797_1485801 3300041453 Bacteria 1250
248 Ga0439448_0103134 3300042005 Bacteria 971
249 Ga0439460_0014231 3300042461 Bacteria 2090
250 Ga0439460_0082673 3300042461 Bacteria 1010
251 Ga0453683_0347058 3300044673 Bacteria 953
252 Ga0451576_0066002 3300045051 Unclassified 3768
253 Ga0451576_0289626 3300045051 Bacteria 1712
254 Ga0495592_0050114 3300046454 Unclassified 3103
255 Ga0495629_0107636 3300046459 Bacteria 1945
256 Ga0495651_0007979 3300046462 Bacteria 8116
257 Ga0495651_0056442 3300046462 Unclassified 3017
258 Ga0495651_0610356 3300046462 Unclassified 687
259 Ga0495653_0002773 3300046463 Bacteria 13970
260 Ga0495580_0052839 3300046472 Bacteria 2869
261 Ga0495582_0083778 3300046473 Bacteria 1772
262 Ga0495664_0006821 3300046477 Bacteria 6319
263 Ga0495594_0145210 3300046499 Bacteria 1346
264 Ga0495608_0294422 3300046511 Unclassified 1005
265 Ga0495618_0111340 3300046514 Bacteria 1753
266 Ga0495628_0054455 3300046516 Unclassified 3154
267 Ga0495630_0074301 3300046517 Bacteria 2560
268 Ga0495652_0033055 3300046529 Unclassified 4519
269 Ga0495665_0056856 3300046531 Bacteria 2065
270 Ga0495640_0313927 3300046533 Bacteria 972
271 Ga0495586_0173315 3300046535 Bacteria 1219
272 Ga0495587_0127978 3300046536 Unclassified 1452
273 Ga0495645_0030037 3300046543 Bacteria 3958
274 Ga0495645_0395307 3300046543 Bacteria 882
275 Ga0495667_0007331 3300046559 Bacteria 7481
276 Ga0495668_0000832 3300046616 Bacteria 35100
277 Ga0495635_0330811 3300046663 Unclassified 1019
278 Ga0495657_0085725 3300046675 Unclassified 2030
279 Ga0495599_0006311 3300046678 Bacteria 7144
280 Ga0495599_0326460 3300046678 Bacteria 923
281 Ga0495646_0073969 3300046680 Unclassified 2001
282 Ga0495646_0218151 3300046680 Bacteria 1033
283 Ga0495658_0228015 3300046683 Bacteria 1168
284 Ga0495669_0275611 3300046684 Unclassified 809
285 Ga0495613_0259988 3300046689 Bacteria 1210
286 Ga0495581_0142591 3300047315 Bacteria 1398
287 Ga0495604_0017602 3300047317 Bacteria 5721
288 Ga0495674_0271879 3300047319 Bacteria 1390
289 Ga0495674_0630958 3300047319 Unclassified 846
290 Ga0495680_0100454 3300047322 Unclassified 2156
291 Ga0495675_0019228 3300047444 Unclassified 4339
292 Ga0495684_0006228 3300047471 Bacteria 9271
293 Ga0495602_0056523 3300048088 Unclassified 3450
294 Ga0495602_0130144 3300048088 Bacteria 2008
295 Ga0496102_0321088 3300048905 Bacteria 1459
296 Ga0496104_0268160 3300048907 Unclassified 1620
297 Ga0496104_0522313 3300048907 Unclassified 1098
298 Ga0496105_0003500 3300048908 Bacteria 11630
299 Ga0496110_0006234 3300048913 Bacteria 9402
300 Ga0496111_0000546 3300048914 Bacteria 19480
301 Ga0501295_050019 3300049518 Bacteria 892
302 Ga0501298_021218 3300049521 Bacteria 1216
303 Ga0501299_046462 3300049522 Unclassified 886
304 Ga0501033_0017419 3300049570 Bacteria 5427
305 Ga0501039_1334309 3300049575 Unclassified 553
306 Ga0501076_0435880 3300049592 Bacteria 1079
307 Ga0501236_065507 3300049670 Unclassified 654
308 Ga0501250_066252 3300049680 Bacteria 587
309 Ga0501081_0493230 3300049743 Unclassified 912
310 Ga0501266_060515 3300049763 Bacteria 605
311 Ga0501268_000453 3300049765 Bacteria 4439
312 Ga0501035_0298162 3300049822 Bacteria 1359
313 nmdc:mga05p37_1103497_c1 3300050507 Unclassified 830
314 nmdc:mga05p37_156815_c1 3300050507 Bacteria 2781
315 nmdc:mga05p37_21757_c1 3300050507 Bacteria 7768
316 nmdc:mga05p37_48776_c1 3300050507 Bacteria 5207
317 nmdc:mga05p37_746973_c1 3300050507 Unclassified 1079
318 nmdc:mga09592_18409_c1 3300050508 Bacteria 5729
319 nmdc:mga09592_364930_c1 3300050508 Unclassified 1249
320 nmdc:mga0qj67_1097645_c1 3300050509 Unclassified 622
321 nmdc:mga0qj67_750395_c1 3300050509 Unclassified 774
322 nmdc:mga0qj67_95551_c1 3300050509 Bacteria 2392
323 nmdc:mga06r32_2500_c1 3300050510 Bacteria 16445
324 nmdc:mga06r32_351327_c1 3300050510 Unclassified 1459
325 nmdc:mga08y16_1230_c1 3300050511 Bacteria 25334
326 nmdc:mga0rr50_729473_c1 3300050513 Bacteria 846
327 nmdc:mga0a205_7_c1 3300050515 Bacteria 129537
328 Ga0495601_0246561 3300053077 Bacteria 1166
329 Ga0495595_0077203 3300053084 Bacteria 1582
330 Ga0495619_0026072 3300053085 Unclassified 3759
331 3005716067 3005710791 Bacteria 7622528
332 Ga0070683_100387235
333 SwRhRL3b_contig_135704
334 SwRhRL2b_contig_1242406
335 Ga0065704_10071794
336 Ga0065715_10226863
337 Ga0065715_10865327
338 Ga0065707_10000547
339 Ga0065707_10361272
340 Ga0070676_10008129
341 Ga0070683_100267534
342 Ga0070690_100223869
343 Ga0070690_100336721
344 Ga0068869_100017240
345 Ga0070680_100019375
346 Ga0070680_100153569
347 Ga0070680_100387937
348 Ga0070689_100118789
349 Ga0070691_10163978
350 Ga0070669_100080659
351 Ga0070674_100148412
352 Ga0070709_10220394
353 Ga0070709_10350360
354 Ga0070709_10964623
355 Ga0070714_101733187
356 Ga0070714_102514368
357 Ga0070713_100077907
358 Ga0070713_100303510
359 Ga0070713_100728627
360 Ga0070710_10748906
361 Ga0070700_100072982
362 Ga0070694_100214443
363 Ga0070694_100493524
364 Ga0070662_100047163
365 Ga0070681_10104647
366 Ga0070681_10202191
367 Ga0070681_10323510
368 Ga0070681_10425781
369 Ga0068867_100336764
370 Ga0070698_100066477
371 Ga0070698_101101283
372 Ga0070699_100223292
373 Ga0070684_100007482
374 Ga0070697_100003964
375 Ga0070672_100577587
376 Ga0070672_100788963
377 Ga0070686_101043276
378 Ga0070686_101829719
379 Ga0070695_100055313
380 Ga0070696_100942284
381 Ga0070665_100001149
382 Ga0068855_100012208
383 Ga0068855_100164250
384 Ga0070664_101309446
385 Ga0070664_102032535
386 Ga0068854_100282563
387 Ga0068852_100403862
388 Ga0068859_100184757
389 Ga0068859_100708656
390 Ga0068864_100364562
391 Ga0068866_10075200
392 Ga0068861_100072885
393 Ga0068861_100671776
394 Ga0068870_10118953
395 Ga0068863_100749663
396 Ga0068858_100310248
397 Ga0068858_100357057
398 Ga0068862_100050974
399 Ga0070717_10271819
400 Ga0070717_10494750
401 Ga0070716_100232223
402 Ga0070716_100427182
403 Ga0070716_101395503
404 Ga0075428_100001312
405 Ga0075428_100008337
406 Ga0075428_100024417
407 Ga0075430_100026314
408 Ga0075430_100057471
409 Ga0075430_100890171
410 Ga0075430_101106940
411 Ga0075431_100000002
412 Ga0075431_100115941
413 Ga0075433_10000242
414 Ga0075433_10623696
415 Ga0075434_100778793
416 Ga0075429_100011383
417 Ga0075429_100053503
418 Ga0075429_100171694
419 Ga0075429_101068806
420 Ga0068865_100042390
421 Ga0068865_102093884
422 Ga0097620_100184755
423 Ga0097620_100708542
424 Ga0105240_10008209
425 Ga0105240_10084441
426 Ga0105240_10154201
427 Ga0105240_10685585
428 Ga0111539_10031766
429 Ga0111539_10040005
430 Ga0111539_10058522
431 Ga0105245_10076069
432 Ga0105247_10294836
433 Ga0114129_10002358
434 Ga0114129_10081690
435 Ga0114129_10142229
436 Ga0114129_10544423
437 Ga0114129_12328380
438 Ga0105242_10881718
439 Ga0105248_10006236
440 Ga0105248_11018023
441 Ga0105237_10200245
442 Ga0105237_11465203
443 Ga0105237_11492453
444 Ga0105238_10016644
445 Ga0105249_10211297
446 Ga0105249_11976131
447 Ga0105239_10123543
448 Ga0105239_10678644
449 Ga0105246_10240993
450 Ga0105246_10318985
451 Ga0157370_10095408
452 Ga0157370_11148137
453 Ga0157369_10088976
454 Ga0157369_10149856
455 Ga0157374_10071430
456 Ga0157378_11436855
457 Ga0157378_12441975
458 Ga0163162_10160730
459 Ga0157372_10068009
460 Ga0157372_10125052
461 Ga0157372_10368480
462 Ga0157375_10014395
463 Ga0157380_10244314
464 Ga0157376_10395486
465 Ga0157376_10543881
466 Ga0213875_10340196
467 Ga0207642_10120989
468 Ga0207710_10176209
469 Ga0207645_10013189
470 Ga0207643_10159833
471 Ga0207707_10358262
472 Ga0207707_10728682
473 Ga0207695_10010454
474 Ga0207695_10025077
475 Ga0207695_10401094
476 Ga0207671_10650739
477 Ga0207671_10804377
478 Ga0207671_11354352
479 Ga0207693_10103418
480 Ga0207693_11248779
481 Ga0207663_11159899
482 Ga0207660_10089657
483 Ga0207660_10213310
484 Ga0207662_10014359
485 Ga0207646_10050626
486 Ga0207681_10037607
487 Ga0207681_10662556
488 Ga0207694_10086678
489 Ga0207694_10958493
490 Ga0207687_10002758
491 Ga0207700_10051864
492 Ga0207700_10154126
493 Ga0207700_10261224
494 Ga0207700_10386688
495 Ga0207700_11455929
496 Ga0207700_11858771
497 Ga0207664_11202394
498 Ga0207664_11472567
499 Ga0207644_10044799
500 Ga0207706_10003646
501 Ga0207686_11348008
502 Ga0207670_10083473
503 Ga0207704_10014146
504 Ga0207665_10109044
505 Ga0207665_10340220
506 Ga0207711_10002742
507 Ga0207689_10042646
508 Ga0207661_10471210
509 Ga0207679_11845574
510 Ga0207667_10034924
511 Ga0207667_10041502
512 Ga0207712_10100675
513 Ga0207712_11325873
514 Ga0207668_11666088
515 Ga0207640_10953527
516 Ga0207677_10027633
517 Ga0207703_10181392
518 Ga0207703_10294975
519 Ga0207678_10559477
520 Ga0207708_10025201
521 Ga0207641_10417177
522 Ga0207648_10636549
523 Ga0207676_10161273
524 Ga0207675_100050360
525 Ga0207675_100741814
526 Ga0207675_100893361
527 Ga0207698_10967632
528 Ga0207698_12322640
529 Ga0207428_10058773
530 Ga0268266_10002752
531 Ga0268265_10068948
532 Ga0265338_10411966
533 Ga0265339_10184348
534 Ga0307408_100027308
535 Ga0307408_100042717
536 Ga0307408_100084180
537 Ga0307408_100466796
538 Ga0307408_100593318
539 Ga0307405_10165033
540 Ga0307405_10367120
541 Ga0307413_10380644
542 Ga0307410_10004352
543 Ga0307410_10036199
544 Ga0307410_10430882
545 Ga0307406_10179988
546 Ga0307412_11531528
547 Ga0307416_100254408
548 Ga0307416_100753781
549 Ga0307416_101823140
550 Ga0307416_101857640
551 Ga0307414_10074403
552 Ga0307411_10077006
553 Ga0307411_10338432
554 Ga0373930_0111928
555 Ga0373934_0004816
556 Ga0373940_0011398
557 Ga0373923_0048138
558 Ga0373953_0013086
559 Ga0373956_0024983
560 Ga0373956_0100662
561 Ga0373957_0138477
562 Ga0373955_0039108
563 Ga0373955_0101393
564 Ga0373955_0789478
565 Ga0373935_0042951
566 Ga0373935_0050481
567 Ga0373927_0043676
568 Ga0373933_0118653
569 Ga0373933_0213181
570 Ga0373947_1262212
571 Ga0373937_0000027
572 Ga0373937_0075305
573 Ga0373937_0344439
574 Ga0373925_0001738
575 Ga0395898_1712531
576 Ga0436364_0831802
577 Ga0436365_0264327
578 Ga0451797_1485801
579 Ga0439448_0103134
580 Ga0439460_0014231
581 Ga0439460_0082673
582 Ga0453683_0347058
583 Ga0451576_0066002
584 Ga0451576_0289626
585 Ga0495592_0050114
586 Ga0495629_0107636
587 Ga0495651_0007979
588 Ga0495651_0056442
589 Ga0495651_0610356
590 Ga0495653_0002773
591 Ga0495580_0052839
592 Ga0495582_0083778
593 Ga0495664_0006821
594 Ga0495594_0145210
595 Ga0495608_0294422
596 Ga0495618_0111340
597 Ga0495628_0054455
598 Ga0495630_0074301
599 Ga0495652_0033055
600 Ga0495665_0056856
601 Ga0495640_0313927
602 Ga0495586_0173315
603 Ga0495587_0127978
604 Ga0495645_0030037
605 Ga0495645_0395307
606 Ga0495667_0007331
607 Ga0495668_0000832
608 Ga0495635_0330811
609 Ga0495657_0085725
610 Ga0495599_0006311
611 Ga0495599_0326460
612 Ga0495646_0073969
613 Ga0495646_0218151
614 Ga0495658_0228015
615 Ga0495669_0275611
616 Ga0495613_0259988
617 Ga0495581_0142591
618 Ga0495604_0017602
619 Ga0495674_0271879
620 Ga0495674_0630958
621 Ga0495680_0100454
622 Ga0495675_0019228
623 Ga0495684_0006228
624 Ga0495602_0056523
625 Ga0495602_0130144
626 Ga0496102_0321088
627 Ga0496104_0268160
628 Ga0496104_0522313
629 Ga0496105_0003500
630 Ga0496110_0006234
631 Ga0496111_0000546
632 Ga0501295_050019
633 Ga0501298_021218
634 Ga0501299_046462
635 Ga0501033_0017419
636 Ga0501039_1334309
637 Ga0501076_0435880
638 Ga0501236_065507
639 Ga0501250_066252
640 Ga0501081_0493230
641 Ga0501266_060515
642 Ga0501268_000453
643 Ga0501035_0298162
644 nmdc:mga05p37_1103497_c1
645 nmdc:mga05p37_156815_c1
646 nmdc:mga05p37_21757_c1
647 nmdc:mga05p37_48776_c1
648 nmdc:mga05p37_746973_c1
649 nmdc:mga09592_18409_c1
650 nmdc:mga09592_364930_c1
651 nmdc:mga0qj67_1097645_c1
652 nmdc:mga0qj67_750395_c1
653 nmdc:mga0qj67_95551_c1
654 nmdc:mga06r32_2500_c1
655 nmdc:mga06r32_351327_c1
656 nmdc:mga08y16_1230_c1
657 nmdc:mga0rr50_729473_c1
658 nmdc:mga0a205_7_c1
659 Ga0495601_0246561
660 Ga0495595_0077203
661 Ga0495619_0026072
662 3005716067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jic-assembly1.cif.gz_B structure of human cd19-cd81 co-receptor complex bound to coltuximab fab fragment 0.6347 5 123
5gn8-assembly1.cif.gz_B structure of a 48-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.5699 1 67
8esv-assembly1.cif.gz_B structure of human adam10-tspan15 complex bound to 11g2 vfab 0.566 1 95
7jic-assembly1.cif.gz_B structure of human cd19-cd81 co-receptor complex bound to coltuximab fab fragment 0.5566 5 123
6k4j-assembly1.cif.gz_A crystal structure of the the cd9 0.4771 2 95
ID Description Score Start End Superfamily
af_O80594_2_109_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7738 9 108 1.20.1280.290
af_Q552F9_2_110_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7331 7 91 1.20.120.550
af_O80594_2_109_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7199 9 108 1.20.1280.290
af_B6U3K5_11_118_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7074 9 108 1.20.1280.290
af_Q54I19_2_110_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6898 9 112 1.20.120.550
ID Description Score Start End GO Terms
AF-L7VTJ4-F1-model_v4 Uncharacterized protein 0.9576 6 122 GO:0016020
AF-D2R0R7-F1-model_v4 Uncharacterized protein 0.9569 2 124 GO:0016020
AF-A0A7W8JE21-F1-model_v4 Uncharacterized protein 0.9517 6 125 GO:0016020
AF-A0A7W0M6W1-F1-model_v4 Uncharacterized protein 0.9513 4 122 GO:0016020
AF-A0A5B9Q5Z1-F1-model_v4 Uncharacterized protein 0.9454 1 127 GO:0016020

Map