F410363

General Info

Members Datasets Scaffolds Average Seq Length
331 151 662 161

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10045028|Ga0065715_100450282
Length 152
Sequence MTPAIDPPLLAVEPSYRHVLRARLALTWXPLAIAXSVADRVLLGATPFYGVASIAAVVIPQRKFRRLSYGLTDRMLRSVHGWMFRIDTIVPFVRVQHLDVTRGPLDKMFGTASLVVHTAGTHNSVVCVHGLAPDRAAEIRDVIREHVRSDFE

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
110 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
111 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
112 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
113 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
114 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
115 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
135 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
136 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
137 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
138 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
139 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
140 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
141 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
142 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
143 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
144 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
145 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
146 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
147 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
148 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
149 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
150 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
151 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.81
Rhizosphere 97.89
Stem 0
Stem Tuber 0
Unclassified 3.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10045028 3300005293 Bacteria 1358
2 rootH1_10159020 3300003323 Bacteria 1200
3 Ga0065712_10361479 3300005290 Bacteria 774
4 Ga0065715_10097189 3300005293 Bacteria 3741
5 Ga0065715_10271891 3300005293 Bacteria 1109
6 Ga0070658_10731228 3300005327 Bacteria 859
7 Ga0070676_10088159 3300005328 Bacteria 1895
8 Ga0070670_100008814 3300005331 Bacteria 8610
9 Ga0070670_100061783 3300005331 Bacteria 3216
10 Ga0070670_100114569 3300005331 Bacteria 2324
11 Ga0070677_10032419 3300005333 Bacteria 2004
12 Ga0070677_10170813 3300005333 Bacteria 1027
13 Ga0070680_100005269 3300005336 Bacteria 9779
14 Ga0070682_100085509 3300005337 Bacteria 2052
15 Ga0070660_100026734 3300005339 Bacteria 4300
16 Ga0070689_100391901 3300005340 Bacteria 1172
17 Ga0070687_100017775 3300005343 Bacteria 3278
18 Ga0070661_100038082 3300005344 Bacteria 3500
19 Ga0070661_100741039 3300005344 Bacteria 803
20 Ga0070668_100077807 3300005347 Bacteria 2593
21 Ga0070669_100027526 3300005353 Bacteria 4091
22 Ga0070669_100043963 3300005353 Bacteria 3255
23 Ga0070675_100039637 3300005354 Bacteria 3845
24 Ga0070674_100001493 3300005356 Bacteria 12459
25 Ga0070673_100017375 3300005364 Bacteria 5113
26 Ga0070659_100012977 3300005366 Bacteria 6196
27 Ga0070659_100101265 3300005366 Bacteria 2319
28 Ga0070659_101075360 3300005366 Bacteria 708
29 Ga0070667_100022812 3300005367 Bacteria 5190
30 Ga0070701_10019350 3300005438 Bacteria 3215
31 Ga0070700_100010959 3300005441 Bacteria 5015
32 Ga0070663_100014869 3300005455 Bacteria 5006
33 Ga0070663_100403232 3300005455 Bacteria 1118
34 Ga0070678_100187721 3300005456 Bacteria 1697
35 Ga0070662_100015355 3300005457 Bacteria 5127
36 Ga0070681_10344891 3300005458 Bacteria 1399
37 Ga0068867_100085144 3300005459 Bacteria 2389
38 Ga0068867_100306748 3300005459 Bacteria 1310
39 Ga0068853_100084898 3300005539 Bacteria 2775
40 Ga0068853_100145257 3300005539 Bacteria 2131
41 Ga0070672_100015943 3300005543 Bacteria 5367
42 Ga0070672_100021579 3300005543 Bacteria 4716
43 Ga0070696_100017998 3300005546 Bacteria 4772
44 Ga0070693_100184274 3300005547 Bacteria 1346
45 Ga0070664_100013349 3300005564 Bacteria 6690
46 Ga0070664_100162823 3300005564 Bacteria 1975
47 Ga0070664_100281806 3300005564 Bacteria 1499
48 Ga0068857_100002619 3300005577 Bacteria 14771
49 Ga0068857_101046324 3300005577 Unclassified 787
50 Ga0068854_100006270 3300005578 Bacteria 7557
51 Ga0068852_100298069 3300005616 Bacteria 1560
52 Ga0068859_100064496 3300005617 Bacteria 3695
53 Ga0068859_100345025 3300005617 Bacteria 1583
54 Ga0068864_100019553 3300005618 Bacteria 5665
55 Ga0068864_100143178 3300005618 Bacteria 2158
56 Ga0068864_100621584 3300005618 Bacteria 1050
57 Ga0068861_100391542 3300005719 Bacteria 1231
58 Ga0068863_100036458 3300005841 Bacteria 4684
59 Ga0068858_100016987 3300005842 Bacteria 6832
60 Ga0068860_100033752 3300005843 Bacteria 4910
61 Ga0068862_100003421 3300005844 Bacteria 13670
62 Ga0068862_100005226 3300005844 Bacteria 10895
63 Ga0068871_100507126 3300006358 Bacteria 1088
64 Ga0097620_100064501 3300006931 Bacteria 3695
65 Ga0097620_100345027 3300006931 Bacteria 1583
66 Ga0105241_10098904 3300009174 Bacteria 2315
67 Ga0105248_10218026 3300009177 Bacteria 2149
68 Ga0105238_12152373 3300009551 Bacteria 592
69 Ga0105249_10371888 3300009553 Bacteria 1453
70 Ga0157373_10030827 3300013100 Bacteria 3858
71 Ga0157373_10155384 3300013100 Bacteria 1609
72 Ga0157373_10248833 3300013100 Bacteria 1257
73 Ga0157373_10456348 3300013100 Unclassified 920
74 Ga0157371_10037986 3300013102 Bacteria 3445
75 Ga0157369_10098145 3300013105 Bacteria 3125
76 Ga0163162_10060515 3300013306 Bacteria 3822
77 Ga0163162_10757247 3300013306 Bacteria 1090
78 Ga0163163_12469940 3300014325 Bacteria 578
79 Ga0157380_10052109 3300014326 Bacteria 3239
80 Ga0157380_11416724 3300014326 Unclassified 746
81 Ga0157377_10178967 3300014745 Bacteria 1332
82 Ga0157379_10188272 3300014968 Bacteria 1865
83 Ga0207697_10010020 3300025315 Bacteria 4071
84 Ga0207682_10058160 3300025893 Bacteria 1613
85 Ga0207682_10075816 3300025893 Bacteria 1432
86 Ga0207688_10311151 3300025901 Bacteria 965
87 Ga0207645_10026991 3300025907 Bacteria 3710
88 Ga0207705_10070256 3300025909 Bacteria 2537
89 Ga0207654_10060006 3300025911 Bacteria 2221
90 Ga0207707_10213099 3300025912 Bacteria 1682
91 Ga0207657_10042370 3300025919 Bacteria 4017
92 Ga0207649_10104502 3300025920 Bacteria 1881
93 Ga0207649_10273348 3300025920 Bacteria 1226
94 Ga0207652_10288699 3300025921 Bacteria 1480
95 Ga0207650_10063415 3300025925 Bacteria 2763
96 Ga0207650_10201656 3300025925 Bacteria 1594
97 Ga0207659_10041804 3300025926 Bacteria 3211
98 Ga0207659_10307390 3300025926 Bacteria 1304
99 Ga0207690_10302788 3300025932 Bacteria 1251
100 Ga0207706_10022340 3300025933 Bacteria 5677
101 Ga0207706_10023938 3300025933 Bacteria 5478
102 Ga0207670_10332353 3300025936 Bacteria 1199
103 Ga0207691_10003700 3300025940 Bacteria 14833
104 Ga0207691_10020354 3300025940 Bacteria 6271
105 Ga0207679_10249213 3300025945 Bacteria 1509
106 Ga0207679_10251271 3300025945 Bacteria 1503
107 Ga0207679_11201590 3300025945 Bacteria 696
108 Ga0207712_10035051 3300025961 Bacteria 3405
109 Ga0207668_10002917 3300025972 Bacteria 10035
110 Ga0207640_10027580 3300025981 Bacteria 3462
111 Ga0207640_10053633 3300025981 Bacteria 2633
112 Ga0207703_10014437 3300026035 Bacteria 6159
113 Ga0207639_10207023 3300026041 Bacteria 1686
114 Ga0207678_10008745 3300026067 Bacteria 8913
115 Ga0207678_10063537 3300026067 Bacteria 3173
116 Ga0207708_10110966 3300026075 Bacteria 2129
117 Ga0207641_10069829 3300026088 Bacteria 3017
118 Ga0207648_10116660 3300026089 Bacteria 2346
119 Ga0207676_10018287 3300026095 Bacteria 5092
120 Ga0207676_10291174 3300026095 Bacteria 1487
121 Ga0207674_10003237 3300026116 Bacteria 20044
122 Ga0207674_10143554 3300026116 Bacteria 2346
123 Ga0207675_100315083 3300026118 Bacteria 1526
124 Ga0207683_10051290 3300026121 Bacteria 3615
125 Ga0207698_10654253 3300026142 Bacteria 1041
126 Ga0209974_10030525 3300027876 Bacteria 1786
127 Ga0268265_10005941 3300028380 Bacteria 8311
128 Ga0268265_10070015 3300028380 Bacteria 2726
129 Ga0268264_10067945 3300028381 Bacteria 3010
130 Ga0268264_10207015 3300028381 Bacteria 1798
131 Ga0307408_100008693 3300031548 Bacteria 6706
132 Ga0307408_100038599 3300031548 Bacteria 3370
133 Ga0307408_100131621 3300031548 Bacteria 1952
134 Ga0307408_100135651 3300031548 Bacteria 1925
135 Ga0307408_100206208 3300031548 Bacteria 1594
136 Ga0307405_10038059 3300031731 Bacteria 2896
137 Ga0307405_10043788 3300031731 Bacteria 2733
138 Ga0307405_10046590 3300031731 Bacteria 2665
139 Ga0307405_10048321 3300031731 Unclassified 2623
140 Ga0307405_10049772 3300031731 Bacteria 2592
141 Ga0307405_10098610 3300031731 Bacteria 1954
142 Ga0307405_10174206 3300031731 Bacteria 1538
143 Ga0307405_10821263 3300031731 Bacteria 780
144 Ga0307413_10019319 3300031824 Bacteria 3597
145 Ga0307413_10032450 3300031824 Bacteria 2960
146 Ga0307413_10037594 3300031824 Bacteria 2797
147 Ga0307413_10048776 3300031824 Bacteria 2533
148 Ga0307413_10051962 3300031824 Bacteria 2472
149 Ga0307413_10056184 3300031824 Unclassified 2399
150 Ga0307413_10056796 3300031824 Bacteria 2390
151 Ga0307413_10267768 3300031824 Bacteria 1277
152 Ga0307413_10326629 3300031824 Bacteria 1174
153 Ga0307410_10000580 3300031852 Bacteria 15026
154 Ga0307410_10004405 3300031852 Bacteria 7276
155 Ga0307410_10004794 3300031852 Bacteria 7060
156 Ga0307410_10005709 3300031852 Bacteria 6628
157 Ga0307410_10014161 3300031852 Bacteria 4681
158 Ga0307410_10023909 3300031852 Bacteria 3809
159 Ga0307410_10034912 3300031852 Bacteria 3262
160 Ga0307410_10076999 3300031852 Bacteria 2330
161 Ga0307410_10165254 3300031852 Bacteria 1662
162 Ga0307410_10175342 3300031852 Bacteria 1619
163 Ga0307410_10350452 3300031852 Bacteria 1179
164 Ga0307410_10832495 3300031852 Bacteria 787
165 Ga0307410_11102191 3300031852 Bacteria 688
166 Ga0307410_11182932 3300031852 Unclassified 665
167 Ga0326468_10006079 3300031889 Bacteria 1108
168 Ga0307406_10003339 3300031901 Bacteria 8747
169 Ga0307406_10031047 3300031901 Bacteria 3250
170 Ga0307406_10068738 3300031901 Bacteria 2313
171 Ga0307406_10092125 3300031901 Bacteria 2043
172 Ga0307406_10149410 3300031901 Bacteria 1665
173 Ga0307406_10192551 3300031901 Bacteria 1494
174 Ga0307406_10453838 3300031901 Bacteria 1029
175 Ga0307407_10002249 3300031903 Bacteria 7464
176 Ga0307407_10013453 3300031903 Bacteria 3972
177 Ga0307407_10022931 3300031903 Bacteria 3248
178 Ga0307407_10065949 3300031903 Bacteria 2134
179 Ga0307407_10097134 3300031903 Bacteria 1820
180 Ga0307407_10114458 3300031903 Bacteria 1699
181 Ga0307407_10114822 3300031903 Bacteria 1697
182 Ga0307407_10187029 3300031903 Bacteria 1377
183 Ga0307407_10296034 3300031903 Bacteria 1126
184 Ga0307407_10499269 3300031903 Bacteria 891
185 Ga0307407_10575932 3300031903 Bacteria 835
186 Ga0307407_10635260 3300031903 Bacteria 798
187 Ga0307412_10030621 3300031911 Bacteria 3390
188 Ga0307412_10078304 3300031911 Bacteria 2276
189 Ga0307412_10089869 3300031911 Bacteria 2145
190 Ga0307412_10134058 3300031911 Bacteria 1804
191 Ga0307412_10138617 3300031911 Bacteria 1778
192 Ga0307412_10187245 3300031911 Bacteria 1562
193 Ga0307412_10351402 3300031911 Bacteria 1184
194 Ga0307412_10796455 3300031911 Bacteria 820
195 Ga0307412_10822198 3300031911 Bacteria 808
196 Ga0307412_10963197 3300031911 Bacteria 752
197 Ga0307409_100019446 3300031995 Bacteria 4599
198 Ga0307409_100069700 3300031995 Bacteria 2788
199 Ga0307409_100071646 3300031995 Bacteria 2756
200 Ga0307409_100100545 3300031995 Bacteria 2397
201 Ga0307409_100110556 3300031995 Bacteria 2303
202 Ga0307409_100124564 3300031995 Bacteria 2189
203 Ga0307409_100165031 3300031995 Bacteria 1942
204 Ga0307409_100302573 3300031995 Bacteria 1488
205 Ga0307409_100360229 3300031995 Bacteria 1375
206 Ga0307409_100475286 3300031995 Bacteria 1211
207 Ga0307409_100553563 3300031995 Bacteria 1129
208 Ga0307409_100780135 3300031995 Bacteria 962
209 Ga0307409_101165367 3300031995 Bacteria 793
210 Ga0307409_101311884 3300031995 Bacteria 749
211 Ga0307409_101383659 3300031995 Unclassified 730
212 Ga0307409_101600719 3300031995 Bacteria 679
213 Ga0307416_100003860 3300032002 Bacteria 8919
214 Ga0307416_100004977 3300032002 Bacteria 8103
215 Ga0307416_100075784 3300032002 Bacteria 2816
216 Ga0307416_100100386 3300032002 Bacteria 2517
217 Ga0307416_100217945 3300032002 Bacteria 1827
218 Ga0307416_100385930 3300032002 Bacteria 1432
219 Ga0307416_100389551 3300032002 Bacteria 1427
220 Ga0307416_100431114 3300032002 Bacteria 1365
221 Ga0307416_100602199 3300032002 Bacteria 1179
222 Ga0307416_101132441 3300032002 Bacteria 887
223 Ga0307416_101375324 3300032002 Bacteria 812
224 Ga0307416_102304889 3300032002 Bacteria 639
225 Ga0307414_10009910 3300032004 Bacteria 5496
226 Ga0307414_10018601 3300032004 Bacteria 4283
227 Ga0307414_10020951 3300032004 Bacteria 4087
228 Ga0307414_10023753 3300032004 Bacteria 3894
229 Ga0307414_10071313 3300032004 Bacteria 2505
230 Ga0307414_10095680 3300032004 Bacteria 2220
231 Ga0307414_10099110 3300032004 Bacteria 2188
232 Ga0307414_10100966 3300032004 Bacteria 2171
233 Ga0307414_10118813 3300032004 Bacteria 2028
234 Ga0307414_10130404 3300032004 Bacteria 1950
235 Ga0307414_10238522 3300032004 Bacteria 1504
236 Ga0307414_10244006 3300032004 Bacteria 1489
237 Ga0307414_10331645 3300032004 Bacteria 1299
238 Ga0307414_10371340 3300032004 Bacteria 1234
239 Ga0307414_10538908 3300032004 Bacteria 1038
240 Ga0307414_10901434 3300032004 Bacteria 811
241 Ga0307414_11550875 3300032004 Bacteria 617
242 Ga0307411_10000517 3300032005 Bacteria 13586
243 Ga0307411_10001764 3300032005 Bacteria 9132
244 Ga0307411_10015565 3300032005 Bacteria 4276
245 Ga0307411_10025029 3300032005 Bacteria 3568
246 Ga0307411_10028886 3300032005 Bacteria 3378
247 Ga0307411_10052547 3300032005 Bacteria 2664
248 Ga0307411_10106389 3300032005 Bacteria 1997
249 Ga0307411_10116664 3300032005 Bacteria 1922
250 Ga0307411_10141871 3300032005 Bacteria 1772
251 Ga0307411_10175573 3300032005 Bacteria 1620
252 Ga0307411_10187872 3300032005 Bacteria 1574
253 Ga0307411_10231515 3300032005 Bacteria 1440
254 Ga0307411_10383230 3300032005 Bacteria 1157
255 Ga0307411_10757821 3300032005 Bacteria 851
256 Ga0307411_10980545 3300032005 Bacteria 755
257 Ga0307415_100001798 3300032126 Bacteria 10497
258 Ga0307415_100012285 3300032126 Bacteria 4945
259 Ga0307415_100020357 3300032126 Bacteria 4051
260 Ga0307415_100057634 3300032126 Bacteria 2670
261 Ga0307415_100079626 3300032126 Bacteria 2334
262 Ga0307415_100080497 3300032126 Bacteria 2324
263 Ga0307415_100252878 3300032126 Bacteria 1433
264 Ga0307415_100258845 3300032126 Bacteria 1418
265 Ga0307415_100288466 3300032126 Bacteria 1353
266 Ga0307415_100478730 3300032126 Bacteria 1083
267 Ga0307415_101942556 3300032126 Bacteria 572
268 Ga0395899_0008492 3300037312 Bacteria 7912
269 Ga0395900_0139855 3300037418 Bacteria 2479
270 Ga0395900_0726125 3300037418 Bacteria 925
271 Ga0395898_0457295 3300037466 Bacteria 1215
272 Ga0395898_0941888 3300037466 Unclassified 801
273 Ga0395905_0040883 3300037471 Bacteria 4350
274 Ga0395905_0179173 3300037471 Bacteria 1989
275 Ga0395905_0425305 3300037471 Bacteria 1224
276 Ga0395905_0805680 3300037471 Unclassified 842
277 Ga0395901_0208764 3300038443 Bacteria 2045
278 Ga0451802_0537818 3300041460 Bacteria 752
279 Ga0439445_0000395 3300042004 Bacteria 8825
280 Ga0439445_0016010 3300042004 Bacteria 1841
281 Ga0439432_015987 3300042006 Bacteria 2528
282 Ga0439432_100422 3300042006 Bacteria 866
283 Ga0439449_0065626 3300042007 Bacteria 1339
284 Ga0439457_191190 3300042014 Bacteria 502
285 Ga0450909_066757 3300042185 Bacteria 573
286 Ga0439464_0134827 3300042439 Unclassified 766
287 Ga0466967_0532672 3300045976 Bacteria 1155
288 Ga0495585_0070776 3300046492 Bacteria 1902
289 Ga0495663_0003048 3300046525 Bacteria 4906
290 Ga0495598_0001198 3300046537 Bacteria 5023
291 Ga0495621_0000192 3300046539 Bacteria 14020
292 Ga0495633_0030600 3300046558 Bacteria 2613
293 Ga0495669_0008310 3300046684 Bacteria 4360
294 Ga0495669_0074897 3300046684 Bacteria 1548
295 Ga0495670_0013909 3300046691 Bacteria 3958
296 Ga0495670_0587903 3300046691 Bacteria 606
297 Ga0495677_0008161 3300047445 Bacteria 3889
298 Ga0496108_0757893 3300048911 Bacteria 839
299 Ga0496109_0742490 3300048912 Bacteria 919
300 Ga0496110_0220129 3300048913 Bacteria 1726
301 Ga0496111_0132655 3300048914 Bacteria 1844
302 Ga0496114_0379712 3300048917 Bacteria 1251
303 Ga0501302_015325 3300049525 Bacteria 609
304 Ga0501071_0339654 3300049587 Bacteria 1142
305 Ga0501071_1030997 3300049587 Bacteria 636
306 Ga0501073_0165806 3300049589 Bacteria 1530
307 Ga0501074_0603996 3300049590 Bacteria 776
308 Ga0501201_020177 3300049651 Bacteria 702
309 Ga0501209_221465 3300049656 Unclassified 586
310 Ga0501224_050351 3300049664 Bacteria 638
311 Ga0501227_057276 3300049665 Bacteria 993
312 Ga0501235_018148 3300049669 Bacteria 1558
313 Ga0501235_036606 3300049669 Bacteria 1116
314 Ga0501235_047164 3300049669 Bacteria 993
315 Ga0501239_014399 3300049672 Bacteria 915
316 Ga0501240_065087 3300049673 Bacteria 650
317 Ga0501247_029492 3300049677 Bacteria 744
318 Ga0501249_015638 3300049679 Bacteria 1624
319 Ga0501249_050922 3300049679 Bacteria 951
320 Ga0501257_107444 3300049686 Bacteria 737
321 Ga0501258_017322 3300049687 Bacteria 821
322 Ga0501260_021220 3300049689 Bacteria 705
323 Ga0501221_005713 3300049704 Bacteria 2088
324 Ga0501263_016263 3300049760 Bacteria 967
325 Ga0501268_001367 3300049765 Bacteria 3029
326 Ga0501268_011199 3300049765 Bacteria 1411
327 Ga0501268_019126 3300049765 Bacteria 1157
328 Ga0501272_031043 3300049769 Bacteria 679
329 Ga0501273_065148 3300049770 Bacteria 581
330 Ga0501204_010215 3300049850 Bacteria 1097
331 Ga0501204_012951 3300049850 Bacteria 1008
332 Ga0065715_10045028
333 rootH1_10159020
334 Ga0065712_10361479
335 Ga0065715_10097189
336 Ga0065715_10271891
337 Ga0070658_10731228
338 Ga0070676_10088159
339 Ga0070670_100008814
340 Ga0070670_100061783
341 Ga0070670_100114569
342 Ga0070677_10032419
343 Ga0070677_10170813
344 Ga0070680_100005269
345 Ga0070682_100085509
346 Ga0070660_100026734
347 Ga0070689_100391901
348 Ga0070687_100017775
349 Ga0070661_100038082
350 Ga0070661_100741039
351 Ga0070668_100077807
352 Ga0070669_100027526
353 Ga0070669_100043963
354 Ga0070675_100039637
355 Ga0070674_100001493
356 Ga0070673_100017375
357 Ga0070659_100012977
358 Ga0070659_100101265
359 Ga0070659_101075360
360 Ga0070667_100022812
361 Ga0070701_10019350
362 Ga0070700_100010959
363 Ga0070663_100014869
364 Ga0070663_100403232
365 Ga0070678_100187721
366 Ga0070662_100015355
367 Ga0070681_10344891
368 Ga0068867_100085144
369 Ga0068867_100306748
370 Ga0068853_100084898
371 Ga0068853_100145257
372 Ga0070672_100015943
373 Ga0070672_100021579
374 Ga0070696_100017998
375 Ga0070693_100184274
376 Ga0070664_100013349
377 Ga0070664_100162823
378 Ga0070664_100281806
379 Ga0068857_100002619
380 Ga0068857_101046324
381 Ga0068854_100006270
382 Ga0068852_100298069
383 Ga0068859_100064496
384 Ga0068859_100345025
385 Ga0068864_100019553
386 Ga0068864_100143178
387 Ga0068864_100621584
388 Ga0068861_100391542
389 Ga0068863_100036458
390 Ga0068858_100016987
391 Ga0068860_100033752
392 Ga0068862_100003421
393 Ga0068862_100005226
394 Ga0068871_100507126
395 Ga0097620_100064501
396 Ga0097620_100345027
397 Ga0105241_10098904
398 Ga0105248_10218026
399 Ga0105238_12152373
400 Ga0105249_10371888
401 Ga0157373_10030827
402 Ga0157373_10155384
403 Ga0157373_10248833
404 Ga0157373_10456348
405 Ga0157371_10037986
406 Ga0157369_10098145
407 Ga0163162_10060515
408 Ga0163162_10757247
409 Ga0163163_12469940
410 Ga0157380_10052109
411 Ga0157380_11416724
412 Ga0157377_10178967
413 Ga0157379_10188272
414 Ga0207697_10010020
415 Ga0207682_10058160
416 Ga0207682_10075816
417 Ga0207688_10311151
418 Ga0207645_10026991
419 Ga0207705_10070256
420 Ga0207654_10060006
421 Ga0207707_10213099
422 Ga0207657_10042370
423 Ga0207649_10104502
424 Ga0207649_10273348
425 Ga0207652_10288699
426 Ga0207650_10063415
427 Ga0207650_10201656
428 Ga0207659_10041804
429 Ga0207659_10307390
430 Ga0207690_10302788
431 Ga0207706_10022340
432 Ga0207706_10023938
433 Ga0207670_10332353
434 Ga0207691_10003700
435 Ga0207691_10020354
436 Ga0207679_10249213
437 Ga0207679_10251271
438 Ga0207679_11201590
439 Ga0207712_10035051
440 Ga0207668_10002917
441 Ga0207640_10027580
442 Ga0207640_10053633
443 Ga0207703_10014437
444 Ga0207639_10207023
445 Ga0207678_10008745
446 Ga0207678_10063537
447 Ga0207708_10110966
448 Ga0207641_10069829
449 Ga0207648_10116660
450 Ga0207676_10018287
451 Ga0207676_10291174
452 Ga0207674_10003237
453 Ga0207674_10143554
454 Ga0207675_100315083
455 Ga0207683_10051290
456 Ga0207698_10654253
457 Ga0209974_10030525
458 Ga0268265_10005941
459 Ga0268265_10070015
460 Ga0268264_10067945
461 Ga0268264_10207015
462 Ga0307408_100008693
463 Ga0307408_100038599
464 Ga0307408_100131621
465 Ga0307408_100135651
466 Ga0307408_100206208
467 Ga0307405_10038059
468 Ga0307405_10043788
469 Ga0307405_10046590
470 Ga0307405_10048321
471 Ga0307405_10049772
472 Ga0307405_10098610
473 Ga0307405_10174206
474 Ga0307405_10821263
475 Ga0307413_10019319
476 Ga0307413_10032450
477 Ga0307413_10037594
478 Ga0307413_10048776
479 Ga0307413_10051962
480 Ga0307413_10056184
481 Ga0307413_10056796
482 Ga0307413_10267768
483 Ga0307413_10326629
484 Ga0307410_10000580
485 Ga0307410_10004405
486 Ga0307410_10004794
487 Ga0307410_10005709
488 Ga0307410_10014161
489 Ga0307410_10023909
490 Ga0307410_10034912
491 Ga0307410_10076999
492 Ga0307410_10165254
493 Ga0307410_10175342
494 Ga0307410_10350452
495 Ga0307410_10832495
496 Ga0307410_11102191
497 Ga0307410_11182932
498 Ga0326468_10006079
499 Ga0307406_10003339
500 Ga0307406_10031047
501 Ga0307406_10068738
502 Ga0307406_10092125
503 Ga0307406_10149410
504 Ga0307406_10192551
505 Ga0307406_10453838
506 Ga0307407_10002249
507 Ga0307407_10013453
508 Ga0307407_10022931
509 Ga0307407_10065949
510 Ga0307407_10097134
511 Ga0307407_10114458
512 Ga0307407_10114822
513 Ga0307407_10187029
514 Ga0307407_10296034
515 Ga0307407_10499269
516 Ga0307407_10575932
517 Ga0307407_10635260
518 Ga0307412_10030621
519 Ga0307412_10078304
520 Ga0307412_10089869
521 Ga0307412_10134058
522 Ga0307412_10138617
523 Ga0307412_10187245
524 Ga0307412_10351402
525 Ga0307412_10796455
526 Ga0307412_10822198
527 Ga0307412_10963197
528 Ga0307409_100019446
529 Ga0307409_100069700
530 Ga0307409_100071646
531 Ga0307409_100100545
532 Ga0307409_100110556
533 Ga0307409_100124564
534 Ga0307409_100165031
535 Ga0307409_100302573
536 Ga0307409_100360229
537 Ga0307409_100475286
538 Ga0307409_100553563
539 Ga0307409_100780135
540 Ga0307409_101165367
541 Ga0307409_101311884
542 Ga0307409_101383659
543 Ga0307409_101600719
544 Ga0307416_100003860
545 Ga0307416_100004977
546 Ga0307416_100075784
547 Ga0307416_100100386
548 Ga0307416_100217945
549 Ga0307416_100385930
550 Ga0307416_100389551
551 Ga0307416_100431114
552 Ga0307416_100602199
553 Ga0307416_101132441
554 Ga0307416_101375324
555 Ga0307416_102304889
556 Ga0307414_10009910
557 Ga0307414_10018601
558 Ga0307414_10020951
559 Ga0307414_10023753
560 Ga0307414_10071313
561 Ga0307414_10095680
562 Ga0307414_10099110
563 Ga0307414_10100966
564 Ga0307414_10118813
565 Ga0307414_10130404
566 Ga0307414_10238522
567 Ga0307414_10244006
568 Ga0307414_10331645
569 Ga0307414_10371340
570 Ga0307414_10538908
571 Ga0307414_10901434
572 Ga0307414_11550875
573 Ga0307411_10000517
574 Ga0307411_10001764
575 Ga0307411_10015565
576 Ga0307411_10025029
577 Ga0307411_10028886
578 Ga0307411_10052547
579 Ga0307411_10106389
580 Ga0307411_10116664
581 Ga0307411_10141871
582 Ga0307411_10175573
583 Ga0307411_10187872
584 Ga0307411_10231515
585 Ga0307411_10383230
586 Ga0307411_10757821
587 Ga0307411_10980545
588 Ga0307415_100001798
589 Ga0307415_100012285
590 Ga0307415_100020357
591 Ga0307415_100057634
592 Ga0307415_100079626
593 Ga0307415_100080497
594 Ga0307415_100252878
595 Ga0307415_100258845
596 Ga0307415_100288466
597 Ga0307415_100478730
598 Ga0307415_101942556
599 Ga0395899_0008492
600 Ga0395900_0139855
601 Ga0395900_0726125
602 Ga0395898_0457295
603 Ga0395898_0941888
604 Ga0395905_0040883
605 Ga0395905_0179173
606 Ga0395905_0425305
607 Ga0395905_0805680
608 Ga0395901_0208764
609 Ga0451802_0537818
610 Ga0439445_0000395
611 Ga0439445_0016010
612 Ga0439432_015987
613 Ga0439432_100422
614 Ga0439449_0065626
615 Ga0439457_191190
616 Ga0450909_066757
617 Ga0439464_0134827
618 Ga0466967_0532672
619 Ga0495585_0070776
620 Ga0495663_0003048
621 Ga0495598_0001198
622 Ga0495621_0000192
623 Ga0495633_0030600
624 Ga0495669_0008310
625 Ga0495669_0074897
626 Ga0495670_0013909
627 Ga0495670_0587903
628 Ga0495677_0008161
629 Ga0496108_0757893
630 Ga0496109_0742490
631 Ga0496110_0220129
632 Ga0496111_0132655
633 Ga0496114_0379712
634 Ga0501302_015325
635 Ga0501071_0339654
636 Ga0501071_1030997
637 Ga0501073_0165806
638 Ga0501074_0603996
639 Ga0501201_020177
640 Ga0501209_221465
641 Ga0501224_050351
642 Ga0501227_057276
643 Ga0501235_018148
644 Ga0501235_036606
645 Ga0501235_047164
646 Ga0501239_014399
647 Ga0501240_065087
648 Ga0501247_029492
649 Ga0501249_015638
650 Ga0501249_050922
651 Ga0501257_107444
652 Ga0501258_017322
653 Ga0501260_021220
654 Ga0501221_005713
655 Ga0501263_016263
656 Ga0501268_001367
657 Ga0501268_011199
658 Ga0501268_019126
659 Ga0501272_031043
660 Ga0501273_065148
661 Ga0501204_010215
662 Ga0501204_012951

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03703

bPH_2

Bacterial PH domain

64

143

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tvv-assembly1.cif.gz_A structure of the tandem ph domains of rtt106 (residues 68-315) 0.8249 73 156
3to1-assembly1.cif.gz_A two surfaces on rtt106 mediate histone binding and chaperone activity 0.8001 73 149
7xti-assembly1.cif.gz_k rna polymerase ii elongation complex transcribing a nucleosome (ec58hex) 0.7915 73 152
2yf0-assembly1.cif.gz_A-2 human myotubularin related protein 6 (mtmr6) 0.7631 73 153
2adz-assembly1.cif.gz_A solution structure of the joined ph domain of alpha1-syntrophin 0.7531 93 153
ID Description Score Start End Superfamily
af_Q2FWI4_74_150_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8888 70 147 2.30.29.30
af_O33222_395_466_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8854 71 142 2.30.29.30
af_O33222_62_143_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8791 70 148 2.30.29.30
af_O33222_395_466_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8631 71 142 2.30.29.30
af_Q2FWI4_74_150_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8577 70 147 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A255I271-F1-model_v4 YdbS-like PH domain-containing protein 0.9143 6 155 GO:0016020
AF-A0A7D5KBE8-F1-model_v4 PH domain-containing protein 0.9117 8 155 GO:0016020
AF-A0A2E6N6A1-F1-model_v4 YdbS-like PH domain-containing protein 0.9108 8 155 GO:0016020
AF-A0A316Q353-F1-model_v4 YdbS-like PH domain-containing protein 0.9079 3 155 GO:0016020
AF-A0A3D2CHR4-F1-model_v4 YdbS-like PH domain-containing protein 0.9032 6 149 GO:0016020

Map