F410325

General Info

Members Datasets Scaffolds Average Seq Length
330 246 660 500

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2997600082|2997608643
Length 574
Sequence TPERLTGPGRTAPRPGSAEGIPGRWLALSVLILAVLLVAVDATVLGLATPYLSEDLEPTGNQLLWIGDVYSFVIAGLLVSMGSLGDRIGRKKLLLVGATAFGGLSVLAAYATSPEMLIATRALLGVAGATLMPSTLALIRNLFPDPKERSVAIGIWGAAASAGAAVGPVVGGFLLEHFWWGSVFLINLPVMAVLVLVGVRLLPESKNPDPGPWDLPSVGLSLVGMIGVVYCVKELASHNTGGVAIAAGIAGVLSLLVFVRRQLTLRTPLLDMRLFQHRGFSGAVLADLLTILGLSGLVFFLSQFLQLVQGRTPLQAGLAELPAAIGAVVAGLVAGAAARRYSVRVIVAGGLAAIGVALAALVFLDAHTGFPVLGAVLLVVGVGAGFSFTVTADVILSSVPKEQAGAASAVSETAYELGAALGIALLGSVVTGVYRGFDTPSGVPADVAAAAHESLGGAAESAADLPSGLASALLASAQESFVDGLRIACGVGAVVLLATAVGAWFLLRGQALQDGVEESEAGQLASDDGWRADGPMGRDGERDERGGDGDSRGHRAQGEHGVRPESAAEPAIRR

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
122 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
123 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
124 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
204 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
205 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
210 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
211 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
212 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
213 2643221647 Streptomyces sp. Root369 Isolate Unclassified
214 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
215 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
216 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
217 2738543013 Variovorax sp. BT01 Isolate Unclassified
218 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
219 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
220 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
221 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
222 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
223 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
224 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
225 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
226 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
227 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
228 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
229 2867369537 Streptomyces sp. Z26 Isolate Unclassified
230 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
231 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
232 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
233 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
234 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
235 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
236 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
237 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
238 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
239 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
240 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
241 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
242 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
243 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
244 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
245 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
246 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.97
Metatranscriptomes 0.61
Isolates 12.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0
Rhizoplane 0
Rhizosphere 85.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000660 3300002987 Bacteria 15290
2 JGI25406J46586_10001222 3300003203 Bacteria 12084
3 JGI25406J46586_10001641 3300003203 Bacteria 10557
4 rootH1_10001292 3300003316 Bacteria 8717
5 rootH2_10122574 3300003320 Bacteria 5889
6 JGI25160J50197_1000458 3300003354 Bacteria 25369
7 JGI25407J50210_10004084 3300003373 Archaea 3545
8 JGI25161J50226_1000335 3300003374 Bacteria 25369
9 Ga0006562J51391_1050269 3300003578 Bacteria 5840
10 Ga0006562J51391_1050271 3300003578 Bacteria 3580
11 Ga0055543_1000744 3300004625 Bacteria 16452
12 Ga0065165_1008422 3300005262 Bacteria 4828
13 Ga0065165_1014050 3300005262 Bacteria 3131
14 Ga0065707_10106630 3300005295 Bacteria 2588
15 Ga0070658_10000422 3300005327 Bacteria 36720
16 Ga0070683_100053882 3300005329 Bacteria 3728
17 Ga0070670_100051158 3300005331 Bacteria 3549
18 Ga0070680_100062981 3300005336 Bacteria 3038
19 Ga0070682_100050926 3300005337 Bacteria 2587
20 Ga0070661_100019471 3300005344 Bacteria 4838
21 Ga0070668_100052153 3300005347 Bacteria 3153
22 Ga0070675_100191085 3300005354 Bacteria 1774
23 Ga0070674_100044292 3300005356 Bacteria 3033
24 Ga0070688_100021518 3300005365 Bacteria 3768
25 Ga0070667_100017532 3300005367 Bacteria 5936
26 Ga0070700_100034428 3300005441 Bacteria 3060
27 Ga0070708_100003281 3300005445 Bacteria 12631
28 Ga0070708_100015397 3300005445 Bacteria 6316
29 Ga0070681_10085649 3300005458 Bacteria 3104
30 Ga0070681_10126877 3300005458 Bacteria 2484
31 Ga0068867_100082220 3300005459 Bacteria 2429
32 Ga0070706_100001819 3300005467 Bacteria 22099
33 Ga0070707_100028756 3300005468 Bacteria 5290
34 Ga0070698_100024303 3300005471 Bacteria 6321
35 Ga0070698_100040820 3300005471 Bacteria 4767
36 Ga0070679_100000180 3300005530 Bacteria 50879
37 Ga0070684_100030315 3300005535 Bacteria 4594
38 Ga0068853_100021840 3300005539 Bacteria 5339
39 Ga0070672_100035601 3300005543 Bacteria 3785
40 Ga0070672_100055684 3300005543 Bacteria 3099
41 Ga0070704_100064506 3300005549 Bacteria 2633
42 Ga0070664_100028008 3300005564 Bacteria 4685
43 Ga0068857_100009350 3300005577 Bacteria 8510
44 Ga0068857_100060798 3300005577 Bacteria 3355
45 Ga0068859_100215253 3300005617 Bacteria 2008
46 Ga0068861_100115359 3300005719 Bacteria 2158
47 Ga0068858_100120753 3300005842 Bacteria 2450
48 Ga0068862_100003137 3300005844 Bacteria 14377
49 Ga0068862_100037067 3300005844 Bacteria 4132
50 Ga0068862_100043733 3300005844 Bacteria 3818
51 Ga0081538_10000129 3300005981 Bacteria 77457
52 Ga0081538_10003369 3300005981 Bacteria 15129
53 Ga0081538_10008196 3300005981 Bacteria 8918
54 Ga0081538_10019693 3300005981 Bacteria 4998
55 Ga0081538_10029726 3300005981 Archaea 3726
56 Ga0081540_1009141 3300005983 Bacteria 6839
57 Ga0081539_10000197 3300005985 Bacteria 140516
58 Ga0081539_10003927 3300005985 Bacteria 17256
59 Ga0081539_10046921 3300005985 Bacteria 2472
60 Ga0081539_10053599 3300005985 Bacteria 2257
61 Ga0070717_10046508 3300006028 Bacteria 3551
62 Ga0075363_100013804 3300006048 Bacteria 3931
63 Ga0075367_10000527 3300006178 Bacteria 14449
64 Ga0075428_100008497 3300006844 Bacteria 11390
65 Ga0075428_100012378 3300006844 Bacteria 9491
66 Ga0075430_100029948 3300006846 Bacteria 4622
67 Ga0075430_100091147 3300006846 Bacteria 2549
68 Ga0075431_100016722 3300006847 Bacteria 7449
69 Ga0075431_100048489 3300006847 Bacteria 4381
70 Ga0075433_10024677 3300006852 Bacteria 5078
71 Ga0075433_10057802 3300006852 Bacteria 3391
72 Ga0075433_10145063 3300006852 Bacteria 2110
73 Ga0075434_100019189 3300006871 Bacteria 6614
74 Ga0075434_100026627 3300006871 Bacteria 5667
75 Ga0075434_100039604 3300006871 Bacteria 4670
76 Ga0075429_100054392 3300006880 Bacteria 3481
77 Ga0075429_100057945 3300006880 Bacteria 3373
78 Ga0075436_100016445 3300006914 Bacteria 5063
79 Ga0097620_100215242 3300006931 Bacteria 2008
80 Ga0075435_100046695 3300007076 Bacteria 3475
81 Ga0099794_10028465 3300007265 Bacteria 2599
82 Ga0105240_10247361 3300009093 Bacteria 2064
83 Ga0111539_10038716 3300009094 Bacteria 5754
84 Ga0114129_10003605 3300009147 Bacteria 21773
85 Ga0114129_10191750 3300009147 Bacteria 2775
86 Ga0114129_10252647 3300009147 Bacteria 2366
87 Ga0114129_10353164 3300009147 Bacteria 1947
88 Ga0105237_10004135 3300009545 Bacteria 16906
89 Ga0105237_10091622 3300009545 Bacteria 3029
90 Ga0105249_10005769 3300009553 Bacteria 10707
91 Ga0105249_10078305 3300009553 Bacteria 3067
92 Ga0105239_10087902 3300010375 Bacteria 3426
93 Ga0157369_10133283 3300013105 Bacteria 2632
94 Ga0157369_10190247 3300013105 Bacteria 2157
95 Ga0163162_10038912 3300013306 Bacteria 4749
96 Ga0157375_10151819 3300013308 Bacteria 2452
97 Ga0157380_10002881 3300014326 Bacteria 11680
98 Ga0183367_1010 3300015688 Bacteria 416164
99 Ga0163161_10000069 3300017792 Bacteria 103861
100 Ga0209130_1000202 3300025284 Bacteria 80333
101 Ga0209050_1003300 3300025298 Bacteria 12085
102 Ga0207426_1000145 3300025302 Bacteria 191065
103 Ga0207645_10023069 3300025907 Bacteria 4045
104 Ga0207684_10004385 3300025910 Bacteria 13303
105 Ga0207684_10007098 3300025910 Bacteria 10125
106 Ga0207695_10002878 3300025913 Bacteria 24964
107 Ga0207671_10002400 3300025914 Bacteria 20082
108 Ga0207693_10084894 3300025915 Bacteria 2481
109 Ga0207649_10007544 3300025920 Bacteria 5913
110 Ga0207652_10003294 3300025921 Bacteria 13369
111 Ga0207652_10009982 3300025921 Bacteria 7644
112 Ga0207652_10085299 3300025921 Bacteria 2768
113 Ga0207681_10001662 3300025923 Bacteria 14310
114 Ga0207669_10081523 3300025937 Bacteria 2073
115 Ga0207691_10002207 3300025940 Bacteria 19052
116 Ga0207691_10053771 3300025940 Bacteria 3675
117 Ga0207691_10073134 3300025940 Bacteria 3092
118 Ga0207689_10030006 3300025942 Bacteria 4534
119 Ga0207661_10017821 3300025944 Bacteria 5263
120 Ga0207679_10020738 3300025945 Bacteria 4440
121 Ga0207667_10113068 3300025949 Bacteria 2799
122 Ga0207668_10016165 3300025972 Bacteria 4652
123 Ga0207658_10005348 3300025986 Bacteria 8827
124 Ga0207648_10103744 3300026089 Bacteria 2493
125 Ga0207676_10086664 3300026095 Bacteria 2559
126 Ga0207674_10003628 3300026116 Bacteria 18823
127 Ga0207675_100029794 3300026118 Bacteria 5081
128 Ga0207428_10030635 3300027907 Bacteria 4446
129 Ga0268265_10023790 3300028380 Bacteria 4324
130 Ga0268265_10029367 3300028380 Bacteria 3945
131 Ga0268264_10133158 3300028381 Bacteria 2207
132 Ga0307512_10005170 3300030522 Bacteria 13762
133 Ga0307513_10000036 3300031456 Bacteria 180080
134 Ga0307408_100003208 3300031548 Bacteria 11253
135 Ga0307508_10012636 3300031616 Bacteria 7722
136 Ga0307518_10017452 3300031838 Bacteria 5148
137 Ga0307410_10021247 3300031852 Bacteria 3989
138 Ga0307406_10008783 3300031901 Bacteria 5650
139 Ga0307407_10087315 3300031903 Bacteria 1902
140 Ga0307507_10078420 3300033179 Bacteria 2928
141 Ga0307510_10122512 3300033180 Bacteria 2299
142 Ga0373934_0000263 3300035086 Bacteria 18839
143 Ga0373923_0003565 3300035111 Bacteria 5011
144 Ga0373956_0000793 3300035119 Bacteria 13120
145 Ga0373946_0012433 3300035171 Bacteria 3187
146 Ga0373955_0002064 3300035172 Bacteria 8656
147 Ga0373935_0000740 3300035692 Bacteria 17337
148 Ga0373927_0030185 3300035695 Bacteria 3537
149 Ga0373933_0000317 3300035724 Bacteria 31226
150 Ga0373947_0000184 3300035725 Bacteria 34389
151 Ga0373937_0000711 3300036401 Bacteria 29037
152 Ga0373925_0000532 3300037068 Bacteria 37813
153 Ga0395900_0008683 3300037418 Bacteria 10438
154 Ga0395905_0141115 3300037471 Bacteria 2266
155 Ga0436364_0064990 3300037853 Bacteria 3677
156 Ga0395901_0009608 3300038443 Bacteria 9813
157 Ga0395901_0033380 3300038443 Bacteria 5313
158 Ga0395901_0040534 3300038443 Bacteria 4824
159 Ga0451853_0061979 3300041512 Bacteria 4775
160 Ga0439455_0003711 3300042012 Bacteria 2950
161 Ga0450894_000425 3300042131 Bacteria 7213
162 Ga0450903_000167 3300042138 Bacteria 14392
163 Ga0450908_001487 3300042184 Bacteria 4549
164 Ga0451577_0000001 3300042876 Bacteria 2461803
165 Ga0466970_0001342 3300044765 Bacteria 11866
166 Ga0466957_0025659 3300044842 Bacteria 3494
167 Ga0495592_0017734 3300046454 Bacteria 5410
168 Ga0495629_0016586 3300046459 Bacteria 5288
169 Ga0495651_0001100 3300046462 Bacteria 20855
170 Ga0495653_0000346 3300046463 Bacteria 37819
171 Ga0495580_0010565 3300046472 Bacteria 7184
172 Ga0495582_0001686 3300046473 Bacteria 12471
173 Ga0495639_0000243 3300046475 Bacteria 27102
174 Ga0495662_0001437 3300046476 Bacteria 11789
175 Ga0495664_0005629 3300046477 Bacteria 6891
176 Ga0495664_0009993 3300046477 Bacteria 5323
177 Ga0495664_0048162 3300046477 Bacteria 2530
178 Ga0495594_0027171 3300046499 Bacteria 3082
179 Ga0495608_0000130 3300046511 Bacteria 53676
180 Ga0495618_0014416 3300046514 Bacteria 4817
181 Ga0495628_0001252 3300046516 Bacteria 23230
182 Ga0495630_0004421 3300046517 Bacteria 9869
183 Ga0495630_0008236 3300046517 Bacteria 7486
184 Ga0495652_0000260 3300046529 Bacteria 62378
185 Ga0495652_0024999 3300046529 Bacteria 5285
186 Ga0495665_0000033 3300046531 Bacteria 53617
187 Ga0495586_0091332 3300046535 Bacteria 1682
188 Ga0495587_0000132 3300046536 Bacteria 56457
189 Ga0495587_0010168 3300046536 Bacteria 6001
190 Ga0495645_0000956 3300046543 Bacteria 19768
191 Ga0495645_0031379 3300046543 Bacteria 3872
192 Ga0495667_0000330 3300046559 Bacteria 29916
193 Ga0495634_0005682 3300046642 Bacteria 9541
194 Ga0495634_0009388 3300046642 Bacteria 7215
195 Ga0495635_0000050 3300046663 Bacteria 76087
196 Ga0495588_0001716 3300046674 Bacteria 9332
197 Ga0495657_0000157 3300046675 Bacteria 61489
198 Ga0495599_0001068 3300046678 Bacteria 15413
199 Ga0495623_0000511 3300046679 Bacteria 25656
200 Ga0495646_0000693 3300046680 Bacteria 18580
201 Ga0495658_0000154 3300046683 Bacteria 38312
202 Ga0495613_0000884 3300046689 Bacteria 23071
203 Ga0495649_0035936 3300046694 Bacteria 2724
204 Ga0495600_0000307 3300046809 Bacteria 26075
205 Ga0495581_0000369 3300047315 Bacteria 22599
206 Ga0495581_0077751 3300047315 Bacteria 1920
207 Ga0495604_0000207 3300047317 Bacteria 53831
208 Ga0495604_0002453 3300047317 Bacteria 14827
209 Ga0495674_0002198 3300047319 Bacteria 19186
210 Ga0495674_0002268 3300047319 Bacteria 18892
211 Ga0495672_0034072 3300047320 Bacteria 3150
212 Ga0495672_0039681 3300047320 Bacteria 2861
213 Ga0495676_0006810 3300047321 Bacteria 10506
214 Ga0495680_0007767 3300047322 Bacteria 9794
215 Ga0495675_0000353 3300047444 Bacteria 32273
216 Ga0495675_0043506 3300047444 Bacteria 2861
217 Ga0495685_003809 3300047447 Bacteria 4829
218 Ga0495684_0000160 3300047471 Bacteria 50298
219 Ga0495593_0000764 3300047673 Bacteria 18692
220 Ga0495593_0015239 3300047673 Bacteria 4360
221 Ga0495602_0001852 3300048088 Bacteria 21171
222 Ga0495614_0000006 3300048089 Bacteria 71718
223 Ga0501033_0005679 3300049570 Bacteria 9844
224 Ga0501034_0063943 3300049571 Bacteria 3693
225 Ga0501036_0007515 3300049572 Bacteria 8891
226 Ga0501036_0039636 3300049572 Bacteria 3986
227 Ga0501036_0050006 3300049572 Bacteria 3540
228 Ga0501036_0199634 3300049572 Bacteria 1682
229 Ga0501038_0000616 3300049574 Bacteria 31748
230 Ga0501040_0000366 3300049576 Bacteria 26742
231 Ga0501040_0023943 3300049576 Bacteria 4096
232 Ga0501040_0041189 3300049576 Bacteria 3145
233 Ga0501041_0003776 3300049577 Bacteria 8712
234 Ga0501042_0000197 3300049578 Bacteria 28667
235 Ga0501042_0000378 3300049578 Bacteria 22527
236 Ga0501042_0001928 3300049578 Bacteria 12488
237 Ga0501043_0015752 3300049579 Bacteria 5927
238 Ga0501046_0001070 3300049580 Bacteria 26827
239 Ga0501048_0021962 3300049582 Bacteria 4671
240 Ga0501048_0078763 3300049582 Bacteria 2326
241 Ga0501068_0022582 3300049584 Bacteria 3680
242 Ga0501070_0063738 3300049586 Bacteria 3053
243 Ga0501072_0001101 3300049588 Bacteria 20089
244 Ga0501072_0046488 3300049588 Bacteria 3416
245 Ga0501072_0099703 3300049588 Bacteria 2309
246 Ga0501073_0067171 3300049589 Bacteria 2500
247 Ga0501074_0038944 3300049590 Bacteria 3443
248 Ga0501075_0003674 3300049591 Bacteria 10290
249 Ga0501075_0010804 3300049591 Bacteria 6432
250 Ga0501076_0002308 3300049592 Bacteria 13062
251 Ga0501076_0030490 3300049592 Bacteria 4200
252 Ga0501077_0002905 3300049593 Bacteria 10281
253 Ga0501077_0003891 3300049593 Bacteria 8987
254 Ga0501081_0001543 3300049743 Bacteria 14164
255 Ga0501044_0162167 3300049823 Bacteria 2211
256 Ga0501045_0005911 3300049824 Bacteria 8466
257 Ga0501045_0009504 3300049824 Bacteria 6805
258 nmdc:mga06z11_238_c1 3300050494 Bacteria 21384
259 nmdc:mga05p37_12420_c1 3300050507 Bacteria 10171
260 nmdc:mga05p37_19083_c1 3300050507 Bacteria 8293
261 nmdc:mga05p37_249395_c1 3300050507 Bacteria 2130
262 nmdc:mga05p37_279941_c1 3300050507 Bacteria 1989
263 nmdc:mga05p37_90075_c1 3300050507 Bacteria 3781
264 nmdc:mga09592_38034_c1 3300050508 Bacteria 4038
265 nmdc:mga0qj67_32681_c1 3300050509 Bacteria 4059
266 nmdc:mga06r32_11492_c1 3300050510 Bacteria 7974
267 nmdc:mga06r32_246076_c1 3300050510 Bacteria 1776
268 nmdc:mga08y16_62213_c1 3300050511 Bacteria 3897
269 nmdc:mga08y16_67706_c1 3300050511 Bacteria 3724
270 nmdc:mga0n895_12079_c1 3300050512 Bacteria 7729
271 nmdc:mga0n895_121615_c1 3300050512 Bacteria 2632
272 nmdc:mga0n895_181717_c1 3300050512 Bacteria 2135
273 nmdc:mga0rr50_40636_c1 3300050513 Bacteria 3383
274 nmdc:mga0a205_149852_c1 3300050515 Bacteria 2233
275 nmdc:mga0a205_16780_c1 3300050515 Bacteria 6857
276 nmdc:mga0a205_8079_c1 3300050515 Bacteria 9566
277 Ga0495612_0005586 3300053078 Bacteria 5198
278 Ga0495619_0021386 3300053085 Bacteria 4129
279 Ga0500644_0001321 3300053088 Bacteria 6687
280 Ga0500553_027846 3300053101 Bacteria 2838
281 Ga0500593_000340 3300053117 Bacteria 18767
282 Ga0501084_0010322 3300054114 Bacteria 7725
283 Ga0501084_0010524 3300054114 Bacteria 7648
284 Ga0501084_0020922 3300054114 Bacteria 5455
285 Ga0501082_0011604 3300060353 Bacteria 7575
286 Ga0501082_0028590 3300060353 Bacteria 4802
287 Ga0501082_0040128 3300060353 Bacteria 4038
288 Ga0530510_0025059 3300061734 Bacteria 4264
289 Ga0530510_0033320 3300061734 Bacteria 3709
290 2997608643 2997600082 Bacteria 9896405
291 2511247198 2511231002 Bacteria 5042903
292 2558911454 2558860112 Bacteria 9931328
293 2616695700 2616644814 Bacteria 11555299
294 2644268094 2643221647 Bacteria 10741251
295 2644443768 2643221678 Bacteria 9540101
296 2676478594 2675903058 Bacteria 6822861
297 2676496374 2675903060 Bacteria 10051191
298 2739252405 2738543013 Bacteria 5618633
299 2768647866 2767802112 Bacteria 6465194
300 2785367226 2784746768 Bacteria 10036182
301 2808847728 2808606359 Bacteria 9866990
302 2808918466 2808606375 Bacteria 9466072
303 2809588647 2808606522 Bacteria 9488490
304 2811842724 2808606982 Bacteria 7791042
305 2819696445 2818991463 Bacteria 7948711
306 2827633466 2827628540 Bacteria 6858585
307 2861524599 2861520306 Bacteria 8348283
308 2861527395 2861520306 Bacteria 8348283
309 2862289589 2862281513 Bacteria 9621493
310 2866614940 2866612099 Bacteria 7543886
311 2867369923 2867369537 Bacteria 6501581
312 2868092348 2868088558 Bacteria 7609351
313 2875392755 2875391855 Bacteria 7600475
314 2877683321 2877676314 Bacteria 9512378
315 2883826487 2883821847 Bacteria 5121194
316 2887445081 2887443736 Bacteria 4426037
317 2895438924 2895427314 Bacteria 13147766
318 2897564134 2897561785 Bacteria 3256946
319 2906802860 2906799679 Bacteria 4031749
320 2915768564 2915768154 Bacteria 8424322
321 2919472123 2919468124 Bacteria 9133025
322 2954388568 2954380949 Bacteria 10050426
323 2954674557 2954673503 Bacteria 9685905
324 2954699357 2954691527 Bacteria 10720516
325 2966604320 2966598605 Bacteria 7676064
326 8056208146 8056207758 Bacteria 8639239
327 8056210574 8056207758 Bacteria 8639239
328 8056213050 8056207758 Bacteria 8639239
329 8056835637 8056829672 Bacteria 9045328
330 8057572961 8057568493 Bacteria 7221719
331 JGI25159J45721_1000660
332 JGI25406J46586_10001222
333 JGI25406J46586_10001641
334 rootH1_10001292
335 rootH2_10122574
336 JGI25160J50197_1000458
337 JGI25407J50210_10004084
338 JGI25161J50226_1000335
339 Ga0006562J51391_1050269
340 Ga0006562J51391_1050271
341 Ga0055543_1000744
342 Ga0065165_1008422
343 Ga0065165_1014050
344 Ga0065707_10106630
345 Ga0070658_10000422
346 Ga0070683_100053882
347 Ga0070670_100051158
348 Ga0070680_100062981
349 Ga0070682_100050926
350 Ga0070661_100019471
351 Ga0070668_100052153
352 Ga0070675_100191085
353 Ga0070674_100044292
354 Ga0070688_100021518
355 Ga0070667_100017532
356 Ga0070700_100034428
357 Ga0070708_100003281
358 Ga0070708_100015397
359 Ga0070681_10085649
360 Ga0070681_10126877
361 Ga0068867_100082220
362 Ga0070706_100001819
363 Ga0070707_100028756
364 Ga0070698_100024303
365 Ga0070698_100040820
366 Ga0070679_100000180
367 Ga0070684_100030315
368 Ga0068853_100021840
369 Ga0070672_100035601
370 Ga0070672_100055684
371 Ga0070704_100064506
372 Ga0070664_100028008
373 Ga0068857_100009350
374 Ga0068857_100060798
375 Ga0068859_100215253
376 Ga0068861_100115359
377 Ga0068858_100120753
378 Ga0068862_100003137
379 Ga0068862_100037067
380 Ga0068862_100043733
381 Ga0081538_10000129
382 Ga0081538_10003369
383 Ga0081538_10008196
384 Ga0081538_10019693
385 Ga0081538_10029726
386 Ga0081540_1009141
387 Ga0081539_10000197
388 Ga0081539_10003927
389 Ga0081539_10046921
390 Ga0081539_10053599
391 Ga0070717_10046508
392 Ga0075363_100013804
393 Ga0075367_10000527
394 Ga0075428_100008497
395 Ga0075428_100012378
396 Ga0075430_100029948
397 Ga0075430_100091147
398 Ga0075431_100016722
399 Ga0075431_100048489
400 Ga0075433_10024677
401 Ga0075433_10057802
402 Ga0075433_10145063
403 Ga0075434_100019189
404 Ga0075434_100026627
405 Ga0075434_100039604
406 Ga0075429_100054392
407 Ga0075429_100057945
408 Ga0075436_100016445
409 Ga0097620_100215242
410 Ga0075435_100046695
411 Ga0099794_10028465
412 Ga0105240_10247361
413 Ga0111539_10038716
414 Ga0114129_10003605
415 Ga0114129_10191750
416 Ga0114129_10252647
417 Ga0114129_10353164
418 Ga0105237_10004135
419 Ga0105237_10091622
420 Ga0105249_10005769
421 Ga0105249_10078305
422 Ga0105239_10087902
423 Ga0157369_10133283
424 Ga0157369_10190247
425 Ga0163162_10038912
426 Ga0157375_10151819
427 Ga0157380_10002881
428 Ga0183367_1010
429 Ga0163161_10000069
430 Ga0209130_1000202
431 Ga0209050_1003300
432 Ga0207426_1000145
433 Ga0207645_10023069
434 Ga0207684_10004385
435 Ga0207684_10007098
436 Ga0207695_10002878
437 Ga0207671_10002400
438 Ga0207693_10084894
439 Ga0207649_10007544
440 Ga0207652_10003294
441 Ga0207652_10009982
442 Ga0207652_10085299
443 Ga0207681_10001662
444 Ga0207669_10081523
445 Ga0207691_10002207
446 Ga0207691_10053771
447 Ga0207691_10073134
448 Ga0207689_10030006
449 Ga0207661_10017821
450 Ga0207679_10020738
451 Ga0207667_10113068
452 Ga0207668_10016165
453 Ga0207658_10005348
454 Ga0207648_10103744
455 Ga0207676_10086664
456 Ga0207674_10003628
457 Ga0207675_100029794
458 Ga0207428_10030635
459 Ga0268265_10023790
460 Ga0268265_10029367
461 Ga0268264_10133158
462 Ga0307512_10005170
463 Ga0307513_10000036
464 Ga0307408_100003208
465 Ga0307508_10012636
466 Ga0307518_10017452
467 Ga0307410_10021247
468 Ga0307406_10008783
469 Ga0307407_10087315
470 Ga0307507_10078420
471 Ga0307510_10122512
472 Ga0373934_0000263
473 Ga0373923_0003565
474 Ga0373956_0000793
475 Ga0373946_0012433
476 Ga0373955_0002064
477 Ga0373935_0000740
478 Ga0373927_0030185
479 Ga0373933_0000317
480 Ga0373947_0000184
481 Ga0373937_0000711
482 Ga0373925_0000532
483 Ga0395900_0008683
484 Ga0395905_0141115
485 Ga0436364_0064990
486 Ga0395901_0009608
487 Ga0395901_0033380
488 Ga0395901_0040534
489 Ga0451853_0061979
490 Ga0439455_0003711
491 Ga0450894_000425
492 Ga0450903_000167
493 Ga0450908_001487
494 Ga0451577_0000001
495 Ga0466970_0001342
496 Ga0466957_0025659
497 Ga0495592_0017734
498 Ga0495629_0016586
499 Ga0495651_0001100
500 Ga0495653_0000346
501 Ga0495580_0010565
502 Ga0495582_0001686
503 Ga0495639_0000243
504 Ga0495662_0001437
505 Ga0495664_0005629
506 Ga0495664_0009993
507 Ga0495664_0048162
508 Ga0495594_0027171
509 Ga0495608_0000130
510 Ga0495618_0014416
511 Ga0495628_0001252
512 Ga0495630_0004421
513 Ga0495630_0008236
514 Ga0495652_0000260
515 Ga0495652_0024999
516 Ga0495665_0000033
517 Ga0495586_0091332
518 Ga0495587_0000132
519 Ga0495587_0010168
520 Ga0495645_0000956
521 Ga0495645_0031379
522 Ga0495667_0000330
523 Ga0495634_0005682
524 Ga0495634_0009388
525 Ga0495635_0000050
526 Ga0495588_0001716
527 Ga0495657_0000157
528 Ga0495599_0001068
529 Ga0495623_0000511
530 Ga0495646_0000693
531 Ga0495658_0000154
532 Ga0495613_0000884
533 Ga0495649_0035936
534 Ga0495600_0000307
535 Ga0495581_0000369
536 Ga0495581_0077751
537 Ga0495604_0000207
538 Ga0495604_0002453
539 Ga0495674_0002198
540 Ga0495674_0002268
541 Ga0495672_0034072
542 Ga0495672_0039681
543 Ga0495676_0006810
544 Ga0495680_0007767
545 Ga0495675_0000353
546 Ga0495675_0043506
547 Ga0495685_003809
548 Ga0495684_0000160
549 Ga0495593_0000764
550 Ga0495593_0015239
551 Ga0495602_0001852
552 Ga0495614_0000006
553 Ga0501033_0005679
554 Ga0501034_0063943
555 Ga0501036_0007515
556 Ga0501036_0039636
557 Ga0501036_0050006
558 Ga0501036_0199634
559 Ga0501038_0000616
560 Ga0501040_0000366
561 Ga0501040_0023943
562 Ga0501040_0041189
563 Ga0501041_0003776
564 Ga0501042_0000197
565 Ga0501042_0000378
566 Ga0501042_0001928
567 Ga0501043_0015752
568 Ga0501046_0001070
569 Ga0501048_0021962
570 Ga0501048_0078763
571 Ga0501068_0022582
572 Ga0501070_0063738
573 Ga0501072_0001101
574 Ga0501072_0046488
575 Ga0501072_0099703
576 Ga0501073_0067171
577 Ga0501074_0038944
578 Ga0501075_0003674
579 Ga0501075_0010804
580 Ga0501076_0002308
581 Ga0501076_0030490
582 Ga0501077_0002905
583 Ga0501077_0003891
584 Ga0501081_0001543
585 Ga0501044_0162167
586 Ga0501045_0005911
587 Ga0501045_0009504
588 nmdc:mga06z11_238_c1
589 nmdc:mga05p37_12420_c1
590 nmdc:mga05p37_19083_c1
591 nmdc:mga05p37_249395_c1
592 nmdc:mga05p37_279941_c1
593 nmdc:mga05p37_90075_c1
594 nmdc:mga09592_38034_c1
595 nmdc:mga0qj67_32681_c1
596 nmdc:mga06r32_11492_c1
597 nmdc:mga06r32_246076_c1
598 nmdc:mga08y16_62213_c1
599 nmdc:mga08y16_67706_c1
600 nmdc:mga0n895_12079_c1
601 nmdc:mga0n895_121615_c1
602 nmdc:mga0n895_181717_c1
603 nmdc:mga0rr50_40636_c1
604 nmdc:mga0a205_149852_c1
605 nmdc:mga0a205_16780_c1
606 nmdc:mga0a205_8079_c1
607 Ga0495612_0005586
608 Ga0495619_0021386
609 Ga0500644_0001321
610 Ga0500553_027846
611 Ga0500593_000340
612 Ga0501084_0010322
613 Ga0501084_0010524
614 Ga0501084_0020922
615 Ga0501082_0011604
616 Ga0501082_0028590
617 Ga0501082_0040128
618 Ga0530510_0025059
619 Ga0530510_0033320
620 2997608643
621 2511247198
622 2558911454
623 2616695700
624 2644268094
625 2644443768
626 2676478594
627 2676496374
628 2739252405
629 2768647866
630 2785367226
631 2808847728
632 2808918466
633 2809588647
634 2811842724
635 2819696445
636 2827633466
637 2861524599
638 2861527395
639 2862289589
640 2866614940
641 2867369923
642 2868092348
643 2875392755
644 2877683321
645 2883826487
646 2887445081
647 2895438924
648 2897564134
649 2906802860
650 2915768564
651 2919472123
652 2954388568
653 2954674557
654 2954699357
655 2966604320
656 8056208146
657 8056210574
658 8056213050
659 8056835637
660 8057572961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

31

423

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.7684 1 439
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.7456 1 439
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.6485 8 436
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.6411 8 436
7d5p-assembly1.cif.gz_A structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.6349 14 439
ID Description Score Start End Superfamily
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.903 15 204 1.20.1250.20
af_P9WJW9_9_219_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8926 16 207 1.20.1250.20
af_P9WJY5_55_296_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8716 17 242 1.20.1250.20
af_P76269_18_258_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8715 17 240 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8711 17 188 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4Q6FCL0-F1-model_v4 MFS transporter 0.9303 2 339 GO:0016020
GO:0022857
AF-A0A7W7CF01-F1-model_v4 DHA2 family multidrug resistance protein-like MFS transporter 0.9174 11 441 GO:0016020
GO:0022857
AF-A0A6N7DAV5-F1-model_v4 Multidrug resistance protein Stp 0.9155 1 311 GO:0016020
GO:0022857
AF-A0A1V0M4B4-F1-model_v4 Antiseptic resistance protein (Transport protein QacB) 0.911 156 441 GO:0016020
GO:0022857
AF-A0A4D4LKI9-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9067 10 341 GO:0016020
GO:0022857
GO:0046677

Map