F410305

General Info

Members Datasets Scaffolds Average Seq Length
330 269 660 288

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2508501009|2508539474
Length 338
Sequence YLRAFAPSTDCGYHLTIRAITFHLAGSFAITAEASDCHVSHRSQSSRSALRTFAMGLLCLMMPAGALAADSDQDAVAKPAVPNIYLDLRTTYATIPAGTLGLGFGNTSLSAAFEALAARRGDALPNGLPAAKSIAVDLPMTVDVSDRVSLYSGVSGSTTDLGGGWSAFDITSWNIGVQADLYQQNGGKIPTITLQSTLTQSVPNDPGMTTSFNNILEFDYALDEDETRGWLAGVQYTITDIAGAVVRIRPNTILYAGGYYQWPSNWKFTGRLGVQSFGGAQLAGRVLAEPFTQPILRLDLDRMDDNDNRLFGITAQIAWMPKPSYQMTLRTPLYAVRN

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
24 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
36 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
37 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
38 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
39 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
41 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
44 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
61 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
62 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
63 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
64 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
65 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
66 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
67 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
169 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
170 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
171 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
172 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
173 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
174 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
175 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
176 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
177 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
178 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
179 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
180 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
181 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
182 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
183 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
184 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
185 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
186 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
187 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
188 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
189 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
190 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
191 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
192 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
193 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
194 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
195 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
196 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
197 2643221651 Afipia sp. Root123D2 Isolate Unclassified
198 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
199 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
200 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
201 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
202 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
203 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
204 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
205 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
206 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
207 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
208 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
209 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
210 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
211 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
212 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
213 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
214 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
215 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
216 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
217 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
218 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
219 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
220 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
221 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
222 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
223 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
224 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
225 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
226 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
227 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
228 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
229 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
230 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
231 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
232 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
233 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
234 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
235 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
236 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
237 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
238 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
239 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
240 2906610324
241 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
242 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
243 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
244 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
245 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
246 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
247 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
248 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
249 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
250 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
251 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
252 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
253 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
254 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
255 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
256 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
257 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
258 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
259 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
260 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
261 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
262 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
263 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
264 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
265 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
266 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
267 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
268 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
269 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.99
Metatranscriptomes 0
Isolates 24.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.39
Nodule 16.36
Rhizoplane 5.15
Rhizosphere 40.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1013641 3300003214 Bacteria 1115
2 JGI25153J46596_10000779 3300003215 Bacteria 19522
3 JGI25153J46596_10013690 3300003215 Bacteria 3414
4 rootL2_10060930 3300003322 Bacteria 1746
5 JGI25160J50197_1015421 3300003354 Bacteria 2508
6 Ga0055531_10008790 3300003794 Bacteria 5266
7 Ga0065165_1008128 3300005262 Bacteria 4991
8 Ga0070671_100016632 3300005355 Bacteria 5945
9 Ga0070667_100024909 3300005367 Bacteria 4970
10 Ga0070665_100167023 3300005548 Bacteria 2203
11 Ga0070665_100224576 3300005548 Bacteria 1878
12 Ga0068856_100222292 3300005614 Bacteria 1904
13 Ga0068859_100417513 3300005617 Bacteria 1438
14 Ga0068863_100280501 3300005841 Bacteria 1614
15 Ga0068860_100104828 3300005843 Bacteria 2700
16 Ga0081540_1006158 3300005983 Bacteria 8798
17 Ga0075365_10071607 3300006038 Bacteria 2334
18 Ga0075368_10001128 3300006042 Bacteria 8425
19 Ga0075368_10041839 3300006042 Bacteria 1801
20 Ga0075364_10021792 3300006051 Bacteria 4040
21 Ga0075367_10047109 3300006178 Bacteria 2535
22 Ga0075369_10012167 3300006186 Bacteria 3397
23 Ga0075366_10014740 3300006195 Bacteria 4470
24 Ga0075370_10008228 3300006353 Bacteria 5353
25 Ga0097620_100417570 3300006931 Bacteria 1438
26 Ga0099824_1006965 3300006942 Bacteria 15237
27 Ga0099823_1053968 3300006944 Bacteria 2335
28 Ga0105245_10186200 3300009098 Bacteria 1986
29 Ga0105243_10057231 3300009148 Bacteria 3104
30 Ga0105241_10012049 3300009174 Bacteria 6351
31 Ga0105248_10370707 3300009177 Bacteria 1612
32 Ga0105237_10041979 3300009545 Bacteria 4612
33 Ga0105237_10061935 3300009545 Bacteria 3740
34 Ga0105237_10166223 3300009545 Bacteria 2205
35 Ga0105238_10246001 3300009551 Bacteria 1766
36 Ga0105239_10101012 3300010375 Bacteria 3191
37 Ga0105246_10012644 3300011119 Bacteria 5273
38 Ga0157374_10023440 3300013296 Bacteria 5520
39 Ga0163163_10009817 3300014325 Bacteria 8576
40 Ga0214544_1000087 3300021320 Bacteria 119600
41 Ga0214542_1000018 3300021321 Bacteria 202226
42 Ga0214542_1041773 3300021321 Bacteria 1126
43 Ga0214545_1000009 3300021324 Bacteria 202915
44 Ga0214545_1034580 3300021324 Bacteria 1733
45 Ga0214543_1000037 3300021327 Bacteria 182113
46 Ga0214543_1042667 3300021327 Bacteria 1123
47 Ga0209563_103174 3300025230 Bacteria 3465
48 Ga0207425_1010441 3300025245 Bacteria 2260
49 Ga0209677_103626 3300025253 Bacteria 4877
50 Ga0209148_1000192 3300025254 Bacteria 115724
51 Ga0209233_1005915 3300025261 Bacteria 4006
52 Ga0209233_1006641 3300025261 Bacteria 3710
53 Ga0209233_1007329 3300025261 Bacteria 3499
54 Ga0209455_1002791 3300025272 Bacteria 6518
55 Ga0209758_1000030 3300025297 Bacteria 509217
56 Ga0209758_1001172 3300025297 Bacteria 33281
57 Ga0209758_1003935 3300025297 Bacteria 12926
58 Ga0209758_1023113 3300025297 Bacteria 2824
59 Ga0209256_1005019 3300025299 Bacteria 7901
60 Ga0207426_1000663 3300025302 Bacteria 42213
61 Ga0207426_1006615 3300025302 Bacteria 4991
62 Ga0209257_1000797 3300025304 Bacteria 46045
63 Ga0207697_10046316 3300025315 Bacteria 1791
64 Ga0207647_10002595 3300025904 Bacteria 13666
65 Ga0207671_10146519 3300025914 Bacteria 1822
66 Ga0207681_10056030 3300025923 Bacteria 2688
67 Ga0207658_10071186 3300025986 Bacteria 2633
68 Ga0207677_10066930 3300026023 Bacteria 2514
69 Ga0207703_10067044 3300026035 Bacteria 2953
70 Ga0207678_10051645 3300026067 Bacteria 3549
71 Ga0207702_10526734 3300026078 Bacteria 1154
72 Ga0207674_10158370 3300026116 Bacteria 2219
73 Ga0207698_10278157 3300026142 Bacteria 1547
74 Ga0209389_1000161 3300027296 Bacteria 55526
75 Ga0209589_1000103 3300027357 Bacteria 86516
76 Ga0209489_100304 3300027361 Bacteria 86516
77 Ga0209813_10060478 3300027866 Bacteria 1208
78 Ga0265337_1038669 3300028556 Bacteria 1382
79 Ga0265326_10001385 3300028558 Bacteria 8536
80 Ga0265323_10002972 3300028653 Bacteria 7573
81 Ga0265336_10000142 3300028666 Bacteria 51042
82 Ga0265338_10000934 3300028800 Bacteria 49279
83 Ga0265324_10001775 3300029957 Bacteria 11798
84 Ga0307511_10071042 3300030521 Bacteria 2543
85 Ga0265328_10036451 3300031239 Bacteria 1817
86 Ga0265340_10008725 3300031247 Bacteria 5466
87 Ga0307509_10094723 3300031507 Bacteria 3044
88 Ga0307509_10308716 3300031507 Bacteria 1325
89 Ga0307508_10000484 3300031616 Bacteria 47980
90 Ga0307508_10283896 3300031616 Bacteria 1249
91 Ga0307510_10049750 3300033180 Bacteria 4455
92 Ga0373956_0046969 3300035119 Bacteria 1930
93 Ga0373955_0000251 3300035172 Bacteria 22333
94 Ga0373924_0049464 3300035410 Bacteria 1739
95 Ga0373935_0032257 3300035692 Bacteria 3254
96 Ga0373927_0025561 3300035695 Bacteria 3861
97 Ga0373947_0111436 3300035725 Bacteria 1730
98 Ga0373937_0391368 3300036401 Bacteria 1318
99 Ga0373925_0015212 3300037068 Bacteria 5564
100 Ga0395898_0185135 3300037466 Bacteria 1990
101 Ga0395905_0008825 3300037471 Bacteria 9905
102 Ga0395905_0042392 3300037471 Bacteria 4271
103 Ga0395905_0366704 3300037471 Bacteria 1333
104 Ga0451795_1484506 3300041456 Bacteria 1342
105 Ga0466972_0000237 3300044658 Bacteria 38144
106 Ga0466972_0049533 3300044658 Bacteria 2029
107 Ga0466966_0001368 3300044684 Bacteria 15665
108 Ga0466961_0000039 3300044693 Bacteria 79787
109 Ga0466963_0076414 3300044694 Bacteria 2261
110 Ga0466959_0000475 3300045049 Bacteria 23395
111 Ga0466967_0404336 3300045976 Bacteria 1329
112 Ga0495592_0066049 3300046454 Bacteria 2647
113 Ga0495592_0158574 3300046454 Bacteria 1559
114 Ga0495629_0003597 3300046459 Bacteria 11710
115 Ga0495629_0040822 3300046459 Bacteria 3264
116 Ga0495638_0000962 3300046460 Bacteria 29175
117 Ga0495651_0021109 3300046462 Bacteria 5058
118 Ga0495651_0052112 3300046462 Bacteria 3152
119 Ga0495653_0051986 3300046463 Bacteria 3142
120 Ga0495653_0098493 3300046463 Bacteria 2123
121 Ga0495639_0112296 3300046475 Bacteria 1294
122 Ga0495664_0014296 3300046477 Bacteria 4497
123 Ga0495606_0021072 3300046507 Bacteria 4783
124 Ga0495606_0113116 3300046507 Bacteria 1634
125 Ga0495608_0049679 3300046511 Bacteria 2784
126 Ga0495608_0050322 3300046511 Bacteria 2764
127 Ga0495618_0147951 3300046514 Bacteria 1501
128 Ga0495643_0011773 3300046522 Bacteria 5306
129 Ga0495644_0082539 3300046523 Bacteria 1212
130 Ga0495648_0020487 3300046524 Bacteria 4610
131 Ga0495652_0018285 3300046529 Bacteria 6252
132 Ga0495652_0021928 3300046529 Bacteria 5678
133 Ga0495652_0071073 3300046529 Bacteria 2906
134 Ga0495640_0005348 3300046533 Bacteria 10210
135 Ga0495640_0107673 3300046533 Bacteria 1824
136 Ga0495587_0170540 3300046536 Bacteria 1236
137 Ga0495609_0034602 3300046538 Bacteria 2290
138 Ga0495645_0010237 3300046543 Bacteria 6571
139 Ga0495645_0019584 3300046543 Bacteria 4872
140 Ga0495622_0030306 3300046557 Bacteria 2528
141 Ga0495667_0026053 3300046559 Bacteria 3938
142 Ga0495667_0041668 3300046559 Bacteria 3044
143 Ga0495668_0021493 3300046616 Bacteria 3699
144 Ga0495668_0108165 3300046616 Bacteria 1521
145 Ga0495668_0153601 3300046616 Bacteria 1261
146 Ga0495634_0015858 3300046642 Bacteria 5399
147 Ga0495611_0077538 3300046648 Bacteria 1524
148 Ga0495625_0135256 3300046660 Bacteria 1667
149 Ga0495635_0001063 3300046663 Bacteria 18175
150 Ga0495635_0008338 3300046663 Bacteria 7238
151 Ga0495657_0019953 3300046675 Bacteria 4829
152 Ga0495657_0045515 3300046675 Bacteria 2977
153 Ga0495599_0015268 3300046678 Bacteria 4763
154 Ga0495599_0022994 3300046678 Bacteria 3894
155 Ga0495623_0006025 3300046679 Bacteria 7887
156 Ga0495623_0015324 3300046679 Bacteria 4954
157 Ga0495613_0003593 3300046689 Bacteria 11621
158 Ga0495649_0020138 3300046694 Bacteria 3743
159 Ga0495649_0213356 3300046694 Bacteria 1000
160 Ga0495600_0005549 3300046809 Bacteria 7615
161 Ga0495600_0005912 3300046809 Bacteria 7403
162 Ga0495604_0001703 3300047317 Bacteria 18081
163 Ga0495604_0009877 3300047317 Bacteria 7555
164 Ga0495604_0099371 3300047317 Bacteria 2141
165 Ga0495674_0122416 3300047319 Bacteria 2197
166 Ga0495676_0100133 3300047321 Bacteria 2146
167 Ga0495680_0018678 3300047322 Bacteria 5876
168 Ga0495683_0082123 3300047323 Bacteria 1571
169 Ga0495687_054520 3300047443 Bacteria 1677
170 Ga0495675_0053114 3300047444 Bacteria 2572
171 Ga0495673_0047455 3300047469 Bacteria 1898
172 Ga0495684_0020264 3300047471 Bacteria 5123
173 Ga0495686_0051462 3300047472 Bacteria 2584
174 Ga0495593_0003458 3300047673 Bacteria 9456
175 Ga0495593_0010016 3300047673 Bacteria 5493
176 Ga0495602_0020571 3300048088 Bacteria 6519
177 Ga0495602_0028209 3300048088 Bacteria 5376
178 Ga0496102_0125513 3300048905 Bacteria 2399
179 Ga0496102_0202029 3300048905 Bacteria 1873
180 Ga0496103_0019138 3300048906 Bacteria 4111
181 Ga0496103_0058351 3300048906 Bacteria 2398
182 Ga0496104_0068682 3300048907 Bacteria 3367
183 Ga0496104_0162452 3300048907 Bacteria 2142
184 Ga0496105_0004856 3300048908 Bacteria 10150
185 Ga0496105_0011484 3300048908 Bacteria 6998
186 Ga0496108_0010432 3300048911 Bacteria 7544
187 Ga0496109_0012106 3300048912 Bacteria 7437
188 Ga0496110_0023050 3300048913 Bacteria 5294
189 Ga0496110_0147315 3300048913 Bacteria 2130
190 Ga0496111_0055707 3300048914 Bacteria 2860
191 Ga0496112_0013915 3300048915 Bacteria 7443
192 Ga0496113_0011364 3300048916 Bacteria 5934
193 Ga0496115_0040914 3300048918 Bacteria 3686
194 Ga0496117_0112844 3300048920 Bacteria 1689
195 Ga0496118_0046680 3300048921 Bacteria 3366
196 Ga0496118_0057238 3300048921 Bacteria 2923
197 Ga0496119_0004806 3300048922 Bacteria 13253
198 Ga0496119_0009947 3300048922 Bacteria 8069
199 Ga0496120_0006060 3300048923 Bacteria 9394
200 Ga0496121_0014951 3300048924 Bacteria 8175
201 Ga0496121_0022485 3300048924 Bacteria 6119
202 Ga0496121_0150384 3300048924 Bacteria 1714
203 Ga0496122_0078664 3300048925 Bacteria 2309
204 Ga0496125_0055190 3300048928 Bacteria 3240
205 Ga0496125_0058271 3300048928 Bacteria 3121
206 Ga0496126_0012493 3300048929 Bacteria 8695
207 Ga0496126_0064030 3300048929 Bacteria 3294
208 Ga0496126_0078138 3300048929 Bacteria 2933
209 Ga0496126_0195867 3300048929 Bacteria 1709
210 Ga0501033_0155154 3300049570 Bacteria 1650
211 Ga0501038_0136639 3300049574 Bacteria 2008
212 Ga0501046_0039459 3300049580 Bacteria 3781
213 Ga0501067_0061033 3300049583 Bacteria 2087
214 nmdc:mga03n38_190171_c1 3300050490 Bacteria 1057
215 nmdc:mga00v17_24349_c1 3300050491 Bacteria 3510
216 nmdc:mga0yw44_124915_c1 3300050492 Bacteria 1661
217 nmdc:mga0yw44_170524_c1 3300050492 Bacteria 1429
218 nmdc:mga0yw44_26344_c1 3300050492 Bacteria 3320
219 nmdc:mga04h51_57198_c1 3300050495 Bacteria 1326
220 nmdc:mga07m45_16023_c2 3300050496 Bacteria 2805
221 nmdc:mga07m45_47159_c1 3300050496 Bacteria 2422
222 nmdc:mga0sz30_24817_c1 3300050516 Bacteria 2449
223 Ga0495601_0116569 3300053077 Bacteria 1732
224 Ga0495595_0052373 3300053084 Bacteria 1894
225 Ga0495619_0017093 3300053085 Bacteria 4597
226 Ga0495619_0212403 3300053085 Bacteria 1340
227 Ga0500643_000270 3300053087 Bacteria 45829
228 Ga0500651_0013383 3300053093 Bacteria 4998
229 Ga0500566_0000029 3300053094 Bacteria 75384
230 Ga0500555_003017 3300053103 Bacteria 4812
231 Ga0500569_010388 3300053109 Bacteria 2192
232 Ga0500572_004349 3300053111 Bacteria 3218
233 Ga0500595_000589 3300053119 Bacteria 21663
234 Ga0500607_029229 3300053121 Bacteria 3045
235 Ga0500642_0000099 3300053130 Bacteria 42097
236 Ga0500642_0006584 3300053130 Bacteria 3837
237 Ga0500655_009016 3300053133 Bacteria 1795
238 Ga0500559_0179364 3300053136 Bacteria 997
239 Ga0500590_052038 3300053148 Bacteria 2079
240 Ga0500604_0047062 3300053151 Bacteria 1321
241 Ga0500622_0010250 3300053156 Bacteria 5150
242 Ga0500627_0027218 3300053158 Bacteria 2365
243 Ga0500633_0029163 3300053160 Bacteria 1764
244 Ga0500638_037390 3300053162 Bacteria 2356
245 Ga0500639_102891 3300053163 Bacteria 1402
246 Ga0500636_0000035 3300053177 Bacteria 72245
247 Ga0500636_0060250 3300053177 Bacteria 2216
248 Ga0500625_004618 3300053729 Bacteria 5656
249 Ga0500552_009465 3300053733 Bacteria 1176
250 Ga0500599_003287 3300053736 Bacteria 1966
251 2508539474 2508501009 Bacteria 7784016
252 2513876984 2513237139 Bacteria 8737671
253 2514016040 2513237161 Bacteria 8871253
254 2517105928 2517093001 Bacteria 9002274
255 2524440016 2524023205 Bacteria 8918781
256 2617353198 2617270735 Bacteria 9163226
257 2617377321 2617270741 Bacteria 8201522
258 2644289970 2643221651 Bacteria 4798932
259 2745077872 2744054633 Bacteria 8678936
260 2805921221 2802429603 Bacteria 8777136
261 2824615659 2824609381 Bacteria 8672835
262 2824623901 2824617872 Bacteria 8814715
263 2824632620 2824626560 Bacteria 8813858
264 2824639426 2824635225 Bacteria 8785348
265 2824652346 2824644064 Bacteria 8743947
266 2824657467 2824653114 Bacteria 8493680
267 2824678155 2824671348 Bacteria 8369588
268 2824685910 2824679649 Bacteria 8248951
269 2824694545 2824687955 Bacteria 8360029
270 2824703066 2824696289 Bacteria 8335049
271 2824722765 2824714736 Bacteria 8717648
272 2824732293 2824723954 Bacteria 8758240
273 2824740270 2824732956 Bacteria 7810675
274 2824752622 2824746037 Bacteria 7911610
275 2824758784 2824753945 Bacteria 9787441
276 2824769254 2824763712 Bacteria 9792355
277 2824777471 2824773399 Bacteria 8360218
278 2838125705 2838122688 Bacteria 8803140
279 2841947916 2841941048 Bacteria 8688029
280 2841957013 2841949485 Bacteria 8680857
281 2841965162 2841957949 Bacteria 8652217
282 2841972744 2841966195 Bacteria 8673214
283 2841977522 2841974524 Bacteria 8931498
284 2841984921 2841983080 Bacteria 8395090
285 2842049363 2842045827 Bacteria 8006841
286 2844315812 2844315083 Bacteria 8138177
287 2847942622 2847939898 Bacteria 8606328
288 2849083378 2849076700 Bacteria 7039503
289 2874621337 2874620515 Bacteria 8290088
290 2876764001 2876761206 Bacteria 10111113
291 2881365556 2881364244 Bacteria 7710352
292 2881668385 2881665667 Bacteria 8175609
293 2885368676 2885366525 Bacteria 8326213
294 2885413385 2885409591 Bacteria 9235467
295 2888390333 2888388044 Bacteria 7304136
296 2888419925 2888419890 Bacteria 7857137
297 2903730888 2903727486 Bacteria 8281579
298 2904668007 2904666416 Bacteria 8226587
299 2904714131 2904711408 Bacteria 9771557
300 2906603711 2906602504 Bacteria 8295279
301 2906615722
302 2906633170 2906626472 Bacteria 8826946
303 2908775837 2908775508 Bacteria 8092255
304 2922394783 2922393267 Bacteria 8285685
305 2932799959 2932794094 Bacteria 7915132
306 2932808882 2932801729 Bacteria 7987968
307 2935774157 2935769743 Bacteria 7878163
308 2935783709 2935777560 Bacteria 8077691
309 2935789126 2935785616 Bacteria 7962367
310 2935796876 2935793552 Bacteria 8012592
311 2935883247 2935883170 Bacteria 7964738
312 2935966459 2935959822 Bacteria 7869783
313 2941535663 2941531003 Bacteria 7653939
314 3005506241 3005506211 Bacteria 6943378
315 3005593416 3005587118 Bacteria 7794411
316 3005595401 3005594810 Bacteria 8716512
317 3005718628 3005718088 Bacteria 8283608
318 8006930978 8006926726 Bacteria 6749210
319 8016525865 8016522445 Bacteria 8156687
320 8016543754 8016539877 Bacteria 8155419
321 8016557959 8016557553 Bacteria 8154380
322 8016569155 8016566248 Bacteria 8158151
323 8016595977 8016595262 Bacteria 8149947
324 8016618756 8016613128 Bacteria 8794220
325 8016622777 8016622563 Bacteria 7999408
326 8019530746 8019530166 Bacteria 8155624
327 8019540838 8019538911 Bacteria 7872763
328 8019549777 8019547302 Bacteria 7996444
329 8019652930 8019648815 Bacteria 10014479
330 8056975661 8056967851 Bacteria 9038162
331 JGI25165J46597_1013641
332 JGI25153J46596_10000779
333 JGI25153J46596_10013690
334 rootL2_10060930
335 JGI25160J50197_1015421
336 Ga0055531_10008790
337 Ga0065165_1008128
338 Ga0070671_100016632
339 Ga0070667_100024909
340 Ga0070665_100167023
341 Ga0070665_100224576
342 Ga0068856_100222292
343 Ga0068859_100417513
344 Ga0068863_100280501
345 Ga0068860_100104828
346 Ga0081540_1006158
347 Ga0075365_10071607
348 Ga0075368_10001128
349 Ga0075368_10041839
350 Ga0075364_10021792
351 Ga0075367_10047109
352 Ga0075369_10012167
353 Ga0075366_10014740
354 Ga0075370_10008228
355 Ga0097620_100417570
356 Ga0099824_1006965
357 Ga0099823_1053968
358 Ga0105245_10186200
359 Ga0105243_10057231
360 Ga0105241_10012049
361 Ga0105248_10370707
362 Ga0105237_10041979
363 Ga0105237_10061935
364 Ga0105237_10166223
365 Ga0105238_10246001
366 Ga0105239_10101012
367 Ga0105246_10012644
368 Ga0157374_10023440
369 Ga0163163_10009817
370 Ga0214544_1000087
371 Ga0214542_1000018
372 Ga0214542_1041773
373 Ga0214545_1000009
374 Ga0214545_1034580
375 Ga0214543_1000037
376 Ga0214543_1042667
377 Ga0209563_103174
378 Ga0207425_1010441
379 Ga0209677_103626
380 Ga0209148_1000192
381 Ga0209233_1005915
382 Ga0209233_1006641
383 Ga0209233_1007329
384 Ga0209455_1002791
385 Ga0209758_1000030
386 Ga0209758_1001172
387 Ga0209758_1003935
388 Ga0209758_1023113
389 Ga0209256_1005019
390 Ga0207426_1000663
391 Ga0207426_1006615
392 Ga0209257_1000797
393 Ga0207697_10046316
394 Ga0207647_10002595
395 Ga0207671_10146519
396 Ga0207681_10056030
397 Ga0207658_10071186
398 Ga0207677_10066930
399 Ga0207703_10067044
400 Ga0207678_10051645
401 Ga0207702_10526734
402 Ga0207674_10158370
403 Ga0207698_10278157
404 Ga0209389_1000161
405 Ga0209589_1000103
406 Ga0209489_100304
407 Ga0209813_10060478
408 Ga0265337_1038669
409 Ga0265326_10001385
410 Ga0265323_10002972
411 Ga0265336_10000142
412 Ga0265338_10000934
413 Ga0265324_10001775
414 Ga0307511_10071042
415 Ga0265328_10036451
416 Ga0265340_10008725
417 Ga0307509_10094723
418 Ga0307509_10308716
419 Ga0307508_10000484
420 Ga0307508_10283896
421 Ga0307510_10049750
422 Ga0373956_0046969
423 Ga0373955_0000251
424 Ga0373924_0049464
425 Ga0373935_0032257
426 Ga0373927_0025561
427 Ga0373947_0111436
428 Ga0373937_0391368
429 Ga0373925_0015212
430 Ga0395898_0185135
431 Ga0395905_0008825
432 Ga0395905_0042392
433 Ga0395905_0366704
434 Ga0451795_1484506
435 Ga0466972_0000237
436 Ga0466972_0049533
437 Ga0466966_0001368
438 Ga0466961_0000039
439 Ga0466963_0076414
440 Ga0466959_0000475
441 Ga0466967_0404336
442 Ga0495592_0066049
443 Ga0495592_0158574
444 Ga0495629_0003597
445 Ga0495629_0040822
446 Ga0495638_0000962
447 Ga0495651_0021109
448 Ga0495651_0052112
449 Ga0495653_0051986
450 Ga0495653_0098493
451 Ga0495639_0112296
452 Ga0495664_0014296
453 Ga0495606_0021072
454 Ga0495606_0113116
455 Ga0495608_0049679
456 Ga0495608_0050322
457 Ga0495618_0147951
458 Ga0495643_0011773
459 Ga0495644_0082539
460 Ga0495648_0020487
461 Ga0495652_0018285
462 Ga0495652_0021928
463 Ga0495652_0071073
464 Ga0495640_0005348
465 Ga0495640_0107673
466 Ga0495587_0170540
467 Ga0495609_0034602
468 Ga0495645_0010237
469 Ga0495645_0019584
470 Ga0495622_0030306
471 Ga0495667_0026053
472 Ga0495667_0041668
473 Ga0495668_0021493
474 Ga0495668_0108165
475 Ga0495668_0153601
476 Ga0495634_0015858
477 Ga0495611_0077538
478 Ga0495625_0135256
479 Ga0495635_0001063
480 Ga0495635_0008338
481 Ga0495657_0019953
482 Ga0495657_0045515
483 Ga0495599_0015268
484 Ga0495599_0022994
485 Ga0495623_0006025
486 Ga0495623_0015324
487 Ga0495613_0003593
488 Ga0495649_0020138
489 Ga0495649_0213356
490 Ga0495600_0005549
491 Ga0495600_0005912
492 Ga0495604_0001703
493 Ga0495604_0009877
494 Ga0495604_0099371
495 Ga0495674_0122416
496 Ga0495676_0100133
497 Ga0495680_0018678
498 Ga0495683_0082123
499 Ga0495687_054520
500 Ga0495675_0053114
501 Ga0495673_0047455
502 Ga0495684_0020264
503 Ga0495686_0051462
504 Ga0495593_0003458
505 Ga0495593_0010016
506 Ga0495602_0020571
507 Ga0495602_0028209
508 Ga0496102_0125513
509 Ga0496102_0202029
510 Ga0496103_0019138
511 Ga0496103_0058351
512 Ga0496104_0068682
513 Ga0496104_0162452
514 Ga0496105_0004856
515 Ga0496105_0011484
516 Ga0496108_0010432
517 Ga0496109_0012106
518 Ga0496110_0023050
519 Ga0496110_0147315
520 Ga0496111_0055707
521 Ga0496112_0013915
522 Ga0496113_0011364
523 Ga0496115_0040914
524 Ga0496117_0112844
525 Ga0496118_0046680
526 Ga0496118_0057238
527 Ga0496119_0004806
528 Ga0496119_0009947
529 Ga0496120_0006060
530 Ga0496121_0014951
531 Ga0496121_0022485
532 Ga0496121_0150384
533 Ga0496122_0078664
534 Ga0496125_0055190
535 Ga0496125_0058271
536 Ga0496126_0012493
537 Ga0496126_0064030
538 Ga0496126_0078138
539 Ga0496126_0195867
540 Ga0501033_0155154
541 Ga0501038_0136639
542 Ga0501046_0039459
543 Ga0501067_0061033
544 nmdc:mga03n38_190171_c1
545 nmdc:mga00v17_24349_c1
546 nmdc:mga0yw44_124915_c1
547 nmdc:mga0yw44_170524_c1
548 nmdc:mga0yw44_26344_c1
549 nmdc:mga04h51_57198_c1
550 nmdc:mga07m45_16023_c2
551 nmdc:mga07m45_47159_c1
552 nmdc:mga0sz30_24817_c1
553 Ga0495601_0116569
554 Ga0495595_0052373
555 Ga0495619_0017093
556 Ga0495619_0212403
557 Ga0500643_000270
558 Ga0500651_0013383
559 Ga0500566_0000029
560 Ga0500555_003017
561 Ga0500569_010388
562 Ga0500572_004349
563 Ga0500595_000589
564 Ga0500607_029229
565 Ga0500642_0000099
566 Ga0500642_0006584
567 Ga0500655_009016
568 Ga0500559_0179364
569 Ga0500590_052038
570 Ga0500604_0047062
571 Ga0500622_0010250
572 Ga0500627_0027218
573 Ga0500633_0029163
574 Ga0500638_037390
575 Ga0500639_102891
576 Ga0500636_0000035
577 Ga0500636_0060250
578 Ga0500625_004618
579 Ga0500552_009465
580 Ga0500599_003287
581 2508539474
582 2513876984
583 2514016040
584 2517105928
585 2524440016
586 2617353198
587 2617377321
588 2644289970
589 2745077872
590 2805921221
591 2824615659
592 2824623901
593 2824632620
594 2824639426
595 2824652346
596 2824657467
597 2824678155
598 2824685910
599 2824694545
600 2824703066
601 2824722765
602 2824732293
603 2824740270
604 2824752622
605 2824758784
606 2824769254
607 2824777471
608 2838125705
609 2841947916
610 2841957013
611 2841965162
612 2841972744
613 2841977522
614 2841984921
615 2842049363
616 2844315812
617 2847942622
618 2849083378
619 2874621337
620 2876764001
621 2881365556
622 2881668385
623 2885368676
624 2885413385
625 2888390333
626 2888419925
627 2903730888
628 2904668007
629 2904714131
630 2906603711
631 2906615722
632 2906633170
633 2908775837
634 2922394783
635 2932799959
636 2932808882
637 2935774157
638 2935783709
639 2935789126
640 2935796876
641 2935883247
642 2935966459
643 2941535663
644 3005506241
645 3005593416
646 3005595401
647 3005718628
648 8006930978
649 8016525865
650 8016543754
651 8016557959
652 8016569155
653 8016595977
654 8016618756
655 8016622777
656 8019530746
657 8019540838
658 8019549777
659 8019652930
660 8056975661

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o68-assembly4.cif.gz_L crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7105 29 280
5o68-assembly3.cif.gz_I crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7094 29 280
5o68-assembly1.cif.gz_B crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7088 30 280
5o68-assembly2.cif.gz_F crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7088 29 280
5o68-assembly2.cif.gz_D crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7026 30 280
ID Description Score Start End Superfamily
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6685 35 283 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6622 35 283 2.40.160.40
af_P76773_24_229_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6014 34 280 2.40.160.40
af_P76773_24_229_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.5952 34 280 2.40.160.40
af_Q9FPG2_1_167_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.5938 32 279 2.40.160.40
ID Description Score Start End GO Terms
AF-H0SUJ4-F1-model_v4 Transporter 0.8848 2 284
AF-F8BRQ5-F1-model_v4 Transporter 0.8796 2 284
AF-H0SUJ4-F1-model_v4 Transporter 0.8788 2 284
AF-F8BRQ5-F1-model_v4 Transporter 0.8736 2 284
AF-A0A2A5PEN6-F1-model_v4 Transporter 0.726 94 282

Map