F410208

General Info

Members Datasets Scaffolds Average Seq Length
330 189 658 406

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0000469|Ga0466971_0000469_6984_8306
Length 440
Sequence VAVVDVVLLGHGAILPARDARVTGRYPRKARFMKLLARLFRLVWGGDVDRALRPVLAVSLVGSIAGSSAYPFMGIWAIKELGAPQGTLAFAYLFGAVLAGLTGYVGGHLSDRVGRRPLILAGWGFQALVPLALIAVGHHVYVGLGLLAMLPVFGSLGGAADQAMVADLVAPDRHEAAYASVRVASNLGVTIGPPIGGLLLVGSQWTHLWLGTLVLASIGFGIAYRYIPRSGAYAPEGPPERGSFSVIVRDSPFLLFMLASVFATMTYVATETLLPISVTTTHHLAPAAWGFLMILNPLFVTVFQLRLTRRVAHVPASLKLGLAMPMMGVPFLLLDWNGTAPVIALVIVIFVLGEMLWVPTSQAVVAALAPADIRGAYMGAFGGTWSVGWAATPFLGLQVRHAYGDATMWMCVATVGVVAGLLGFAAARGHDADAAVASPA

Samples

Sample ID Description Type Environment
1 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
86 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
87 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
88 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
96 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
108 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
109 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
110 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.12
Rhizosphere 87.58
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466971_0000469 3300044719 Bacteria 15840
2 Ga0070683_100040560 3300005329 Bacteria 4281
3 Ga0070683_100057210 3300005329 Bacteria 3622
4 Ga0070683_100262298 3300005329 Bacteria 1644
5 Ga0070680_100018239 3300005336 Bacteria 5543
6 Ga0070680_100022628 3300005336 Bacteria 5008
7 Ga0070680_100028601 3300005336 Bacteria 4472
8 Ga0070682_100039904 3300005337 Bacteria 2887
9 Ga0070660_100008471 3300005339 Bacteria 7194
10 Ga0070660_100012212 3300005339 Bacteria 6132
11 Ga0070660_100025299 3300005339 Bacteria 4411
12 Ga0070661_100008990 3300005344 Bacteria 6914
13 Ga0070661_100012209 3300005344 Bacteria 6006
14 Ga0070671_100029577 3300005355 Bacteria 4517
15 Ga0070659_100069700 3300005366 Bacteria 2792
16 Ga0070709_10008554 3300005434 Bacteria 5626
17 Ga0070714_100230345 3300005435 Bacteria 1706
18 Ga0070713_100166051 3300005436 Bacteria 1974
19 Ga0070710_10010996 3300005437 Bacteria 4460
20 Ga0070708_100033117 3300005445 Bacteria 4489
21 Ga0070708_100089423 3300005445 Bacteria 2802
22 Ga0070678_100028711 3300005456 Bacteria 3798
23 Ga0070681_10011373 3300005458 Bacteria 8806
24 Ga0070681_10041815 3300005458 Bacteria 4594
25 Ga0070681_10083061 3300005458 Bacteria 3157
26 Ga0070681_10113446 3300005458 Bacteria 2649
27 Ga0070706_100081941 3300005467 Bacteria 2989
28 Ga0070706_100206039 3300005467 Bacteria 1837
29 Ga0070707_100002709 3300005468 Bacteria 16853
30 Ga0070707_100053012 3300005468 Bacteria 3888
31 Ga0070698_100046184 3300005471 Bacteria 4453
32 Ga0070699_100063282 3300005518 Bacteria 3207
33 Ga0070679_100020944 3300005530 Bacteria 6379
34 Ga0070679_100045133 3300005530 Bacteria 4391
35 Ga0070679_100061993 3300005530 Bacteria 3727
36 Ga0070684_100005407 3300005535 Bacteria 9783
37 Ga0070684_100038137 3300005535 Bacteria 4126
38 Ga0070684_100148968 3300005535 Bacteria 2119
39 Ga0070696_100011676 3300005546 Bacteria 5886
40 Ga0070665_100051711 3300005548 Bacteria 4120
41 Ga0070704_100016603 3300005549 Bacteria 4656
42 Ga0068855_100012841 3300005563 Bacteria 10106
43 Ga0068855_100016655 3300005563 Bacteria 8837
44 Ga0068855_100022296 3300005563 Bacteria 7589
45 Ga0068855_100052137 3300005563 Bacteria 4817
46 Ga0068855_100368868 3300005563 Bacteria 1579
47 Ga0068856_100024369 3300005614 Bacteria 5889
48 Ga0068856_100065913 3300005614 Bacteria 3578
49 Ga0068852_100112165 3300005616 Bacteria 2481
50 Ga0068852_100183812 3300005616 Bacteria 1967
51 Ga0081538_10000012 3300005981 Bacteria 153046
52 Ga0081538_10000541 3300005981 Bacteria 41700
53 Ga0081539_10007399 3300005985 Bacteria 10036
54 Ga0075432_10014508 3300006058 Bacteria 2684
55 Ga0070715_10071335 3300006163 Bacteria 1552
56 Ga0070716_100015023 3300006173 Bacteria 3973
57 Ga0070712_100035203 3300006175 Bacteria 3398
58 Ga0070712_100040019 3300006175 Bacteria 3211
59 Ga0070712_100049635 3300006175 Bacteria 2915
60 Ga0075431_100071423 3300006847 Bacteria 3581
61 Ga0075434_100015149 3300006871 Bacteria 7386
62 Ga0075436_100021783 3300006914 Bacteria 4399
63 Ga0075436_100022749 3300006914 Bacteria 4306
64 Ga0075435_100204089 3300007076 Bacteria 1675
65 Ga0105240_10055251 3300009093 Bacteria 4972
66 Ga0105240_10292271 3300009093 Bacteria 1867
67 Ga0111539_10030626 3300009094 Bacteria 6541
68 Ga0114129_10148165 3300009147 Bacteria 3214
69 Ga0114129_10453335 3300009147 Bacteria 1682
70 Ga0105241_10210033 3300009174 Bacteria 1631
71 Ga0105242_10038091 3300009176 Bacteria 3864
72 Ga0105237_10068289 3300009545 Bacteria 3548
73 Ga0105237_10103356 3300009545 Bacteria 2841
74 Ga0105238_10013751 3300009551 Bacteria 8179
75 Ga0105239_10140306 3300010375 Bacteria 2693
76 Ga0157370_10045044 3300013104 Bacteria 4235
77 Ga0157370_10095728 3300013104 Bacteria 2785
78 Ga0157370_10201573 3300013104 Bacteria 1846
79 Ga0157369_10002303 3300013105 Bacteria 22963
80 Ga0157369_10015027 3300013105 Bacteria 8737
81 Ga0157369_10042874 3300013105 Bacteria 4935
82 Ga0157369_10119673 3300013105 Bacteria 2795
83 Ga0157369_10440683 3300013105 Bacteria 1349
84 Ga0157374_10203535 3300013296 Bacteria 1939
85 Ga0157372_10245121 3300013307 Bacteria 2080
86 Ga0157372_10428703 3300013307 Unclassified 1541
87 Ga0206353_11455507 3300020082 Bacteria 4366
88 Ga0206353_11548455 3300020082 Bacteria 5480
89 Ga0207705_10022323 3300025909 Bacteria 4513
90 Ga0207705_10096413 3300025909 Bacteria 2171
91 Ga0207705_10142955 3300025909 Unclassified 1788
92 Ga0207684_10099648 3300025910 Bacteria 2482
93 Ga0207707_10003519 3300025912 Bacteria 13867
94 Ga0207707_10009500 3300025912 Bacteria 8438
95 Ga0207707_10201964 3300025912 Unclassified 1733
96 Ga0207707_10381297 3300025912 Bacteria 1212
97 Ga0207695_10190937 3300025913 Bacteria 1966
98 Ga0207695_10333103 3300025913 Bacteria 1406
99 Ga0207693_10001803 3300025915 Bacteria 18783
100 Ga0207693_10029592 3300025915 Bacteria 4324
101 Ga0207663_10091468 3300025916 Bacteria 2020
102 Ga0207663_10141181 3300025916 Bacteria 1678
103 Ga0207660_10006022 3300025917 Bacteria 7872
104 Ga0207660_10006989 3300025917 Bacteria 7309
105 Ga0207660_10055775 3300025917 Bacteria 2825
106 Ga0207660_10069973 3300025917 Unclassified 2550
107 Ga0207657_10000964 3300025919 Bacteria 30488
108 Ga0207657_10005129 3300025919 Bacteria 13727
109 Ga0207657_10006273 3300025919 Bacteria 12358
110 Ga0207657_10019162 3300025919 Bacteria 6507
111 Ga0207652_10016334 3300025921 Bacteria 6059
112 Ga0207646_10018113 3300025922 Bacteria 6573
113 Ga0207646_10212901 3300025922 Unclassified 1745
114 Ga0207694_10045674 3300025924 Bacteria 3383
115 Ga0207664_10036539 3300025929 Bacteria 3797
116 Ga0207644_10105048 3300025931 Bacteria 2127
117 Ga0207665_10006182 3300025939 Bacteria 7951
118 Ga0207665_10027108 3300025939 Bacteria 3785
119 Ga0207661_10050652 3300025944 Bacteria 3310
120 Ga0207661_10078061 3300025944 Bacteria 2724
121 Ga0207661_10178695 3300025944 Bacteria 1852
122 Ga0207667_10037484 3300025949 Bacteria 5181
123 Ga0207667_10136180 3300025949 Bacteria 2529
124 Ga0207667_10185263 3300025949 Bacteria 2137
125 Ga0207667_10259177 3300025949 Bacteria 1778
126 Ga0207712_10268450 3300025961 Bacteria 1387
127 Ga0207678_10081335 3300026067 Bacteria 2773
128 Ga0207702_10027550 3300026078 Bacteria 4719
129 Ga0207674_10041497 3300026116 Bacteria 4759
130 Ga0207674_10084752 3300026116 Bacteria 3166
131 Ga0207674_10236509 3300026116 Bacteria 1774
132 Ga0207683_10011899 3300026121 Bacteria 7425
133 Ga0207683_10037902 3300026121 Bacteria 4199
134 Ga0207698_10077666 3300026142 Bacteria 2663
135 Ga0207428_10124035 3300027907 Bacteria 1979
136 Ga0268266_10022553 3300028379 Bacteria 5363
137 Ga0265338_10030316 3300028800 Bacteria 5331
138 Ga0265338_10073094 3300028800 Bacteria 2924
139 Ga0265325_10010118 3300031241 Bacteria 5477
140 Ga0265339_10016391 3300031249 Bacteria 4418
141 Ga0265327_10033181 3300031251 Bacteria 2880
142 Ga0265316_10072474 3300031344 Bacteria 2653
143 Ga0265313_10015452 3300031595 Bacteria 4441
144 Ga0265314_10008957 3300031711 Bacteria 8517
145 Ga0265342_10025929 3300031712 Bacteria 3679
146 Ga0307415_100033033 3300032126 Bacteria 3355
147 Ga0373926_0026260 3300035083 Bacteria 2036
148 Ga0373928_0012940 3300035084 Bacteria 1671
149 Ga0373940_0009072 3300035088 Bacteria 2302
150 Ga0373944_0007465 3300035089 Bacteria 2933
151 Ga0373951_0023280 3300035091 Bacteria 1430
152 Ga0373936_0015074 3300035113 Bacteria 2960
153 Ga0373939_0003728 3300035114 Bacteria 3590
154 Ga0373945_0002007 3300035116 Bacteria 6328
155 Ga0373945_0009710 3300035116 Bacteria 3157
156 Ga0373960_0007117 3300035121 Bacteria 2642
157 Ga0373943_0005277 3300035170 Bacteria 5814
158 Ga0373943_0009624 3300035170 Bacteria 4330
159 Ga0373946_0000950 3300035171 Bacteria 9916
160 Ga0373942_0019653 3300035207 Bacteria 1688
161 Ga0373961_0026434 3300035241 Bacteria 1586
162 Ga0373931_0025893 3300035691 Bacteria 2980
163 Ga0373935_0035080 3300035692 Bacteria 3130
164 Ga0373935_0046128 3300035692 Bacteria 2752
165 Ga0373947_0001964 3300035725 Bacteria 12587
166 Ga0395899_0001351 3300037312 Bacteria 21115
167 Ga0395899_0026144 3300037312 Bacteria 4406
168 Ga0395900_0001626 3300037418 Bacteria 26408
169 Ga0395900_0005467 3300037418 Bacteria 13302
170 Ga0395900_0018972 3300037418 Bacteria 7015
171 Ga0395900_0133344 3300037418 Archaea 2545
172 Ga0395900_0146606 3300037418 Bacteria 2413
173 Ga0395898_0005712 3300037466 Bacteria 13405
174 Ga0395898_0012216 3300037466 Bacteria 8880
175 Ga0395898_0076771 3300037466 Bacteria 3225
176 Ga0395898_0078240 3300037466 Bacteria 3191
177 Ga0395905_0030084 3300037471 Bacteria 5118
178 Ga0395905_0064120 3300037471 Bacteria 3437
179 Ga0395905_0130549 3300037471 Bacteria 2363
180 Ga0395905_0138859 3300037471 Bacteria 2287
181 Ga0395905_0149478 3300037471 Bacteria 2197
182 Ga0395901_0000244 3300038443 Bacteria 67684
183 Ga0395901_0006504 3300038443 Bacteria 11825
184 Ga0395901_0009655 3300038443 Bacteria 9787
185 Ga0395901_0039903 3300038443 Bacteria 4860
186 Ga0395901_0082007 3300038443 Bacteria 3369
187 Ga0395901_0118642 3300038443 Unclassified 2780
188 Ga0395901_0205688 3300038443 Bacteria 2062
189 Ga0395901_0206580 3300038443 Bacteria 2057
190 Ga0242420_000471 3300038996 Bacteria 4571
191 Ga0436363_0108127 3300039450 Bacteria 4441
192 Ga0439439_0004701 3300041406 Bacteria 3086
193 Ga0451802_0701561 3300041460 Bacteria 1540
194 Ga0439431_0004909 3300041997 Bacteria 2949
195 Ga0439433_0002262 3300041999 Bacteria 4070
196 Ga0439448_0060667 3300042005 Unclassified 1250
197 Ga0439446_0001268 3300042156 Bacteria 5676
198 Ga0439434_0008774 3300042435 Bacteria 2970
199 Ga0466961_0003168 3300044693 Bacteria 10245
200 Ga0466961_0036972 3300044693 Bacteria 3133
201 Ga0466961_0045803 3300044693 Bacteria 2798
202 Ga0466961_0112901 3300044693 Unclassified 1709
203 Ga0466963_0001137 3300044694 Bacteria 13906
204 Ga0466963_0002621 3300044694 Bacteria 10100
205 Ga0466963_0028319 3300044694 Bacteria 3596
206 Ga0466963_0032670 3300044694 Bacteria 3372
207 Ga0466963_0037365 3300044694 Bacteria 3170
208 Ga0466964_0003114 3300044706 Bacteria 6030
209 Ga0466971_0017216 3300044719 Bacteria 3195
210 Ga0466970_0008011 3300044765 Bacteria 5305
211 Ga0466957_0004662 3300044842 Bacteria 7662
212 Ga0466957_0010915 3300044842 Bacteria 5224
213 Ga0466957_0020684 3300044842 Bacteria 3873
214 Ga0466960_0033138 3300044901 Bacteria 2399
215 Ga0466959_0004921 3300045049 Bacteria 9047
216 Ga0466959_0021004 3300045049 Bacteria 4814
217 Ga0466959_0119882 3300045049 Bacteria 1871
218 Ga0466958_0001601 3300045836 Bacteria 10877
219 Ga0466958_0010873 3300045836 Bacteria 5111
220 Ga0466958_0116220 3300045836 Bacteria 1672
221 Ga0466967_0012646 3300045976 Bacteria 6472
222 Ga0466967_0018416 3300045976 Bacteria 5579
223 Ga0466967_0022820 3300045976 Bacteria 5116
224 Ga0466967_0029693 3300045976 Bacteria 4579
225 Ga0466967_0032572 3300045976 Bacteria 4402
226 Ga0466967_0042853 3300045976 Bacteria 3914
227 Ga0466967_0047797 3300045976 Bacteria 3732
228 Ga0495629_0001172 3300046459 Bacteria 20684
229 Ga0495629_0072043 3300046459 Bacteria 2412
230 Ga0495629_0073728 3300046459 Unclassified 2383
231 Ga0495651_0139935 3300046462 Unclassified 1756
232 Ga0495653_0088926 3300046463 Bacteria 2264
233 Ga0495653_0089196 3300046463 Bacteria 2260
234 Ga0495582_0014796 3300046473 Bacteria 4286
235 Ga0495639_0026766 3300046475 Bacteria 2550
236 Ga0495662_0002670 3300046476 Bacteria 9011
237 Ga0495662_0038842 3300046476 Bacteria 2300
238 Ga0495628_0073470 3300046516 Unclassified 2664
239 Ga0495630_0044810 3300046517 Bacteria 3306
240 Ga0495652_0269773 3300046529 Bacteria 1251
241 Ga0495665_0000572 3300046531 Bacteria 18699
242 Ga0495640_0101463 3300046533 Bacteria 1888
243 Ga0495667_0017567 3300046559 Bacteria 4832
244 Ga0495635_0017186 3300046663 Bacteria 5051
245 Ga0495635_0059073 3300046663 Bacteria 2637
246 Ga0495646_0075889 3300046680 Bacteria 1970
247 Ga0495658_0002818 3300046683 Bacteria 8732
248 Ga0495658_0004955 3300046683 Bacteria 6534
249 Ga0495613_0002807 3300046689 Bacteria 13069
250 Ga0495624_0003083 3300046690 Bacteria 12472
251 Ga0495600_0105571 3300046809 Unclassified 1835
252 Ga0495581_0001629 3300047315 Bacteria 12517
253 Ga0495604_0079370 3300047317 Bacteria 2461
254 Ga0495674_0071641 3300047319 Bacteria 2990
255 Ga0495676_0033632 3300047321 Bacteria 4314
256 Ga0495680_0040309 3300047322 Bacteria 3721
257 Ga0495684_0003459 3300047471 Bacteria 12362
258 Ga0495684_0045616 3300047471 Bacteria 3354
259 Ga0495593_0016863 3300047673 Bacteria 4112
260 Ga0496100_0029947 3300048903 Bacteria 3371
261 Ga0496100_0031736 3300048903 Bacteria 3287
262 Ga0496100_0058799 3300048903 Bacteria 2524
263 Ga0496100_0142119 3300048903 Bacteria 1702
264 Ga0496101_0002848 3300048904 Bacteria 10634
265 Ga0496101_0009732 3300048904 Bacteria 6327
266 Ga0496101_0074246 3300048904 Bacteria 2500
267 Ga0496101_0093300 3300048904 Unclassified 2242
268 Ga0496101_0096160 3300048904 Bacteria 2210
269 Ga0496102_0082766 3300048905 Bacteria 2960
270 Ga0496102_0109381 3300048905 Bacteria 2575
271 Ga0496102_0146001 3300048905 Bacteria 2220
272 Ga0496103_0003789 3300048906 Bacteria 9197
273 Ga0496103_0100575 3300048906 Bacteria 1830
274 Ga0496104_0005264 3300048907 Bacteria 11308
275 Ga0496104_0018343 3300048907 Bacteria 6385
276 Ga0496104_0071653 3300048907 Bacteria 3295
277 Ga0496105_0000413 3300048908 Bacteria 28035
278 Ga0496106_0076131 3300048909 Bacteria 2571
279 Ga0496107_0002348 3300048910 Bacteria 12224
280 Ga0496107_0018083 3300048910 Bacteria 4958
281 Ga0496107_0056299 3300048910 Bacteria 2841
282 Ga0496107_0081514 3300048910 Bacteria 2360
283 Ga0496108_0193772 3300048911 Unclassified 1762
284 Ga0496109_0029868 3300048912 Bacteria 4884
285 Ga0496109_0056820 3300048912 Bacteria 3571
286 Ga0496109_0059258 3300048912 Bacteria 3497
287 Ga0496109_0116585 3300048912 Bacteria 2486
288 Ga0496112_0000766 3300048915 Bacteria 22600
289 Ga0496112_0014425 3300048915 Bacteria 7330
290 Ga0496112_0016051 3300048915 Bacteria 7003
291 Ga0496112_0147006 3300048915 Bacteria 2325
292 Ga0496113_0026625 3300048916 Bacteria 4137
293 Ga0496113_0082034 3300048916 Bacteria 2472
294 Ga0496114_0001026 3300048917 Bacteria 20985
295 Ga0496114_0003757 3300048917 Bacteria 11703
296 Ga0496114_0008425 3300048917 Bacteria 8165
297 Ga0496115_0000307 3300048918 Bacteria 41675
298 Ga0496115_0059087 3300048918 Bacteria 3087
299 Ga0501031_0001993 3300049568 Bacteria 12892
300 Ga0501033_0007054 3300049570 Bacteria 8772
301 Ga0501036_0012771 3300049572 Bacteria 6966
302 Ga0501038_0005251 3300049574 Bacteria 12042
303 Ga0501039_0005473 3300049575 Bacteria 9605
304 Ga0501041_0030832 3300049577 Bacteria 3236
305 Ga0501042_0023780 3300049578 Bacteria 4291
306 Ga0501046_0004402 3300049580 Bacteria 12788
307 Ga0501046_0135429 3300049580 Bacteria 1866
308 Ga0501048_0002455 3300049582 Bacteria 14141
309 Ga0501067_0001127 3300049583 Bacteria 14464
310 Ga0501068_0002519 3300049584 Bacteria 9729
311 Ga0501069_0000287 3300049585 Bacteria 22953
312 Ga0501069_0003627 3300049585 Bacteria 7947
313 Ga0501071_0045666 3300049587 Bacteria 3144
314 Ga0501072_0124738 3300049588 Bacteria 2051
315 Ga0501073_0091557 3300049589 Bacteria 2114
316 Ga0501075_0005465 3300049591 Bacteria 8686
317 Ga0501076_0007544 3300049592 Bacteria 7917
318 Ga0501080_0262076 3300049742 Bacteria 1574
319 Ga0501035_0051404 3300049822 Bacteria 3690
320 Ga0501045_0009101 3300049824 Bacteria 6936
321 nmdc:mga05p37_177874_c1 3300050507 Bacteria 2591
322 nmdc:mga0n895_13593_c1 3300050512 Bacteria 7354
323 nmdc:mga0n895_282322_c1 3300050512 Bacteria 1684
324 nmdc:mga08x19_63957_c1 3300050514 Unclassified 2388
325 Ga0495655_0000926 3300053083 Bacteria 4564
326 Ga0495595_0005011 3300053084 Bacteria 5348
327 Ga0495619_0003130 3300053085 Bacteria 10733
328 Ga0466962_0012256 3300061719 Bacteria 4121
329 Ga0530510_0015566 3300061734 Bacteria 5376
330 Ga0466971_0000469
331 Ga0070683_100040560
332 Ga0070683_100057210
333 Ga0070683_100262298
334 Ga0070680_100018239
335 Ga0070680_100022628
336 Ga0070680_100028601
337 Ga0070682_100039904
338 Ga0070660_100008471
339 Ga0070660_100012212
340 Ga0070660_100025299
341 Ga0070661_100008990
342 Ga0070661_100012209
343 Ga0070671_100029577
344 Ga0070659_100069700
345 Ga0070709_10008554
346 Ga0070714_100230345
347 Ga0070713_100166051
348 Ga0070710_10010996
349 Ga0070708_100033117
350 Ga0070708_100089423
351 Ga0070678_100028711
352 Ga0070681_10011373
353 Ga0070681_10041815
354 Ga0070681_10083061
355 Ga0070681_10113446
356 Ga0070706_100081941
357 Ga0070706_100206039
358 Ga0070707_100002709
359 Ga0070707_100053012
360 Ga0070698_100046184
361 Ga0070699_100063282
362 Ga0070679_100020944
363 Ga0070679_100045133
364 Ga0070679_100061993
365 Ga0070684_100005407
366 Ga0070684_100038137
367 Ga0070684_100148968
368 Ga0070696_100011676
369 Ga0070665_100051711
370 Ga0070704_100016603
371 Ga0068855_100012841
372 Ga0068855_100016655
373 Ga0068855_100022296
374 Ga0068855_100052137
375 Ga0068855_100368868
376 Ga0068856_100024369
377 Ga0068856_100065913
378 Ga0068852_100112165
379 Ga0068852_100183812
380 Ga0081538_10000012
381 Ga0081538_10000541
382 Ga0081539_10007399
383 Ga0075432_10014508
384 Ga0070715_10071335
385 Ga0070716_100015023
386 Ga0070712_100035203
387 Ga0070712_100040019
388 Ga0070712_100049635
389 Ga0075431_100071423
390 Ga0075434_100015149
391 Ga0075436_100021783
392 Ga0075436_100022749
393 Ga0075435_100204089
394 Ga0105240_10055251
395 Ga0105240_10292271
396 Ga0111539_10030626
397 Ga0114129_10148165
398 Ga0114129_10453335
399 Ga0105241_10210033
400 Ga0105242_10038091
401 Ga0105237_10068289
402 Ga0105237_10103356
403 Ga0105238_10013751
404 Ga0105239_10140306
405 Ga0157370_10045044
406 Ga0157370_10095728
407 Ga0157370_10201573
408 Ga0157369_10002303
409 Ga0157369_10015027
410 Ga0157369_10042874
411 Ga0157369_10119673
412 Ga0157369_10440683
413 Ga0157374_10203535
414 Ga0157372_10245121
415 Ga0157372_10428703
416 Ga0206353_11455507
417 Ga0206353_11548455
418 Ga0207705_10022323
419 Ga0207705_10096413
420 Ga0207705_10142955
421 Ga0207684_10099648
422 Ga0207707_10003519
423 Ga0207707_10009500
424 Ga0207707_10201964
425 Ga0207707_10381297
426 Ga0207695_10190937
427 Ga0207695_10333103
428 Ga0207693_10001803
429 Ga0207693_10029592
430 Ga0207663_10091468
431 Ga0207663_10141181
432 Ga0207660_10006022
433 Ga0207660_10006989
434 Ga0207660_10055775
435 Ga0207660_10069973
436 Ga0207657_10000964
437 Ga0207657_10005129
438 Ga0207657_10006273
439 Ga0207657_10019162
440 Ga0207652_10016334
441 Ga0207646_10018113
442 Ga0207646_10212901
443 Ga0207694_10045674
444 Ga0207664_10036539
445 Ga0207644_10105048
446 Ga0207665_10006182
447 Ga0207665_10027108
448 Ga0207661_10050652
449 Ga0207661_10078061
450 Ga0207661_10178695
451 Ga0207667_10037484
452 Ga0207667_10136180
453 Ga0207667_10185263
454 Ga0207667_10259177
455 Ga0207712_10268450
456 Ga0207678_10081335
457 Ga0207702_10027550
458 Ga0207674_10041497
459 Ga0207674_10084752
460 Ga0207674_10236509
461 Ga0207683_10011899
462 Ga0207683_10037902
463 Ga0207698_10077666
464 Ga0207428_10124035
465 Ga0268266_10022553
466 Ga0265338_10030316
467 Ga0265338_10073094
468 Ga0265325_10010118
469 Ga0265339_10016391
470 Ga0265327_10033181
471 Ga0265316_10072474
472 Ga0265313_10015452
473 Ga0265314_10008957
474 Ga0265342_10025929
475 Ga0307415_100033033
476 Ga0373926_0026260
477 Ga0373928_0012940
478 Ga0373940_0009072
479 Ga0373944_0007465
480 Ga0373951_0023280
481 Ga0373936_0015074
482 Ga0373939_0003728
483 Ga0373945_0002007
484 Ga0373945_0009710
485 Ga0373960_0007117
486 Ga0373943_0005277
487 Ga0373943_0009624
488 Ga0373946_0000950
489 Ga0373942_0019653
490 Ga0373961_0026434
491 Ga0373931_0025893
492 Ga0373935_0035080
493 Ga0373935_0046128
494 Ga0373947_0001964
495 Ga0395899_0001351
496 Ga0395899_0026144
497 Ga0395900_0001626
498 Ga0395900_0005467
499 Ga0395900_0018972
500 Ga0395900_0133344
501 Ga0395900_0146606
502 Ga0395898_0005712
503 Ga0395898_0012216
504 Ga0395898_0076771
505 Ga0395898_0078240
506 Ga0395905_0030084
507 Ga0395905_0064120
508 Ga0395905_0130549
509 Ga0395905_0138859
510 Ga0395905_0149478
511 Ga0395901_0000244
512 Ga0395901_0006504
513 Ga0395901_0009655
514 Ga0395901_0039903
515 Ga0395901_0082007
516 Ga0395901_0118642
517 Ga0395901_0205688
518 Ga0395901_0206580
519 Ga0242420_000471
520 Ga0436363_0108127
521 Ga0439439_0004701
522 Ga0451802_0701561
523 Ga0439431_0004909
524 Ga0439433_0002262
525 Ga0439448_0060667
526 Ga0439446_0001268
527 Ga0439434_0008774
528 Ga0466961_0003168
529 Ga0466961_0036972
530 Ga0466961_0045803
531 Ga0466961_0112901
532 Ga0466963_0001137
533 Ga0466963_0002621
534 Ga0466963_0028319
535 Ga0466963_0032670
536 Ga0466963_0037365
537 Ga0466964_0003114
538 Ga0466971_0017216
539 Ga0466970_0008011
540 Ga0466957_0004662
541 Ga0466957_0010915
542 Ga0466957_0020684
543 Ga0466960_0033138
544 Ga0466959_0004921
545 Ga0466959_0021004
546 Ga0466959_0119882
547 Ga0466958_0001601
548 Ga0466958_0010873
549 Ga0466958_0116220
550 Ga0466967_0012646
551 Ga0466967_0018416
552 Ga0466967_0022820
553 Ga0466967_0029693
554 Ga0466967_0032572
555 Ga0466967_0042853
556 Ga0466967_0047797
557 Ga0495629_0001172
558 Ga0495629_0072043
559 Ga0495629_0073728
560 Ga0495651_0139935
561 Ga0495653_0088926
562 Ga0495653_0089196
563 Ga0495582_0014796
564 Ga0495639_0026766
565 Ga0495662_0002670
566 Ga0495662_0038842
567 Ga0495628_0073470
568 Ga0495630_0044810
569 Ga0495652_0269773
570 Ga0495665_0000572
571 Ga0495640_0101463
572 Ga0495667_0017567
573 Ga0495635_0017186
574 Ga0495635_0059073
575 Ga0495646_0075889
576 Ga0495658_0002818
577 Ga0495658_0004955
578 Ga0495613_0002807
579 Ga0495624_0003083
580 Ga0495600_0105571
581 Ga0495581_0001629
582 Ga0495604_0079370
583 Ga0495674_0071641
584 Ga0495676_0033632
585 Ga0495680_0040309
586 Ga0495684_0003459
587 Ga0495684_0045616
588 Ga0495593_0016863
589 Ga0496100_0029947
590 Ga0496100_0031736
591 Ga0496100_0058799
592 Ga0496100_0142119
593 Ga0496101_0002848
594 Ga0496101_0009732
595 Ga0496101_0074246
596 Ga0496101_0093300
597 Ga0496101_0096160
598 Ga0496102_0082766
599 Ga0496102_0109381
600 Ga0496102_0146001
601 Ga0496103_0003789
602 Ga0496103_0100575
603 Ga0496104_0005264
604 Ga0496104_0018343
605 Ga0496104_0071653
606 Ga0496105_0000413
607 Ga0496106_0076131
608 Ga0496107_0002348
609 Ga0496107_0018083
610 Ga0496107_0056299
611 Ga0496107_0081514
612 Ga0496108_0193772
613 Ga0496109_0029868
614 Ga0496109_0056820
615 Ga0496109_0059258
616 Ga0496109_0116585
617 Ga0496112_0000766
618 Ga0496112_0014425
619 Ga0496112_0016051
620 Ga0496112_0147006
621 Ga0496113_0026625
622 Ga0496113_0082034
623 Ga0496114_0001026
624 Ga0496114_0003757
625 Ga0496114_0008425
626 Ga0496115_0000307
627 Ga0496115_0059087
628 Ga0501031_0001993
629 Ga0501033_0007054
630 Ga0501036_0012771
631 Ga0501038_0005251
632 Ga0501039_0005473
633 Ga0501041_0030832
634 Ga0501042_0023780
635 Ga0501046_0004402
636 Ga0501046_0135429
637 Ga0501048_0002455
638 Ga0501067_0001127
639 Ga0501068_0002519
640 Ga0501069_0000287
641 Ga0501069_0003627
642 Ga0501071_0045666
643 Ga0501072_0124738
644 Ga0501073_0091557
645 Ga0501075_0005465
646 Ga0501076_0007544
647 Ga0501080_0262076
648 Ga0501035_0051404
649 Ga0501045_0009101
650 nmdc:mga05p37_177874_c1
651 nmdc:mga0n895_13593_c1
652 nmdc:mga0n895_282322_c1
653 nmdc:mga08x19_63957_c1
654 Ga0495655_0000926
655 Ga0495595_0005011
656 Ga0495619_0003130
657 Ga0466962_0012256
658 Ga0530510_0015566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

39

393

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.8082 17 381
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.797 17 375
6lyy-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. 0.7897 17 381
3wdo-assembly1.cif.gz_A structure of e. coli yajr transporter 0.7859 16 374
6t1z-assembly1.cif.gz_A lmrp from l. lactis, in an outward-open conformation, bound to hoechst 33342 0.7823 9 384
ID Description Score Start End Superfamily
af_Q2FXH1_197_391_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9202 211 375 1.20.1250.20
af_Q9VPD9_294_503_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8791 207 374 1.20.1250.20
af_O06171_250_435_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8656 15 190 1.20.1250.20
af_Q9VY22_125_509_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8636 45 379 1.20.1250.20
af_P31126_1_382_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8574 14 375 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A841FY57-F1-model_v4 MFS family permease 0.8929 16 377 GO:0016020
GO:0022857
AF-A0A2S3U1Y4-F1-model_v4 Putative MFS-type transporter YceJ 0.8915 42 382 GO:0005886
GO:0022857
AF-A0A1H0VZU4-F1-model_v4 deleted 0.8805 13 379
AF-A0A1S3HNG2-F1-model_v4 Synaptic vesicular amine transporter-like 0.8784 45 376 GO:0016020
GO:0022857
AF-A0A523NBX1-F1-model_v4 MFS transporter 0.8759 12 376 GO:0016020
GO:0022857

Map