F410202

General Info

Members Datasets Scaffolds Average Seq Length
330 236 317 204

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0000718|Ga0453683_0000718_24280_25002
Length 240
Sequence MKRRNFIRSTVLGGALAAIPAGNLISSLITTTQPKEHTAMPFTLPELPYAHDALEPYIDKQTMEIHHGKHHAAYVTNLNKALEGNEWASKSIEDILANISKLPMAVRNNGGGHYNHSLFWNIMKVNGGAVPGGDLGAAITRDFGSFDKFKEQFAAAGATRFGSGWAWLISQHGKLVVASTPNQDNPMMDIAETKGVPVLGMDVWEHAYYLKYQNRRPDYIAAFWNVVNWDEVAKRYAAAK

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
3 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
4 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
5 2842682962 Bacillus sp. R-72492 Isolate Unclassified
6 2849139964 Bacillus sp. R-71875 Isolate Unclassified
7 2857581216 Bacillus sp. R-71922 Isolate Unclassified
8 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
9 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
10 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
11 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
12 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
13 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
76 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
114 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
123 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
132 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
136 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
137 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
138 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
199 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
219 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
220 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
226 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.7
Metatranscriptomes 16.36
Isolates 3.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 3.03
Rhizosphere 87.27
Stem 0
Stem Tuber 0
Unclassified 8.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10078762 3300003320 Bacteria 2749
2 rootL2_10009973 3300003322 Bacteria 6689
3 rootL2_10299127 3300003322 Bacteria 2361
4 Ga0055532_1000546 3300003758 Bacteria 16044
5 Ga0055531_10000110 3300003794 Bacteria 89725
6 Ga0058861_10019557 3300004800 Bacteria 1092
7 Ga0070670_100748805 3300005331 Bacteria 880
8 Ga0068869_100129605 3300005334 Bacteria 1937
9 Ga0070666_10000106 3300005335 Bacteria 57218
10 Ga0068868_100149832 3300005338 Bacteria 1920
11 Ga0070668_100102277 3300005347 Bacteria 2272
12 Ga0070671_100037209 3300005355 Bacteria 4036
13 Ga0070673_100077239 3300005364 Bacteria 2691
14 Ga0070714_100116491 3300005435 Bacteria 2372
15 Ga0070713_100814091 3300005436 Bacteria 896
16 Ga0070701_10340326 3300005438 Bacteria 934
17 Ga0070705_100533944 3300005440 Bacteria 896
18 Ga0068867_101089856 3300005459 Bacteria 729
19 Ga0070698_100046034 3300005471 Bacteria 4461
20 Ga0070672_100521303 3300005543 Bacteria 1030
21 Ga0070686_100047898 3300005544 Bacteria 2705
22 Ga0070704_100468340 3300005549 Bacteria 1088
23 Ga0068855_100100612 3300005563 Bacteria 3328
24 Ga0068852_100015845 3300005616 Bacteria 5862
25 Ga0068859_100000024 3300005617 Bacteria 217931
26 Ga0068859_100293054 3300005617 Bacteria 1720
27 Ga0068864_100003921 3300005618 Bacteria 12256
28 Ga0068861_100497135 3300005719 Bacteria 1102
29 Ga0068861_101126295 3300005719 Bacteria 755
30 Ga0068851_10109814 3300005834 Bacteria 1471
31 Ga0068863_100014236 3300005841 Bacteria 7664
32 Ga0068858_100001879 3300005842 Bacteria 21434
33 Ga0068860_100012877 3300005843 Bacteria 8221
34 Ga0068860_100672800 3300005843 Bacteria 1044
35 Ga0070717_10075729 3300006028 Bacteria 2815
36 Ga0070717_10094277 3300006028 Bacteria 2532
37 Ga0097621_100540419 3300006237 Bacteria 1060
38 Ga0068871_100386649 3300006358 Bacteria 1244
39 Ga0075428_100008155 3300006844 Bacteria 11628
40 Ga0075428_100122727 3300006844 Bacteria 2828
41 Ga0075433_10162670 3300006852 Bacteria 1986
42 Ga0075433_10229158 3300006852 Bacteria 1650
43 Ga0075429_100101109 3300006880 Bacteria 2517
44 Ga0075429_100110101 3300006880 Bacteria 2407
45 Ga0097620_100000024 3300006931 Bacteria 217931
46 Ga0097620_100293050 3300006931 Bacteria 1720
47 Ga0105251_10000697 3300009011 Bacteria 31001
48 Ga0105244_10124573 3300009036 Bacteria 1246
49 Ga0111539_10265494 3300009094 Bacteria 1998
50 Ga0114129_10063935 3300009147 Bacteria 5135
51 Ga0114129_10136983 3300009147 Bacteria 3359
52 Ga0105243_10640858 3300009148 Bacteria 1028
53 Ga0105241_10007343 3300009174 Bacteria 8105
54 Ga0105242_10886990 3300009176 Bacteria 891
55 Ga0105248_10537927 3300009177 Bacteria 1318
56 Ga0105237_10002723 3300009545 Bacteria 21571
57 Ga0105237_10686258 3300009545 Bacteria 1031
58 Ga0105249_10001970 3300009553 Bacteria 17816
59 Ga0105249_10170481 3300009553 Bacteria 2110
60 Ga0105249_10310817 3300009553 Bacteria 1584
61 Ga0105249_10341979 3300009553 Bacteria 1513
62 Ga0105239_10033631 3300010375 Bacteria 5630
63 Ga0105239_10065548 3300010375 Bacteria 3989
64 Ga0157373_10012349 3300013100 Bacteria 6280
65 Ga0157371_10004044 3300013102 Bacteria 12973
66 Ga0157370_10218154 3300013104 Bacteria 1767
67 Ga0157370_10269657 3300013104 Bacteria 1573
68 Ga0157378_10202633 3300013297 Bacteria 1877
69 Ga0157378_10436256 3300013297 Bacteria 1297
70 Ga0163162_10002370 3300013306 Bacteria 17715
71 Ga0163162_10042035 3300013306 Bacteria 4574
72 Ga0157375_10021938 3300013308 Bacteria 5869
73 Ga0157375_11621548 3300013308 Bacteria 765
74 Ga0163163_10215474 3300014325 Bacteria 1969
75 Ga0157380_10261516 3300014326 Bacteria 1572
76 Ga0157380_10495530 3300014326 Bacteria 1185
77 Ga0182008_10002853 3300014497 Bacteria 10702
78 Ga0157379_10098338 3300014968 Bacteria 2627
79 Ga0182006_1020291 3300015261 Bacteria 2785
80 Ga0182007_10006799 3300015262 Bacteria 4868
81 Ga0206349_1971295 3300020075 Bacteria 852
82 Ga0206355_1647993 3300020076 Bacteria 700
83 Ga0206351_10057679 3300020077 Bacteria 692
84 Ga0206351_10306747 3300020077 Bacteria 860
85 Ga0206351_10735540 3300020077 Bacteria 722
86 Ga0206352_10062450 3300020078 Bacteria 696
87 Ga0206352_10125966 3300020078 Bacteria 9075
88 Ga0206350_10673252 3300020080 Bacteria 846
89 Ga0206350_10815981 3300020080 Bacteria 787
90 Ga0206353_10516619 3300020082 Bacteria 835
91 Ga0154015_1139239 3300020610 Bacteria 802
92 Ga0154015_1184269 3300020610 Bacteria 738
93 Ga0224712_10001958 3300022467 Bacteria 4976
94 Ga0224712_10110776 3300022467 Bacteria 1177
95 Ga0224712_10266680 3300022467 Bacteria 794
96 Ga0209147_100029 3300025229 Bacteria 376498
97 Ga0209257_1000006 3300025304 Bacteria 1570111
98 Ga0207655_1001182 3300025728 Bacteria 25333
99 Ga0207713_1000138 3300025735 Bacteria 111150
100 Ga0207710_10273049 3300025900 Bacteria 849
101 Ga0207680_10000024 3300025903 Bacteria 82106
102 Ga0207647_10020475 3300025904 Bacteria 4435
103 Ga0207654_10002300 3300025911 Bacteria 9798
104 Ga0207707_10010200 3300025912 Bacteria 8154
105 Ga0207671_10004009 3300025914 Bacteria 14306
106 Ga0207652_10334353 3300025921 Bacteria 1368
107 Ga0207700_10169677 3300025928 Bacteria 1819
108 Ga0207700_10172226 3300025928 Bacteria 1807
109 Ga0207700_10680375 3300025928 Bacteria 918
110 Ga0207664_10026777 3300025929 Bacteria 4362
111 Ga0207664_10051022 3300025929 Bacteria 3265
112 Ga0207670_10242921 3300025936 Bacteria 1388
113 Ga0207691_10211446 3300025940 Bacteria 1684
114 Ga0207689_10002373 3300025942 Bacteria 17589
115 Ga0207651_10281643 3300025960 Bacteria 1374
116 Ga0207712_10004440 3300025961 Bacteria 8860
117 Ga0207712_10119246 3300025961 Bacteria 1993
118 Ga0207712_10304673 3300025961 Bacteria 1309
119 Ga0207668_10153831 3300025972 Bacteria 1784
120 Ga0207658_10081927 3300025986 Bacteria 2476
121 Ga0207703_10001036 3300026035 Bacteria 26636
122 Ga0207641_10000058 3300026088 Bacteria 166385
123 Ga0207648_10736752 3300026089 Bacteria 915
124 Ga0207676_10002016 3300026095 Bacteria 14781
125 Ga0207675_100488999 3300026118 Bacteria 1224
126 Ga0207675_100600172 3300026118 Bacteria 1104
127 Ga0207698_10014252 3300026142 Bacteria 5278
128 Ga0268264_10001732 3300028381 Bacteria 20053
129 Ga0268264_10665168 3300028381 Bacteria 1032
130 Ga0265322_10000052 3300028654 Bacteria 58413
131 Ga0307515_10110628 3300028794 Bacteria 3213
132 Ga0307408_100011084 3300031548 Bacteria 5953
133 Ga0307508_10090609 3300031616 Bacteria 2645
134 Ga0316575_10017355 3300031665 Bacteria 2733
135 Ga0316579_10002338 3300031691 Bacteria 7163
136 Ga0316578_10031094 3300031728 Bacteria 3039
137 Ga0307516_10199090 3300031730 Bacteria 1724
138 Ga0307405_10206999 3300031731 Bacteria 1429
139 Ga0316577_10001872 3300031733 Bacteria 10168
140 Ga0307412_10483627 3300031911 Bacteria 1027
141 Ga0307409_100053823 3300031995 Bacteria 3095
142 Ga0307416_100008312 3300032002 Bacteria 6684
143 Ga0316585_10005323 3300032137 Bacteria 3629
144 Ga0316593_10080886 3300032168 Bacteria 1134
145 Ga0316593_10120033 3300032168 Bacteria 943
146 Ga0316593_10146212 3300032168 Bacteria 858
147 Ga0316586_1016705 3300033527 Bacteria 1179
148 Ga0316588_1035981 3300033528 Bacteria 1175
149 Ga0316596_1043419 3300033541 Bacteria 1184
150 Ga0316596_1099575 3300033541 Bacteria 786
151 Ga0316574_0001393 3300035398 Bacteria 11422
152 Ga0316582_0013828 3300036647 Bacteria 4557
153 Ga0316584_0002124 3300036712 Bacteria 12396
154 Ga0395905_0301459 3300037471 Bacteria 1490
155 Ga0316581_0001607 3300037588 Bacteria 5154
156 Ga0400483_073690 3300039062 Bacteria 14993
157 Ga0400483_233176 3300039062 Bacteria 26214
158 Ga0436365_1710856 3300039437 Bacteria 657
159 Ga0436362_1142038 3300039453 Bacteria 698
160 Ga0451800_0239197 3300041459 Bacteria 1696
161 Ga0451802_1926413 3300041460 Bacteria 2344
162 Ga0451839_0580142 3300041496 Bacteria 4525
163 Ga0450905_012875 3300042142 Bacteria 1182
164 Ga0451577_0000614 3300042876 Bacteria 57427
165 Ga0451577_0002841 3300042876 Bacteria 19923
166 Ga0466969_0052075 3300044656 Bacteria 2012
167 Ga0453683_0000718 3300044673 Bacteria 34148
168 Ga0466961_0133670 3300044693 Bacteria 1554
169 Ga0466963_0263594 3300044694 Bacteria 1210
170 Ga0453684_0000792 3300044712 Bacteria 108377
171 Ga0453684_0001797 3300044712 Bacteria 56922
172 Ga0453684_0017579 3300044712 Bacteria 11060
173 Ga0453684_0059251 3300044712 Bacteria 4938
174 Ga0453684_0113992 3300044712 Bacteria 3278
175 Ga0466971_0164874 3300044719 Bacteria 1038
176 Ga0466970_0045146 3300044765 Bacteria 2346
177 Ga0466970_0096981 3300044765 Bacteria 1604
178 Ga0466970_0166159 3300044765 Bacteria 1222
179 Ga0466957_0020801 3300044842 Bacteria 3860
180 Ga0466957_0072021 3300044842 Bacteria 2139
181 Ga0466959_0020406 3300045049 Bacteria 4881
182 Ga0466959_0090547 3300045049 Bacteria 2197
183 Ga0451576_0001746 3300045051 Bacteria 35704
184 Ga0451576_0017161 3300045051 Bacteria 7964
185 Ga0451576_0206358 3300045051 Bacteria 2052
186 Ga0466958_0000576 3300045836 Bacteria 15657
187 Ga0466967_0007214 3300045976 Bacteria 7987
188 Ga0466967_0027275 3300045976 Bacteria 4749
189 Ga0495591_000675 3300046458 Bacteria 25029
190 Ga0495591_001816 3300046458 Bacteria 12647
191 Ga0495650_0020742 3300046471 Bacteria 3195
192 Ga0495605_0000152 3300046474 Bacteria 89123
193 Ga0495605_0000696 3300046474 Bacteria 25113
194 Ga0495605_0001910 3300046474 Bacteria 13262
195 Ga0495664_0627425 3300046477 Bacteria 638
196 Ga0495585_0035794 3300046492 Bacteria 2803
197 Ga0495607_0001218 3300046501 Bacteria 23124
198 Ga0495607_0029528 3300046501 Bacteria 3373
199 Ga0495607_0048248 3300046501 Bacteria 2491
200 Ga0495607_0056447 3300046501 Bacteria 2254
201 Ga0495607_0173384 3300046501 Bacteria 1087
202 Ga0495583_0000168 3300046506 Bacteria 111781
203 Ga0495583_0001270 3300046506 Bacteria 26433
204 Ga0495583_0001927 3300046506 Bacteria 19192
205 Ga0495583_0050114 3300046506 Bacteria 1909
206 Ga0495606_0061805 3300046507 Bacteria 2393
207 Ga0495610_0016821 3300046512 Bacteria 4195
208 Ga0495610_0038429 3300046512 Bacteria 2429
209 Ga0495620_0046163 3300046515 Bacteria 1882
210 Ga0495620_0093335 3300046515 Bacteria 1205
211 Ga0495631_0054977 3300046518 Bacteria 1735
212 Ga0495632_0003368 3300046519 Bacteria 11389
213 Ga0495632_0013121 3300046519 Bacteria 4744
214 Ga0495632_0018318 3300046519 Bacteria 3844
215 Ga0495637_0000609 3300046520 Bacteria 25502
216 Ga0495637_0008817 3300046520 Bacteria 4939
217 Ga0495637_0012434 3300046520 Bacteria 4070
218 Ga0495637_0033378 3300046520 Bacteria 2260
219 Ga0495644_0006244 3300046523 Bacteria 4627
220 Ga0495648_0014448 3300046524 Bacteria 5781
221 Ga0495648_0023014 3300046524 Bacteria 4275
222 Ga0495652_0256008 3300046529 Bacteria 1295
223 Ga0495654_0000761 3300046530 Bacteria 24924
224 Ga0495654_0022257 3300046530 Bacteria 3292
225 Ga0495665_0333191 3300046531 Bacteria 774
226 Ga0495609_0000099 3300046538 Bacteria 101070
227 Ga0495609_0008846 3300046538 Bacteria 4901
228 Ga0495668_0012645 3300046616 Bacteria 5002
229 Ga0495668_0104130 3300046616 Bacteria 1552
230 Ga0495611_0056761 3300046648 Bacteria 1773
231 Ga0495611_0083253 3300046648 Bacteria 1473
232 Ga0495625_0000050 3300046660 Bacteria 197065
233 Ga0495661_0000890 3300046665 Bacteria 27565
234 Ga0495658_0476431 3300046683 Bacteria 798
235 Ga0495671_0004447 3300046692 Bacteria 8383
236 Ga0495676_0000024 3300047321 Bacteria 150285
237 Ga0495673_0000502 3300047469 Bacteria 41495
238 Ga0495673_0006802 3300047469 Bacteria 6678
239 Ga0495673_0011451 3300047469 Bacteria 4767
240 Ga0495626_0000061 3300048091 Bacteria 144886
241 Ga0496102_0417471 3300048905 Bacteria 1260
242 Ga0496103_0551231 3300048906 Bacteria 736
243 Ga0496108_0000219 3300048911 Bacteria 51931
244 Ga0496110_0238242 3300048913 Bacteria 1655
245 Ga0496110_0311262 3300048913 Bacteria 1434
246 Ga0496112_1032541 3300048915 Bacteria 741
247 Ga0496112_1176684 3300048915 Bacteria 684
248 Ga0496116_0186738 3300048919 Bacteria 1102
249 Ga0496117_0306828 3300048920 Bacteria 838
250 Ga0496118_0013569 3300048921 Bacteria 7692
251 Ga0496121_0002405 3300048924 Bacteria 28678
252 Ga0496121_0005476 3300048924 Bacteria 16251
253 Ga0496122_0003936 3300048925 Bacteria 18971
254 Ga0496122_0055452 3300048925 Bacteria 2965
255 Ga0496123_0000080 3300048926 Bacteria 190247
256 Ga0496123_0070964 3300048926 Bacteria 2176
257 Ga0496124_0000149 3300048927 Bacteria 143351
258 Ga0496124_0007122 3300048927 Bacteria 11972
259 Ga0501308_029037 3300049128 Bacteria 733
260 Ga0501309_039693 3300049129 Bacteria 717
261 Ga0501343_001581 3300049132 Bacteria 1555
262 Ga0501343_016480 3300049132 Bacteria 633
263 Ga0501344_01564 3300049133 Bacteria 1121
264 Ga0501345_02410 3300049134 Bacteria 771
265 Ga0501305_020481 3300049161 Bacteria 973
266 Ga0501305_025254 3300049161 Bacteria 900
267 Ga0501305_033138 3300049161 Bacteria 814
268 Ga0495678_000842 3300049459 Bacteria 27391
269 Ga0501312_019896 3300049528 Bacteria 989
270 Ga0501312_021275 3300049528 Bacteria 965
271 Ga0501312_025872 3300049528 Bacteria 897
272 Ga0501314_008599 3300049530 Bacteria 926
273 Ga0501315_003632 3300049531 Bacteria 1557
274 Ga0501315_027001 3300049531 Bacteria 808
275 Ga0501316_003326 3300049532 Bacteria 1553
276 Ga0501316_032502 3300049532 Bacteria 703
277 Ga0501317_007979 3300049533 Bacteria 1208
278 Ga0501317_016625 3300049533 Bacteria 956
279 Ga0501318_007266 3300049534 Bacteria 1153
280 Ga0501323_031003 3300049539 Bacteria 751
281 Ga0501331_03762 3300049547 Bacteria 827
282 Ga0501332_00427 3300049548 Bacteria 1824
283 Ga0501334_00275 3300049550 Bacteria 2162
284 Ga0501335_011308 3300049551 Bacteria 871
285 Ga0501335_015125 3300049551 Bacteria 785
286 Ga0501335_015963 3300049551 Bacteria 771
287 Ga0501336_000517 3300049552 Bacteria 1947
288 Ga0501338_00794 3300049554 Bacteria 1541
289 Ga0501338_08294 3300049554 Bacteria 680
290 Ga0501067_0037787 3300049583 Bacteria 2681
291 Ga0501070_0336366 3300049586 Bacteria 1227
292 Ga0501072_0002846 3300049588 Bacteria 12987
293 Ga0501073_0010215 3300049589 Bacteria 6895
294 Ga0501073_0012796 3300049589 Bacteria 6120
295 Ga0501074_0114048 3300049590 Bacteria 1933
296 Ga0501076_0888095 3300049592 Bacteria 735
297 Ga0501217_015195 3300049661 Bacteria 1750
298 Ga0501221_211534 3300049704 Bacteria 543
299 Ga0501225_0200146 3300049705 Bacteria 633
300 Ga0501079_0134538 3300049741 Bacteria 1924
301 Ga0501080_0109498 3300049742 Bacteria 2560
302 Ga0501081_0361480 3300049743 Bacteria 1071
303 Ga0501083_0019636 3300049744 Bacteria 4707
304 Ga0501266_041058 3300049763 Bacteria 688
305 Ga0501270_010737 3300049767 Bacteria 1214
306 nmdc:mga05p37_544335_c1 3300050507 Bacteria 1323
307 nmdc:mga05p37_621599_c1 3300050507 Bacteria 1215
308 nmdc:mga09592_129810_c1 3300050508 Bacteria 2168
309 nmdc:mga09592_317590_c1 3300050508 Bacteria 1350
310 nmdc:mga0qj67_73513_c1 3300050509 Bacteria 2730
311 nmdc:mga06r32_605384_c1 3300050510 Bacteria 1066
312 nmdc:mga08y16_61947_c1 3300050511 Bacteria 3907
313 nmdc:mga0a205_41029_c1 3300050515 Bacteria 4456
314 Ga0501084_0304823 3300054114 Bacteria 1345
315 Ga0587079_103906 3300059647 Bacteria 682
316 Ga0501082_0698495 3300060353 Bacteria 888
317 Ga0530510_0280135 3300061734 Bacteria 1245

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049763 Ga0501266_041058 Ga0501266_041058_178_675 161
2 3300049704 Ga0501221_211534 Ga0501221_211534_17_520 162
3 3300048906 Ga0496103_0551231 Ga0496103_0551231_31_570 165
4 iso_pu_bacteria 2857581216 2857585728 170
5 3300046477 Ga0495664_0627425 Ga0495664_0627425_11_547 174
6 3300049132 Ga0501343_016480 Ga0501343_016480_72_611 174
7 3300049554 Ga0501338_08294 Ga0501338_08294_24_563 174
8 3300048920 Ga0496117_0306828 Ga0496117_0306828_14_556 176
9 iso_pu_bacteria 2510917027 2511176378 193
10 iso_pu_bacteria 2842682962 2842684497 193
11 iso_pu_bacteria 2849139964 2849142519 193
12 iso_pu_bacteria 2857591370 2857597157 193
13 iso_pu_bacteria 2919414237 2919415448 193
14 iso_pu_bacteria 2977254563 2977256584 193
15 iso_pu_bacteria 2990275345 2990277454 193
16 iso_pu_bacteria 3006973921 3006975942 193
17 3300014325 Ga0163163_10215474 Ga0163163_102154742 194
18 3300025912 Ga0207707_10010200 Ga0207707_100102003 194
19 3300025921 Ga0207652_10334353 Ga0207652_103343531 194
20 3300046683 Ga0495658_0476431 Ga0495658_0476431_84_680 194
21 iso_pu_bacteria 2831905167 2831908724 194
22 3300013297 Ga0157378_10436256 Ga0157378_104362562 195
23 3300044712 Ga0453684_0017579 Ga0453684_0017579_3410_4012 195
24 3300048911 Ga0496108_0000219 Ga0496108_0000219_50293_50895 195
25 3300049589 Ga0501073_0010215 Ga0501073_0010215_4968_5570 195
26 iso_pu_bacteria 2600255283 2601626242 195
27 3300039437 Ga0436365_1710856 Ga0436365_1710856_15_626 196
28 iso_pu_bacteria 2920107658 2920107680 196
29 3300003758 Ga0055532_1000546 Ga0055532_100054617 197
30 3300005334 Ga0068869_100129605 Ga0068869_1001296052 197
31 3300005335 Ga0070666_10000106 Ga0070666_100001066 197
32 3300005338 Ga0068868_100149832 Ga0068868_1001498323 197
33 3300005347 Ga0070668_100102277 Ga0070668_1001022772 197
34 3300005355 Ga0070671_100037209 Ga0070671_1000372095 197
35 3300005364 Ga0070673_100077239 Ga0070673_1000772393 197
36 3300005436 Ga0070713_100814091 Ga0070713_1008140911 197
37 3300005543 Ga0070672_100521303 Ga0070672_1005213031 197
38 3300005616 Ga0068852_100015845 Ga0068852_1000158455 197
39 3300005617 Ga0068859_100000024 Ga0068859_1000000246 197
40 3300005618 Ga0068864_100003921 Ga0068864_10000392110 197
41 3300005834 Ga0068851_10109814 Ga0068851_101098142 197
42 3300005841 Ga0068863_100014236 Ga0068863_1000142366 197
43 3300005842 Ga0068858_100001879 Ga0068858_1000018795 197
44 3300005843 Ga0068860_100012877 Ga0068860_1000128772 197
45 3300006028 Ga0070717_10075729 Ga0070717_100757293 197
46 3300006028 Ga0070717_10094277 Ga0070717_100942772 197
47 3300006358 Ga0068871_100386649 Ga0068871_1003866492 197
48 3300006931 Ga0097620_100000024 Ga0097620_1000000246 197
49 3300009174 Ga0105241_10007343 Ga0105241_100073432 197
50 3300009545 Ga0105237_10002723 Ga0105237_100027236 197
51 3300009553 Ga0105249_10001970 Ga0105249_1000197022 197
52 3300010375 Ga0105239_10033631 Ga0105239_100336319 197
53 3300013102 Ga0157371_10004044 Ga0157371_100040447 197
54 3300013297 Ga0157378_10202633 Ga0157378_102026333 197
55 3300013306 Ga0163162_10002370 Ga0163162_100023709 197
56 3300013308 Ga0157375_10021938 Ga0157375_100219389 197
57 3300014968 Ga0157379_10098338 Ga0157379_100983382 197
58 3300025229 Ga0209147_100029 Ga0209147_10002971 197
59 3300025900 Ga0207710_10273049 Ga0207710_102730491 197
60 3300025903 Ga0207680_10000024 Ga0207680_1000002429 197
61 3300025904 Ga0207647_10020475 Ga0207647_100204755 197
62 3300025911 Ga0207654_10002300 Ga0207654_100023006 197
63 3300025914 Ga0207671_10004009 Ga0207671_100040092 197
64 3300025928 Ga0207700_10169677 Ga0207700_101696772 197
65 3300025928 Ga0207700_10172226 Ga0207700_101722262 197
66 3300025929 Ga0207664_10026777 Ga0207664_100267774 197
67 3300025929 Ga0207664_10051022 Ga0207664_100510222 197
68 3300025936 Ga0207670_10242921 Ga0207670_102429211 197
69 3300025940 Ga0207691_10211446 Ga0207691_102114463 197
70 3300025942 Ga0207689_10002373 Ga0207689_100023735 197
71 3300025960 Ga0207651_10281643 Ga0207651_102816431 197
72 3300025961 Ga0207712_10004440 Ga0207712_100044406 197
73 3300025972 Ga0207668_10153831 Ga0207668_101538312 197
74 3300025986 Ga0207658_10081927 Ga0207658_100819273 197
75 3300026035 Ga0207703_10001036 Ga0207703_1000103616 197
76 3300026088 Ga0207641_10000058 Ga0207641_1000005876 197
77 3300026095 Ga0207676_10002016 Ga0207676_1000201611 197
78 3300026142 Ga0207698_10014252 Ga0207698_100142522 197
79 3300028381 Ga0268264_10001732 Ga0268264_100017326 197
80 3300031548 Ga0307408_100011084 Ga0307408_1000110842 197
81 3300031691 Ga0316579_10002338 Ga0316579_100023389 197
82 3300031728 Ga0316578_10031094 Ga0316578_100310942 197
83 3300031731 Ga0307405_10206999 Ga0307405_102069992 197
84 3300031733 Ga0316577_10001872 Ga0316577_100018724 197
85 3300031911 Ga0307412_10483627 Ga0307412_104836272 197
86 3300031995 Ga0307409_100053823 Ga0307409_1000538232 197
87 3300032002 Ga0307416_100008312 Ga0307416_1000083128 197
88 3300032137 Ga0316585_10005323 Ga0316585_100053232 197
89 3300032168 Ga0316593_10080886 Ga0316593_100808862 197
90 3300032168 Ga0316593_10120033 Ga0316593_101200331 197
91 3300032168 Ga0316593_10146212 Ga0316593_101462121 197
92 3300033527 Ga0316586_1016705 Ga0316586_10167052 197
93 3300033528 Ga0316588_1035981 Ga0316588_10359812 197
94 3300033541 Ga0316596_1043419 Ga0316596_10434192 197
95 3300033541 Ga0316596_1099575 Ga0316596_10995751 197
96 3300035398 Ga0316574_0001393 Ga0316574_0001393_6067_6759 197
97 3300036647 Ga0316582_0013828 Ga0316582_0013828_1322_2014 197
98 3300036712 Ga0316584_0002124 Ga0316584_0002124_5946_6638 197
99 3300037588 Ga0316581_0001607 Ga0316581_0001607_3010_3702 197
100 3300044712 Ga0453684_0113992 Ga0453684_0113992_198_803 197
101 3300045976 Ga0466967_0007214 Ga0466967_0007214_3335_3940 197
102 3300046529 Ga0495652_0256008 Ga0495652_0256008_234_839 197
103 3300049128 Ga0501308_029037 Ga0501308_029037_109_717 197
104 3300049129 Ga0501309_039693 Ga0501309_039693_80_688 197
105 3300049132 Ga0501343_001581 Ga0501343_001581_155_763 197
106 3300049133 Ga0501344_01564 Ga0501344_01564_232_840 197
107 3300049134 Ga0501345_02410 Ga0501345_02410_64_672 197
108 3300049161 Ga0501305_020481 Ga0501305_020481_286_894 197
109 3300049161 Ga0501305_025254 Ga0501305_025254_168_776 197
110 3300049161 Ga0501305_033138 Ga0501305_033138_83_691 197
111 3300049528 Ga0501312_019896 Ga0501312_019896_250_858 197
112 3300049528 Ga0501312_021275 Ga0501312_021275_57_665 197
113 3300049528 Ga0501312_025872 Ga0501312_025872_166_774 197
114 3300049530 Ga0501314_008599 Ga0501314_008599_85_693 197
115 3300049531 Ga0501315_003632 Ga0501315_003632_151_759 197
116 3300049531 Ga0501315_027001 Ga0501315_027001_121_729 197
117 3300049532 Ga0501316_003326 Ga0501316_003326_155_763 197
118 3300049532 Ga0501316_032502 Ga0501316_032502_24_632 197
119 3300049533 Ga0501317_007979 Ga0501317_007979_335_943 197
120 3300049533 Ga0501317_016625 Ga0501317_016625_192_800 197
121 3300049534 Ga0501318_007266 Ga0501318_007266_135_743 197
122 3300049539 Ga0501323_031003 Ga0501323_031003_64_672 197
123 3300049547 Ga0501331_03762 Ga0501331_03762_169_777 197
124 3300049548 Ga0501332_00427 Ga0501332_00427_1016_1624 197
125 3300049550 Ga0501334_00275 Ga0501334_00275_263_871 197
126 3300049551 Ga0501335_011308 Ga0501335_011308_83_691 197
127 3300049551 Ga0501335_015125 Ga0501335_015125_60_668 197
128 3300049551 Ga0501335_015963 Ga0501335_015963_17_625 197
129 3300049552 Ga0501336_000517 Ga0501336_000517_792_1400 197
130 3300049554 Ga0501338_00794 Ga0501338_00794_141_749 197
131 3300049661 Ga0501217_015195 Ga0501217_015195_855_1463 197
132 3300049705 Ga0501225_0200146 Ga0501225_0200146_15_623 197
133 3300049767 Ga0501270_010737 Ga0501270_010737_46_654 197
134 iso_pu_bacteria 2671180330 2672336989 197
135 3300004800 Ga0058861_10019557 Ga0058861_100195572 198
136 3300005331 Ga0070670_100748805 Ga0070670_1007488052 198
137 3300005471 Ga0070698_100046034 Ga0070698_1000460342 198
138 3300005719 Ga0068861_101126295 Ga0068861_1011262951 198
139 3300006237 Ga0097621_100540419 Ga0097621_1005404191 198
140 3300006880 Ga0075429_100101109 Ga0075429_1001011092 198
141 3300009147 Ga0114129_10063935 Ga0114129_100639353 198
142 3300009148 Ga0105243_10640858 Ga0105243_106408581 198
143 3300009176 Ga0105242_10886990 Ga0105242_108869902 198
144 3300009177 Ga0105248_10537927 Ga0105248_105379272 198
145 3300009545 Ga0105237_10686258 Ga0105237_106862582 198
146 3300009553 Ga0105249_10310817 Ga0105249_103108172 198
147 3300009553 Ga0105249_10341979 Ga0105249_103419791 198
148 3300010375 Ga0105239_10065548 Ga0105239_100655485 198
149 3300014497 Ga0182008_10002853 Ga0182008_100028536 198
150 3300015261 Ga0182006_1020291 Ga0182006_10202913 198
151 3300015262 Ga0182007_10006799 Ga0182007_100067995 198
152 3300020076 Ga0206355_1647993 Ga0206355_16479931 198
153 3300020077 Ga0206351_10057679 Ga0206351_100576791 198
154 3300020078 Ga0206352_10062450 Ga0206352_100624501 198
155 3300020080 Ga0206350_10815981 Ga0206350_108159811 198
156 3300022467 Ga0224712_10110776 Ga0224712_101107762 198
157 3300022467 Ga0224712_10266680 Ga0224712_102666801 198
158 3300025928 Ga0207700_10680375 Ga0207700_106803752 198
159 3300025961 Ga0207712_10304673 Ga0207712_103046732 198
160 3300026118 Ga0207675_100600172 Ga0207675_1006001721 198
161 3300028381 Ga0268264_10665168 Ga0268264_106651682 198
162 3300031616 Ga0307508_10090609 Ga0307508_100906092 198
163 3300031665 Ga0316575_10017355 Ga0316575_100173551 198
164 3300037471 Ga0395905_0301459 Ga0395905_0301459_331_1077 198
165 3300039453 Ga0436362_1142038 Ga0436362_1142038_73_687 198
166 3300041459 Ga0451800_0239197 Ga0451800_0239197_39_647 198
167 3300041460 Ga0451802_1926413 Ga0451802_1926413_1625_2254 198
168 3300041496 Ga0451839_0580142 Ga0451839_0580142_47_676 198
169 3300044656 Ga0466969_0052075 Ga0466969_0052075_915_1523 198
170 3300044765 Ga0466970_0045146 Ga0466970_0045146_1470_2078 198
171 3300044842 Ga0466957_0072021 Ga0466957_0072021_190_798 198
172 3300045049 Ga0466959_0090547 Ga0466959_0090547_51_659 198
173 3300045976 Ga0466967_0027275 Ga0466967_0027275_648_1259 198
174 3300046474 Ga0495605_0000696 Ga0495605_0000696_8824_9567 198
175 3300048905 Ga0496102_0417471 Ga0496102_0417471_548_1159 198
176 3300048915 Ga0496112_1176684 Ga0496112_1176684_46_657 198
177 3300049583 Ga0501067_0037787 Ga0501067_0037787_1488_2099 198
178 3300049586 Ga0501070_0336366 Ga0501070_0336366_40_651 198
179 3300049588 Ga0501072_0002846 Ga0501072_0002846_8930_9550 198
180 3300049589 Ga0501073_0012796 Ga0501073_0012796_1701_2321 198
181 3300049590 Ga0501074_0114048 Ga0501074_0114048_788_1408 198
182 3300049741 Ga0501079_0134538 Ga0501079_0134538_1281_1901 198
183 3300049742 Ga0501080_0109498 Ga0501080_0109498_1656_2276 198
184 3300049743 Ga0501081_0361480 Ga0501081_0361480_202_810 198
185 3300049744 Ga0501083_0019636 Ga0501083_0019636_1507_2127 198
186 3300050507 nmdc:mga05p37_544335_c1 nmdc:mga05p37_544335_c1_22_630 198
187 3300050508 nmdc:mga09592_317590_c1 nmdc:mga09592_317590_c1_294_902 198
188 3300050509 nmdc:mga0qj67_73513_c1 nmdc:mga0qj67_73513_c1_1793_2401 198
189 3300050510 nmdc:mga06r32_605384_c1 nmdc:mga06r32_605384_c1_204_812 198
190 3300054114 Ga0501084_0304823 Ga0501084_0304823_489_1109 198
191 3300059647 Ga0587079_103906 Ga0587079_103906_29_640 198
192 3300060353 Ga0501082_0698495 Ga0501082_0698495_96_704 198
193 3300009011 Ga0105251_10000697 Ga0105251_1000069713 199
194 3300009036 Ga0105244_10124573 Ga0105244_101245732 199
195 3300013100 Ga0157373_10012349 Ga0157373_100123495 199
196 3300013104 Ga0157370_10269657 Ga0157370_102696572 199
197 3300020075 Ga0206349_1971295 Ga0206349_19712951 199
198 3300020077 Ga0206351_10306747 Ga0206351_103067471 199
199 3300020077 Ga0206351_10735540 Ga0206351_107355401 199
200 3300020078 Ga0206352_10125966 Ga0206352_101259668 199
201 3300020080 Ga0206350_10673252 Ga0206350_106732521 199
202 3300020082 Ga0206353_10516619 Ga0206353_105166191 199
203 3300020610 Ga0154015_1139239 Ga0154015_11392391 199
204 3300020610 Ga0154015_1184269 Ga0154015_11842691 199
205 3300022467 Ga0224712_10001958 Ga0224712_100019581 199
206 3300025728 Ga0207655_1001182 Ga0207655_100118221 199
207 3300025735 Ga0207713_1000138 Ga0207713_100013862 199
208 3300039062 Ga0400483_073690 Ga0400483_073690_9580_10203 199
209 3300039062 Ga0400483_233176 Ga0400483_233176_8570_9193 199
210 3300042142 Ga0450905_012875 Ga0450905_012875_243_854 199
211 3300042876 Ga0451577_0002841 Ga0451577_0002841_18587_19216 199
212 3300044693 Ga0466961_0133670 Ga0466961_0133670_23_637 199
213 3300044694 Ga0466963_0263594 Ga0466963_0263594_213_827 199
214 3300044712 Ga0453684_0000792 Ga0453684_0000792_83722_84351 199
215 3300044719 Ga0466971_0164874 Ga0466971_0164874_401_1015 199
216 3300044765 Ga0466970_0096981 Ga0466970_0096981_23_637 199
217 3300044765 Ga0466970_0166159 Ga0466970_0166159_553_1167 199
218 3300044842 Ga0466957_0020801 Ga0466957_0020801_2167_2781 199
219 3300045049 Ga0466959_0020406 Ga0466959_0020406_4109_4723 199
220 3300045051 Ga0451576_0017161 Ga0451576_0017161_6041_6670 199
221 3300045836 Ga0466958_0000576 Ga0466958_0000576_14689_15303 199
222 3300046458 Ga0495591_000675 Ga0495591_000675_783_1394 199
223 3300046458 Ga0495591_001816 Ga0495591_001816_8916_9542 199
224 3300046471 Ga0495650_0020742 Ga0495650_0020742_228_839 199
225 3300046474 Ga0495605_0000152 Ga0495605_0000152_30702_31355 199
226 3300046474 Ga0495605_0001910 Ga0495605_0001910_664_1275 199
227 3300046492 Ga0495585_0035794 Ga0495585_0035794_560_1171 199
228 3300046501 Ga0495607_0001218 Ga0495607_0001218_2554_3165 199
229 3300046501 Ga0495607_0029528 Ga0495607_0029528_1176_1787 199
230 3300046501 Ga0495607_0048248 Ga0495607_0048248_1245_1856 199
231 3300046501 Ga0495607_0056447 Ga0495607_0056447_861_1472 199
232 3300046501 Ga0495607_0173384 Ga0495607_0173384_44_655 199
233 3300046506 Ga0495583_0000168 Ga0495583_0000168_74731_75357 199
234 3300046506 Ga0495583_0001270 Ga0495583_0001270_21771_22382 199
235 3300046506 Ga0495583_0001927 Ga0495583_0001927_14048_14659 199
236 3300046506 Ga0495583_0050114 Ga0495583_0050114_315_926 199
237 3300046507 Ga0495606_0061805 Ga0495606_0061805_184_795 199
238 3300046512 Ga0495610_0016821 Ga0495610_0016821_1566_2177 199
239 3300046512 Ga0495610_0038429 Ga0495610_0038429_1481_2092 199
240 3300046515 Ga0495620_0046163 Ga0495620_0046163_557_1168 199
241 3300046515 Ga0495620_0093335 Ga0495620_0093335_130_783 199
242 3300046518 Ga0495631_0054977 Ga0495631_0054977_146_757 199
243 3300046519 Ga0495632_0003368 Ga0495632_0003368_5519_6130 199
244 3300046519 Ga0495632_0013121 Ga0495632_0013121_2460_3071 199
245 3300046519 Ga0495632_0018318 Ga0495632_0018318_2252_2878 199
246 3300046520 Ga0495637_0000609 Ga0495637_0000609_24196_24807 199
247 3300046520 Ga0495637_0008817 Ga0495637_0008817_3098_3709 199
248 3300046520 Ga0495637_0012434 Ga0495637_0012434_1016_1627 199
249 3300046520 Ga0495637_0033378 Ga0495637_0033378_954_1580 199
250 3300046523 Ga0495644_0006244 Ga0495644_0006244_1669_2295 199
251 3300046524 Ga0495648_0014448 Ga0495648_0014448_1880_2533 199
252 3300046524 Ga0495648_0023014 Ga0495648_0023014_3227_3838 199
253 3300046530 Ga0495654_0000761 Ga0495654_0000761_2720_3331 199
254 3300046530 Ga0495654_0022257 Ga0495654_0022257_2215_2826 199
255 3300046531 Ga0495665_0333191 Ga0495665_0333191_61_675 199
256 3300046538 Ga0495609_0000099 Ga0495609_0000099_84455_85066 199
257 3300046538 Ga0495609_0008846 Ga0495609_0008846_751_1377 199
258 3300046616 Ga0495668_0012645 Ga0495668_0012645_3071_3682 199
259 3300046616 Ga0495668_0104130 Ga0495668_0104130_296_907 199
260 3300046648 Ga0495611_0056761 Ga0495611_0056761_791_1402 199
261 3300046648 Ga0495611_0083253 Ga0495611_0083253_469_1080 199
262 3300046660 Ga0495625_0000050 Ga0495625_0000050_116908_117561 199
263 3300046665 Ga0495661_0000890 Ga0495661_0000890_12488_13099 199
264 3300046692 Ga0495671_0004447 Ga0495671_0004447_3273_3884 199
265 3300047321 Ga0495676_0000024 Ga0495676_0000024_36304_36915 199
266 3300047469 Ga0495673_0000502 Ga0495673_0000502_25270_25881 199
267 3300047469 Ga0495673_0006802 Ga0495673_0006802_5120_5731 199
268 3300047469 Ga0495673_0011451 Ga0495673_0011451_517_1128 199
269 3300048091 Ga0495626_0000061 Ga0495626_0000061_108852_109463 199
270 3300048913 Ga0496110_0238242 Ga0496110_0238242_765_1397 199
271 3300048913 Ga0496110_0311262 Ga0496110_0311262_99_710 199
272 3300048915 Ga0496112_1032541 Ga0496112_1032541_15_626 199
273 3300048919 Ga0496116_0186738 Ga0496116_0186738_237_848 199
274 3300048921 Ga0496118_0013569 Ga0496118_0013569_226_837 199
275 3300048924 Ga0496121_0002405 Ga0496121_0002405_22802_23413 199
276 3300048924 Ga0496121_0005476 Ga0496121_0005476_1394_2005 199
277 3300048925 Ga0496122_0003936 Ga0496122_0003936_1484_2095 199
278 3300048925 Ga0496122_0055452 Ga0496122_0055452_913_1524 199
279 3300048926 Ga0496123_0000080 Ga0496123_0000080_63007_63618 199
280 3300048926 Ga0496123_0070964 Ga0496123_0070964_181_792 199
281 3300048927 Ga0496124_0000149 Ga0496124_0000149_106413_107024 199
282 3300048927 Ga0496124_0007122 Ga0496124_0007122_9197_9808 199
283 3300049459 Ga0495678_000842 Ga0495678_000842_10625_11251 199
284 3300005435 Ga0070714_100116491 Ga0070714_1001164915 200
285 3300005544 Ga0070686_100047898 Ga0070686_1000478982 200
286 3300005563 Ga0068855_100100612 Ga0068855_1001006124 200
287 3300005617 Ga0068859_100293054 Ga0068859_1002930542 200
288 3300006931 Ga0097620_100293050 Ga0097620_1002930502 200
289 3300031730 Ga0307516_10199090 Ga0307516_101990903 200
290 3300045051 Ga0451576_0001746 Ga0451576_0001746_12270_12872 200
291 3300003322 rootL2_10299127 rootL2_102991273 201
292 3300005438 Ga0070701_10340326 Ga0070701_103403261 201
293 3300005440 Ga0070705_100533944 Ga0070705_1005339442 201
294 3300005459 Ga0068867_101089856 Ga0068867_1010898561 201
295 3300005549 Ga0070704_100468340 Ga0070704_1004683402 201
296 3300005719 Ga0068861_100497135 Ga0068861_1004971352 201
297 3300005843 Ga0068860_100672800 Ga0068860_1006728001 201
298 3300006844 Ga0075428_100008155 Ga0075428_1000081558 201
299 3300006844 Ga0075428_100122727 Ga0075428_1001227272 201
300 3300006852 Ga0075433_10229158 Ga0075433_102291581 201
301 3300006880 Ga0075429_100110101 Ga0075429_1001101013 201
302 3300009094 Ga0111539_10265494 Ga0111539_102654942 201
303 3300009147 Ga0114129_10136983 Ga0114129_101369834 201
304 3300009553 Ga0105249_10170481 Ga0105249_101704813 201
305 3300013104 Ga0157370_10218154 Ga0157370_102181542 201
306 3300013306 Ga0163162_10042035 Ga0163162_100420354 201
307 3300013308 Ga0157375_11621548 Ga0157375_116215481 201
308 3300014326 Ga0157380_10495530 Ga0157380_104955302 201
309 3300025961 Ga0207712_10119246 Ga0207712_101192463 201
310 3300026089 Ga0207648_10736752 Ga0207648_107367521 201
311 3300026118 Ga0207675_100488999 Ga0207675_1004889991 201
312 3300028654 Ga0265322_10000052 Ga0265322_1000005246 201
313 3300028794 Ga0307515_10110628 Ga0307515_101106282 201
314 3300042876 Ga0451577_0000614 Ga0451577_0000614_42947_43552 201
315 3300044673 Ga0453683_0000718 Ga0453683_0000718_24280_25002 201
316 3300044712 Ga0453684_0001797 Ga0453684_0001797_43838_44443 201
317 3300044712 Ga0453684_0059251 Ga0453684_0059251_65_778 201
318 3300045051 Ga0451576_0206358 Ga0451576_0206358_1239_1961 201
319 3300049592 Ga0501076_0888095 Ga0501076_0888095_86_709 201
320 3300050507 nmdc:mga05p37_621599_c1 nmdc:mga05p37_621599_c1_429_1037 201
321 3300050508 nmdc:mga09592_129810_c1 nmdc:mga09592_129810_c1_1154_1762 201
322 3300050511 nmdc:mga08y16_61947_c1 nmdc:mga08y16_61947_c1_527_1135 201
323 3300061734 Ga0530510_0280135 Ga0530510_0280135_400_1023 201
324 3300003322 rootL2_10009973 rootL2_100099735 202
325 3300003794 Ga0055531_10000110 Ga0055531_1000011053 202
326 3300006852 Ga0075433_10162670 Ga0075433_101626702 202
327 3300014326 Ga0157380_10261516 Ga0157380_102615161 202
328 3300025304 Ga0209257_1000006 Ga0209257_10000061122 202
329 3300050515 nmdc:mga0a205_41029_c1 nmdc:mga0a205_41029_c1_3379_4005 202
330 3300003320 rootH2_10078762 rootH2_100787621 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00081

Sod_Fe_N

Iron/manganese superoxide dismutases, alpha-hairpin domain

41

124

0.96

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

131

235

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1za5-assembly1.cif.gz_B q69h-fesod 0.9709 3 199
1isc-assembly1.cif.gz_B structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus 0.9698 3 199
2bkb-assembly2.cif.gz_C q69e-fesod 0.9698 3 199
6gsc-assembly1.cif.gz_A sphingobacterium sp. t2 manganese superoxide dismutase catalyses the oxidative demethylation of polymeric lignin via generation of hydroxyl radical 0.9692 2 201
6gsb-assembly1.cif.gz_B sphingobacterium sp. t2 manganese superoxide dismutase catalyses the oxidative demethylation of polymeric lignin via generation of hydroxyl radical 0.9686 3 203
ID Description Score Start End Superfamily
5a9gA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9728 20 84 1.10.287.990
5n56B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9649 20 84 1.10.287.990
6bejA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9622 20 84 1.10.287.990
2cdyC01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9617 20 85 1.10.287.990
6ex3D01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9574 20 84 1.10.287.990
ID Description Score Start End GO Terms
AF-A0A3C1MCV1-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9952 1 151 GO:0004784
GO:0005737
GO:0046872
AF-A0A388Q3J1-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9937 1 159 GO:0004784
GO:0005737
GO:0046872
AF-A0A246AHP2-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.988 1 201 GO:0004784
GO:0005737
GO:0046872
AF-A0A4R3VNV7-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9879 1 202 GO:0004784
GO:0005737
GO:0046872
AF-A0A4R7EF74-F1-model_v4 deleted 0.9879 1 203

Feature Viewer

pLDDT pTM Quality
94.04 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map