F410064

General Info

Members Datasets Scaffolds Average Seq Length
330 180 660 53

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10627162|Ga0105237_106271622
Length 59
Sequence MYKEHVMGRIGLPEMLVILVIVILIFGANRLPEIGRGIGKGIRNFKEATKDGASDKDVD

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
114 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
115 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
119 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
120 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
121 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
122 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
123 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
135 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
155 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0
Rhizoplane 1.82
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 31.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10627162 3300009545 Unclassified 1082
2 JGI24751J29686_10056602 3300002459 Unclassified 808
3 Ga0065714_10129445 3300005288 Bacteria 1264
4 Ga0065712_10007458 3300005290 Bacteria 3630
5 Ga0065712_10186426 3300005290 Bacteria 1168
6 Ga0065712_10525358 3300005290 Unclassified 633
7 Ga0065715_10966857 3300005293 Bacteria 554
8 Ga0070676_10764725 3300005328 Bacteria 710
9 Ga0070670_100002548 3300005331 Bacteria 15039
10 Ga0070670_100110679 3300005331 Bacteria 2366
11 Ga0070670_102220857 3300005331 Unclassified 506
12 Ga0070682_100053557 3300005337 Unclassified 2529
13 Ga0070660_100197490 3300005339 Unclassified 1631
14 Ga0070660_101401753 3300005339 Unclassified 594
15 Ga0070661_100165275 3300005344 Bacteria 1678
16 Ga0070661_100506506 3300005344 Bacteria 967
17 Ga0070668_100665045 3300005347 Bacteria 916
18 Ga0070669_101902240 3300005353 Unclassified 520
19 Ga0070674_100296900 3300005356 Bacteria 1286
20 Ga0070674_100329288 3300005356 Unclassified 1227
21 Ga0070674_100671825 3300005356 Bacteria 882
22 Ga0070673_100247617 3300005364 Bacteria 1552
23 Ga0070659_100055948 3300005366 Bacteria 3110
24 Ga0070659_100092293 3300005366 Bacteria 2428
25 Ga0070659_101073260 3300005366 Bacteria 709
26 Ga0070659_102062004 3300005366 Bacteria 512
27 Ga0070708_100476220 3300005445 Bacteria 1178
28 Ga0070678_101859177 3300005456 Unclassified 568
29 Ga0070662_100199133 3300005457 Bacteria 1588
30 Ga0070662_101053963 3300005457 Unclassified 697
31 Ga0070681_10275022 3300005458 Unclassified 1595
32 Ga0070681_10608306 3300005458 Bacteria 1007
33 Ga0070681_11551685 3300005458 Bacteria 587
34 Ga0068867_100817320 3300005459 Viruses 832
35 Ga0070706_100275616 3300005467 Bacteria 1570
36 Ga0070707_100151803 3300005468 Bacteria 2256
37 Ga0070698_100694252 3300005471 Bacteria 960
38 Ga0070699_100626960 3300005518 Bacteria 981
39 Ga0070684_101016029 3300005535 Unclassified 778
40 Ga0070697_100130097 3300005536 Bacteria 2111
41 Ga0068853_100172531 3300005539 Unclassified 1957
42 Ga0070695_100661674 3300005545 Unclassified 826
43 Ga0070696_101394792 3300005546 Unclassified 597
44 Ga0070693_100041902 3300005547 Bacteria 2578
45 Ga0070665_101078580 3300005548 Unclassified 815
46 Ga0070704_101142096 3300005549 Unclassified 709
47 Ga0070704_101590876 3300005549 Unclassified 602
48 Ga0068855_101147062 3300005563 Unclassified 810
49 Ga0070664_101516497 3300005564 Unclassified 634
50 Ga0068857_100120093 3300005577 Unclassified 2366
51 Ga0068857_100389392 3300005577 Bacteria 1295
52 Ga0068857_100620163 3300005577 Unclassified 1023
53 Ga0068857_101275762 3300005577 Unclassified 712
54 Ga0068854_100636693 3300005578 Bacteria 914
55 Ga0068856_100968469 3300005614 Bacteria 869
56 Ga0068852_100480225 3300005616 Unclassified 1235
57 Ga0068864_100068619 3300005618 Bacteria 3080
58 Ga0068864_101625807 3300005618 Unclassified 650
59 Ga0068861_101872599 3300005719 Unclassified 596
60 Ga0068870_10688752 3300005840 Bacteria 704
61 Ga0068858_100918970 3300005842 Bacteria 856
62 Ga0068860_100085045 3300005843 Bacteria 3009
63 Ga0068862_100553064 3300005844 Unclassified 1099
64 Ga0081539_10229816 3300005985 Bacteria 838
65 Ga0075368_10009264 3300006042 Bacteria 3538
66 Ga0075363_100502715 3300006048 Unclassified 720
67 Ga0075364_10178117 3300006051 Bacteria 1438
68 Ga0075367_10031368 3300006178 Unclassified 3051
69 Ga0075366_10014030 3300006195 Bacteria 4571
70 Ga0075370_10117784 3300006353 Unclassified 1544
71 Ga0075428_101287335 3300006844 Unclassified 769
72 Ga0075428_102586185 3300006844 Bacteria 519
73 Ga0075430_100166986 3300006846 Bacteria 1831
74 Ga0075431_100027325 3300006847 Bacteria 5854
75 Ga0075431_100421948 3300006847 Unclassified 1333
76 Ga0075433_10004522 3300006852 Bacteria 10843
77 Ga0075434_100394067 3300006871 Bacteria 1406
78 Ga0075434_101736349 3300006871 Bacteria 631
79 Ga0068865_101364715 3300006881 Bacteria 632
80 Ga0075435_101357603 3300007076 Unclassified 623
81 Ga0111539_10002400 3300009094 Bacteria 24912
82 Ga0111539_10047989 3300009094 Bacteria 5100
83 Ga0111539_10050284 3300009094 Unclassified 4965
84 Ga0105247_10023533 3300009101 Bacteria 3711
85 Ga0105247_11404725 3300009101 Bacteria 565
86 Ga0114129_10133876 3300009147 Bacteria 3403
87 Ga0105248_13253668 3300009177 Unclassified 517
88 Ga0105249_10519615 3300009553 Unclassified 1238
89 Ga0105249_12570998 3300009553 Bacteria 581
90 Ga0105239_11871072 3300010375 Unclassified 696
91 Ga0157370_10899630 3300013104 Bacteria 803
92 Ga0163163_11408469 3300014325 Unclassified 759
93 Ga0157380_10165210 3300014326 Bacteria 1928
94 Ga0157380_10712391 3300014326 Bacteria 1010
95 Ga0157380_13107408 3300014326 Bacteria 530
96 Ga0157379_10958828 3300014968 Unclassified 814
97 Ga0206352_10442457 3300020078 Unclassified 506
98 Ga0207682_10067484 3300025893 Bacteria 1509
99 Ga0207645_10692200 3300025907 Bacteria 693
100 Ga0207684_10145818 3300025910 Bacteria 2036
101 Ga0207707_10525877 3300025912 Bacteria 1007
102 Ga0207671_10406922 3300025914 Unclassified 1082
103 Ga0207693_10003540 3300025915 Bacteria 13336
104 Ga0207649_10118259 3300025920 Bacteria 1783
105 Ga0207649_10518561 3300025920 Bacteria 908
106 Ga0207681_11729160 3300025923 Unclassified 522
107 Ga0207650_10184294 3300025925 Bacteria 1665
108 Ga0207650_10370581 3300025925 Unclassified 1181
109 Ga0207690_10125995 3300025932 Bacteria 1867
110 Ga0207690_11684013 3300025932 Bacteria 530
111 Ga0207690_11791586 3300025932 Bacteria 513
112 Ga0207706_10138602 3300025933 Bacteria 2140
113 Ga0207706_11240800 3300025933 Unclassified 618
114 Ga0207669_10942288 3300025937 Unclassified 723
115 Ga0207661_10270657 3300025944 Bacteria 1516
116 Ga0207667_10903597 3300025949 Unclassified 875
117 Ga0207712_10175869 3300025961 Unclassified 1677
118 Ga0207668_10430501 3300025972 Bacteria 1122
119 Ga0207703_10991226 3300026035 Unclassified 806
120 Ga0207639_10089132 3300026041 Bacteria 2464
121 Ga0207708_12019343 3300026075 Bacteria 505
122 Ga0207648_10738779 3300026089 Unclassified 914
123 Ga0207676_10025548 3300026095 Bacteria 4382
124 Ga0207676_11288134 3300026095 Unclassified 725
125 Ga0207674_10232613 3300026116 Bacteria 1791
126 Ga0207674_10358445 3300026116 Bacteria 1410
127 Ga0207674_10980357 3300026116 Bacteria 814
128 Ga0207674_11060297 3300026116 Unclassified 780
129 Ga0207674_11116571 3300026116 Unclassified 758
130 Ga0207675_100466565 3300026118 Bacteria 1253
131 Ga0207675_100842559 3300026118 Unclassified 932
132 Ga0207698_10450845 3300026142 Unclassified 1242
133 Ga0209813_10014976 3300027866 Unclassified 2094
134 Ga0207428_10155823 3300027907 Bacteria 1737
135 Ga0268265_10549441 3300028380 Unclassified 1096
136 Ga0316176_1146958 3300030732 Unclassified 511
137 Ga0307408_100019276 3300031548 Bacteria 4592
138 Ga0307408_100041406 3300031548 Bacteria 3265
139 Ga0307408_100820441 3300031548 Unclassified 846
140 Ga0307408_101079454 3300031548 Unclassified 744
141 Ga0307408_101451790 3300031548 Bacteria 647
142 Ga0307405_10013270 3300031731 Bacteria 4391
143 Ga0307405_10280469 3300031731 Bacteria 1254
144 Ga0307405_10336821 3300031731 Bacteria 1158
145 Ga0307405_11888921 3300031731 Unclassified 532
146 Ga0307413_10026247 3300031824 Bacteria 3208
147 Ga0307413_10027736 3300031824 Bacteria 3143
148 Ga0307410_10029960 3300031852 Bacteria 3472
149 Ga0307410_10031052 3300031852 Bacteria 3423
150 Ga0307410_10045282 3300031852 Bacteria 2928
151 Ga0307410_10750549 3300031852 Unclassified 826
152 Ga0307410_11189207 3300031852 Bacteria 664
153 Ga0307406_10005546 3300031901 Bacteria 6902
154 Ga0307406_10879378 3300031901 Bacteria 761
155 Ga0307406_11364492 3300031901 Unclassified 620
156 Ga0307407_10009934 3300031903 Bacteria 4458
157 Ga0307407_10027249 3300031903 Bacteria 3037
158 Ga0307407_10028493 3300031903 Bacteria 2986
159 Ga0307412_10011813 3300031911 Bacteria 5069
160 Ga0307412_10030859 3300031911 Bacteria 3379
161 Ga0307412_10576604 3300031911 Bacteria 949
162 Ga0307412_11209404 3300031911 Unclassified 677
163 Ga0307409_100010622 3300031995 Bacteria 5740
164 Ga0307409_100031522 3300031995 Bacteria 3828
165 Ga0307409_100035886 3300031995 Bacteria 3637
166 Ga0307409_100746181 3300031995 Bacteria 982
167 Ga0307409_101238387 3300031995 Bacteria 770
168 Ga0307409_101314914 3300031995 Unclassified 748
169 Ga0307416_100019655 3300032002 Bacteria 4796
170 Ga0307416_100048165 3300032002 Unclassified 3379
171 Ga0307416_100061221 3300032002 Bacteria 3070
172 Ga0307416_100312828 3300032002 Bacteria 1568
173 Ga0307416_100426230 3300032002 Bacteria 1372
174 Ga0307416_100485646 3300032002 Bacteria 1296
175 Ga0307416_101724731 3300032002 Bacteria 731
176 Ga0307416_101827699 3300032002 Unclassified 711
177 Ga0307416_102404532 3300032002 Unclassified 626
178 Ga0307414_10015271 3300032004 Bacteria 4633
179 Ga0307414_10028704 3300032004 Bacteria 3612
180 Ga0307411_10003509 3300032005 Bacteria 7290
181 Ga0307411_10007027 3300032005 Bacteria 5691
182 Ga0307411_10161856 3300032005 Bacteria 1677
183 Ga0307411_10163890 3300032005 Unclassified 1669
184 Ga0307411_10286344 3300032005 Bacteria 1314
185 Ga0307411_10368249 3300032005 Bacteria 1178
186 Ga0307415_100038092 3300032126 Bacteria 3166
187 Ga0307415_100336949 3300032126 Bacteria 1264
188 Ga0307415_100447603 3300032126 Unclassified 1116
189 Ga0307415_102444459 3300032126 Bacteria 514
190 Ga0373943_0501297 3300035170 Bacteria 709
191 Ga0373947_0188969 3300035725 Bacteria 1343
192 Ga0373925_0443880 3300037068 Bacteria 1062
193 Ga0242420_155417 3300038996 Unclassified 515
194 Ga0439436_0060130 3300041404 Bacteria 1064
195 Ga0439439_0135625 3300041406 Unclassified 693
196 Ga0451795_0188219 3300041456 Bacteria 528
197 Ga0451807_2361536 3300041486 Bacteria 1359
198 Ga0439431_0125661 3300041997 Bacteria 718
199 Ga0439443_107357 3300042003 Bacteria 539
200 Ga0439449_0034515 3300042007 Unclassified 1884
201 Ga0439451_031599 3300042009 Bacteria 1064
202 Ga0439462_0120831 3300042015 Bacteria 728
203 Ga0450898_113299 3300042134 Unclassified 575
204 Ga0439435_0014875 3300042436 Bacteria 1928
205 Ga0453683_0448482 3300044673 Archaea 834
206 Ga0495580_0513656 3300046472 Bacteria 799
207 Ga0495642_0073682 3300046528 Unclassified 1431
208 Ga0495659_0068080 3300046664 Bacteria 1329
209 Ga0495658_0378195 3300046683 Bacteria 901
210 Ga0496104_0903103 3300048907 Bacteria 788
211 Ga0496106_1494961 3300048909 Unclassified 520
212 Ga0496112_0192774 3300048915 Bacteria 1999
213 Ga0496112_0792946 3300048915 Unclassified 872
214 Ga0501308_057805 3300049128 Bacteria 580
215 Ga0501290_039738 3300049513 Bacteria 701
216 Ga0501299_064432 3300049522 Bacteria 783
217 Ga0501299_193640 3300049522 Unclassified 537
218 Ga0501036_0100336 3300049572 Bacteria 2449
219 Ga0501036_1183699 3300049572 Archaea 623
220 Ga0501038_0215834 3300049574 Bacteria 1533
221 Ga0501038_0240312 3300049574 Bacteria 1438
222 Ga0501038_0360783 3300049574 Unclassified 1130
223 Ga0501038_1215499 3300049574 Unclassified 547
224 Ga0501039_0073230 3300049575 Bacteria 2662
225 Ga0501039_0290961 3300049575 Bacteria 1284
226 Ga0501039_0502363 3300049575 Bacteria 952
227 Ga0501039_1073589 3300049575 Unclassified 624
228 Ga0501040_0102784 3300049576 Bacteria 1994
229 Ga0501040_0320108 3300049576 Bacteria 1109
230 Ga0501040_1386543 3300049576 Unclassified 510
231 Ga0501041_0047061 3300049577 Bacteria 2625
232 Ga0501041_0085873 3300049577 Bacteria 1941
233 Ga0501041_0098619 3300049577 Bacteria 1807
234 Ga0501041_0345932 3300049577 Bacteria 939
235 Ga0501042_0016720 3300049578 Bacteria 5043
236 Ga0501042_0106664 3300049578 Bacteria 2016
237 Ga0501042_0178171 3300049578 Unclassified 1533
238 Ga0501042_0289426 3300049578 Bacteria 1183
239 Ga0501042_0337983 3300049578 Bacteria 1089
240 Ga0501043_1241479 3300049579 Unclassified 522
241 Ga0501046_0346558 3300049580 Bacteria 1079
242 Ga0501048_0009902 3300049582 Bacteria 7145
243 Ga0501048_0070319 3300049582 Bacteria 2472
244 Ga0501048_0217235 3300049582 Bacteria 1356
245 Ga0501048_0312187 3300049582 Bacteria 1119
246 Ga0501048_0548396 3300049582 Unclassified 829
247 Ga0501048_1347479 3300049582 Bacteria 513
248 Ga0501068_0358715 3300049584 Bacteria 937
249 Ga0501068_0378487 3300049584 Bacteria 911
250 Ga0501069_0513818 3300049585 Bacteria 715
251 Ga0501069_0967421 3300049585 Bacteria 519
252 Ga0501070_0940176 3300049586 Unclassified 673
253 Ga0501070_1446581 3300049586 Bacteria 521
254 Ga0501071_0022252 3300049587 Bacteria 4418
255 Ga0501071_0074670 3300049587 Bacteria 2475
256 Ga0501071_0123371 3300049587 Bacteria 1921
257 Ga0501071_0260256 3300049587 Bacteria 1310
258 Ga0501071_0749412 3300049587 Bacteria 752
259 Ga0501072_0005775 3300049588 Bacteria 9421
260 Ga0501072_0065771 3300049588 Bacteria 2859
261 Ga0501072_0212808 3300049588 Bacteria 1540
262 Ga0501072_0726621 3300049588 Bacteria 780
263 Ga0501074_0106058 3300049590 Bacteria 2012
264 Ga0501074_0166840 3300049590 Bacteria 1572
265 Ga0501074_0398677 3300049590 Unclassified 976
266 Ga0501075_0045188 3300049591 Bacteria 3305
267 Ga0501075_0052240 3300049591 Bacteria 3073
268 Ga0501075_0079172 3300049591 Bacteria 2487
269 Ga0501075_0547868 3300049591 Unclassified 883
270 Ga0501075_1061081 3300049591 Archaea 615
271 Ga0501076_0023182 3300049592 Bacteria 4782
272 Ga0501076_0072875 3300049592 Bacteria 2749
273 Ga0501076_0082212 3300049592 Bacteria 2586
274 Ga0501076_0094480 3300049592 Bacteria 2407
275 Ga0501076_0225056 3300049592 Bacteria 1533
276 Ga0501076_1745728 3300049592 Unclassified 510
277 Ga0501077_0340896 3300049593 Unclassified 956
278 Ga0501230_044860 3300049667 Bacteria 865
279 Ga0501247_028806 3300049677 Bacteria 750
280 Ga0501247_070041 3300049677 Bacteria 552
281 Ga0501225_0027402 3300049705 Bacteria 1567
282 Ga0501079_0118323 3300049741 Bacteria 2059
283 Ga0501079_0163489 3300049741 Bacteria 1736
284 Ga0501079_0478852 3300049741 Unclassified 978
285 Ga0501079_0904098 3300049741 Archaea 695
286 Ga0501080_0335994 3300049742 Bacteria 1366
287 Ga0501080_0357219 3300049742 Bacteria 1318
288 Ga0501081_0053461 3300049743 Bacteria 2788
289 Ga0501081_0341684 3300049743 Bacteria 1102
290 Ga0501081_0773233 3300049743 Unclassified 722
291 Ga0501081_1190260 3300049743 Unclassified 577
292 Ga0501083_0136550 3300049744 Bacteria 1607
293 Ga0501035_1201362 3300049822 Bacteria 588
294 Ga0501045_0036002 3300049824 Bacteria 3594
295 Ga0501045_0058168 3300049824 Bacteria 2830
296 Ga0501045_0118590 3300049824 Bacteria 1964
297 Ga0501045_0237406 3300049824 Bacteria 1357
298 nmdc:mga0yw44_1018054_c1 3300050492 Unclassified 560
299 nmdc:mga0k408_167211_c1 3300050493 Unclassified 1311
300 nmdc:mga06z11_134517_c1 3300050494 Unclassified 1392
301 nmdc:mga04h51_61225_c1 3300050495 Unclassified 1291
302 nmdc:mga07m45_294484_c1 3300050496 Unclassified 944
303 nmdc:mga05p37_1004597_c1 3300050507 Unclassified 886
304 nmdc:mga0qj67_531188_c1 3300050509 Bacteria 944
305 nmdc:mga0qj67_536038_c1 3300050509 Bacteria 939
306 nmdc:mga0qj67_946859_c1 3300050509 Bacteria 677
307 nmdc:mga08y16_1368803_c1 3300050511 Bacteria 672
308 nmdc:mga08y16_1820_c1 3300050511 Bacteria 21625
309 nmdc:mga08y16_186839_c1 3300050511 Unclassified 2150
310 nmdc:mga08y16_41474_c1 3300050511 Bacteria 4821
311 nmdc:mga0n895_300810_c1 3300050512 Bacteria 1626
312 nmdc:mga0n895_7897_c1 3300050512 Bacteria 9174
313 nmdc:mga0rr50_283715_c1 3300050513 Bacteria 1382
314 nmdc:mga0a205_630_c1 3300050515 Bacteria 28020
315 Ga0501084_0027813 3300054114 Bacteria 4726
316 Ga0501084_0219973 3300054114 Bacteria 1602
317 Ga0501084_0226929 3300054114 Bacteria 1576
318 Ga0501084_0749954 3300054114 Bacteria 823
319 Ga0590071_009390 3300059421 Unclassified 2297
320 Ga0590071_062342 3300059421 Bacteria 912
321 Ga0590074_046623 3300059423 Unclassified 787
322 Ga0590075_022156 3300059424 Bacteria 1588
323 Ga0590075_027512 3300059424 Bacteria 1435
324 Ga0590075_155720 3300059424 Unclassified 602
325 Ga0590077_002960 3300059426 Bacteria 3559
326 Ga0501082_0056140 3300060353 Bacteria 3392
327 Ga0501082_0070548 3300060353 Bacteria 3008
328 Ga0530510_0176276 3300061734 Bacteria 1584
329 Ga0530510_0680087 3300061734 Bacteria 784
330 Ga0530510_0940920 3300061734 Bacteria 661
331 Ga0105237_10627162
332 JGI24751J29686_10056602
333 Ga0065714_10129445
334 Ga0065712_10007458
335 Ga0065712_10186426
336 Ga0065712_10525358
337 Ga0065715_10966857
338 Ga0070676_10764725
339 Ga0070670_100002548
340 Ga0070670_100110679
341 Ga0070670_102220857
342 Ga0070682_100053557
343 Ga0070660_100197490
344 Ga0070660_101401753
345 Ga0070661_100165275
346 Ga0070661_100506506
347 Ga0070668_100665045
348 Ga0070669_101902240
349 Ga0070674_100296900
350 Ga0070674_100329288
351 Ga0070674_100671825
352 Ga0070673_100247617
353 Ga0070659_100055948
354 Ga0070659_100092293
355 Ga0070659_101073260
356 Ga0070659_102062004
357 Ga0070708_100476220
358 Ga0070678_101859177
359 Ga0070662_100199133
360 Ga0070662_101053963
361 Ga0070681_10275022
362 Ga0070681_10608306
363 Ga0070681_11551685
364 Ga0068867_100817320
365 Ga0070706_100275616
366 Ga0070707_100151803
367 Ga0070698_100694252
368 Ga0070699_100626960
369 Ga0070684_101016029
370 Ga0070697_100130097
371 Ga0068853_100172531
372 Ga0070695_100661674
373 Ga0070696_101394792
374 Ga0070693_100041902
375 Ga0070665_101078580
376 Ga0070704_101142096
377 Ga0070704_101590876
378 Ga0068855_101147062
379 Ga0070664_101516497
380 Ga0068857_100120093
381 Ga0068857_100389392
382 Ga0068857_100620163
383 Ga0068857_101275762
384 Ga0068854_100636693
385 Ga0068856_100968469
386 Ga0068852_100480225
387 Ga0068864_100068619
388 Ga0068864_101625807
389 Ga0068861_101872599
390 Ga0068870_10688752
391 Ga0068858_100918970
392 Ga0068860_100085045
393 Ga0068862_100553064
394 Ga0081539_10229816
395 Ga0075368_10009264
396 Ga0075363_100502715
397 Ga0075364_10178117
398 Ga0075367_10031368
399 Ga0075366_10014030
400 Ga0075370_10117784
401 Ga0075428_101287335
402 Ga0075428_102586185
403 Ga0075430_100166986
404 Ga0075431_100027325
405 Ga0075431_100421948
406 Ga0075433_10004522
407 Ga0075434_100394067
408 Ga0075434_101736349
409 Ga0068865_101364715
410 Ga0075435_101357603
411 Ga0111539_10002400
412 Ga0111539_10047989
413 Ga0111539_10050284
414 Ga0105247_10023533
415 Ga0105247_11404725
416 Ga0114129_10133876
417 Ga0105248_13253668
418 Ga0105249_10519615
419 Ga0105249_12570998
420 Ga0105239_11871072
421 Ga0157370_10899630
422 Ga0163163_11408469
423 Ga0157380_10165210
424 Ga0157380_10712391
425 Ga0157380_13107408
426 Ga0157379_10958828
427 Ga0206352_10442457
428 Ga0207682_10067484
429 Ga0207645_10692200
430 Ga0207684_10145818
431 Ga0207707_10525877
432 Ga0207671_10406922
433 Ga0207693_10003540
434 Ga0207649_10118259
435 Ga0207649_10518561
436 Ga0207681_11729160
437 Ga0207650_10184294
438 Ga0207650_10370581
439 Ga0207690_10125995
440 Ga0207690_11684013
441 Ga0207690_11791586
442 Ga0207706_10138602
443 Ga0207706_11240800
444 Ga0207669_10942288
445 Ga0207661_10270657
446 Ga0207667_10903597
447 Ga0207712_10175869
448 Ga0207668_10430501
449 Ga0207703_10991226
450 Ga0207639_10089132
451 Ga0207708_12019343
452 Ga0207648_10738779
453 Ga0207676_10025548
454 Ga0207676_11288134
455 Ga0207674_10232613
456 Ga0207674_10358445
457 Ga0207674_10980357
458 Ga0207674_11060297
459 Ga0207674_11116571
460 Ga0207675_100466565
461 Ga0207675_100842559
462 Ga0207698_10450845
463 Ga0209813_10014976
464 Ga0207428_10155823
465 Ga0268265_10549441
466 Ga0316176_1146958
467 Ga0307408_100019276
468 Ga0307408_100041406
469 Ga0307408_100820441
470 Ga0307408_101079454
471 Ga0307408_101451790
472 Ga0307405_10013270
473 Ga0307405_10280469
474 Ga0307405_10336821
475 Ga0307405_11888921
476 Ga0307413_10026247
477 Ga0307413_10027736
478 Ga0307410_10029960
479 Ga0307410_10031052
480 Ga0307410_10045282
481 Ga0307410_10750549
482 Ga0307410_11189207
483 Ga0307406_10005546
484 Ga0307406_10879378
485 Ga0307406_11364492
486 Ga0307407_10009934
487 Ga0307407_10027249
488 Ga0307407_10028493
489 Ga0307412_10011813
490 Ga0307412_10030859
491 Ga0307412_10576604
492 Ga0307412_11209404
493 Ga0307409_100010622
494 Ga0307409_100031522
495 Ga0307409_100035886
496 Ga0307409_100746181
497 Ga0307409_101238387
498 Ga0307409_101314914
499 Ga0307416_100019655
500 Ga0307416_100048165
501 Ga0307416_100061221
502 Ga0307416_100312828
503 Ga0307416_100426230
504 Ga0307416_100485646
505 Ga0307416_101724731
506 Ga0307416_101827699
507 Ga0307416_102404532
508 Ga0307414_10015271
509 Ga0307414_10028704
510 Ga0307411_10003509
511 Ga0307411_10007027
512 Ga0307411_10161856
513 Ga0307411_10163890
514 Ga0307411_10286344
515 Ga0307411_10368249
516 Ga0307415_100038092
517 Ga0307415_100336949
518 Ga0307415_100447603
519 Ga0307415_102444459
520 Ga0373943_0501297
521 Ga0373947_0188969
522 Ga0373925_0443880
523 Ga0242420_155417
524 Ga0439436_0060130
525 Ga0439439_0135625
526 Ga0451795_0188219
527 Ga0451807_2361536
528 Ga0439431_0125661
529 Ga0439443_107357
530 Ga0439449_0034515
531 Ga0439451_031599
532 Ga0439462_0120831
533 Ga0450898_113299
534 Ga0439435_0014875
535 Ga0453683_0448482
536 Ga0495580_0513656
537 Ga0495642_0073682
538 Ga0495659_0068080
539 Ga0495658_0378195
540 Ga0496104_0903103
541 Ga0496106_1494961
542 Ga0496112_0192774
543 Ga0496112_0792946
544 Ga0501308_057805
545 Ga0501290_039738
546 Ga0501299_064432
547 Ga0501299_193640
548 Ga0501036_0100336
549 Ga0501036_1183699
550 Ga0501038_0215834
551 Ga0501038_0240312
552 Ga0501038_0360783
553 Ga0501038_1215499
554 Ga0501039_0073230
555 Ga0501039_0290961
556 Ga0501039_0502363
557 Ga0501039_1073589
558 Ga0501040_0102784
559 Ga0501040_0320108
560 Ga0501040_1386543
561 Ga0501041_0047061
562 Ga0501041_0085873
563 Ga0501041_0098619
564 Ga0501041_0345932
565 Ga0501042_0016720
566 Ga0501042_0106664
567 Ga0501042_0178171
568 Ga0501042_0289426
569 Ga0501042_0337983
570 Ga0501043_1241479
571 Ga0501046_0346558
572 Ga0501048_0009902
573 Ga0501048_0070319
574 Ga0501048_0217235
575 Ga0501048_0312187
576 Ga0501048_0548396
577 Ga0501048_1347479
578 Ga0501068_0358715
579 Ga0501068_0378487
580 Ga0501069_0513818
581 Ga0501069_0967421
582 Ga0501070_0940176
583 Ga0501070_1446581
584 Ga0501071_0022252
585 Ga0501071_0074670
586 Ga0501071_0123371
587 Ga0501071_0260256
588 Ga0501071_0749412
589 Ga0501072_0005775
590 Ga0501072_0065771
591 Ga0501072_0212808
592 Ga0501072_0726621
593 Ga0501074_0106058
594 Ga0501074_0166840
595 Ga0501074_0398677
596 Ga0501075_0045188
597 Ga0501075_0052240
598 Ga0501075_0079172
599 Ga0501075_0547868
600 Ga0501075_1061081
601 Ga0501076_0023182
602 Ga0501076_0072875
603 Ga0501076_0082212
604 Ga0501076_0094480
605 Ga0501076_0225056
606 Ga0501076_1745728
607 Ga0501077_0340896
608 Ga0501230_044860
609 Ga0501247_028806
610 Ga0501247_070041
611 Ga0501225_0027402
612 Ga0501079_0118323
613 Ga0501079_0163489
614 Ga0501079_0478852
615 Ga0501079_0904098
616 Ga0501080_0335994
617 Ga0501080_0357219
618 Ga0501081_0053461
619 Ga0501081_0341684
620 Ga0501081_0773233
621 Ga0501081_1190260
622 Ga0501083_0136550
623 Ga0501035_1201362
624 Ga0501045_0036002
625 Ga0501045_0058168
626 Ga0501045_0118590
627 Ga0501045_0237406
628 nmdc:mga0yw44_1018054_c1
629 nmdc:mga0k408_167211_c1
630 nmdc:mga06z11_134517_c1
631 nmdc:mga04h51_61225_c1
632 nmdc:mga07m45_294484_c1
633 nmdc:mga05p37_1004597_c1
634 nmdc:mga0qj67_531188_c1
635 nmdc:mga0qj67_536038_c1
636 nmdc:mga0qj67_946859_c1
637 nmdc:mga08y16_1368803_c1
638 nmdc:mga08y16_1820_c1
639 nmdc:mga08y16_186839_c1
640 nmdc:mga08y16_41474_c1
641 nmdc:mga0n895_300810_c1
642 nmdc:mga0n895_7897_c1
643 nmdc:mga0rr50_283715_c1
644 nmdc:mga0a205_630_c1
645 Ga0501084_0027813
646 Ga0501084_0219973
647 Ga0501084_0226929
648 Ga0501084_0749954
649 Ga0590071_009390
650 Ga0590071_062342
651 Ga0590074_046623
652 Ga0590075_022156
653 Ga0590075_027512
654 Ga0590075_155720
655 Ga0590077_002960
656 Ga0501082_0056140
657 Ga0501082_0070548
658 Ga0530510_0176276
659 Ga0530510_0680087
660 Ga0530510_0940920

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02416

TatA_B_E

mttA/Hcf106 family

10

59

0.94

Map