F409961

General Info

Members Datasets Scaffolds Average Seq Length
330 207 660 276

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100423955|Ga0070660_1004239551
Length 293
Sequence MLGSRMAAEERIQMLGRSTMAAVREHAGSASELAAQLARDKKFRKQLGGAAKHGSRAKQRVVGQIGSLSLVRRLATDAELHAEVQQMTNDLQAAWERLQSKRNRSHGLRNTLLLAGLAGGALALHRRRTSKSSVSGSTTPRVIESSIEVDVPVSAAYNQWTQFEEFPQFMDGVEEVRQLGDTRLHWVASVGGRRAEWDAKILEQHPDRQISWISEDGKKTRGTVTFESLGEERTLVRLSLGYQAEGFVEAVGSAAGFDRRRVEGDLARFKELIEGRGTATGAWREDISAGTTT

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
178 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 3.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 16.06
Rhizosphere 83.64
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100423955 3300005339 Bacteria 1102
2 JGI24744J21845_10000181 3300002077 Bacteria 9562
3 Ga0070683_100123938 3300005329 Bacteria 2442
4 Ga0070683_100127879 3300005329 Bacteria 2403
5 Ga0068869_100162965 3300005334 Bacteria 1737
6 Ga0070680_100013219 3300005336 Bacteria 6426
7 Ga0070680_100072486 3300005336 Bacteria 2831
8 Ga0070682_100031114 3300005337 Bacteria 3227
9 Ga0070682_100038465 3300005337 Bacteria 2935
10 Ga0068868_100019390 3300005338 Bacteria 5096
11 Ga0070660_100007296 3300005339 Bacteria 7702
12 Ga0070660_100014367 3300005339 Bacteria 5701
13 Ga0070689_100022318 3300005340 Bacteria 4725
14 Ga0070692_10001128 3300005345 Bacteria 9362
15 Ga0070668_100068937 3300005347 Bacteria 2750
16 Ga0070669_100469178 3300005353 Bacteria 1040
17 Ga0070671_100093109 3300005355 Bacteria 2526
18 Ga0070673_100022216 3300005364 Bacteria 4615
19 Ga0070688_100001637 3300005365 Bacteria 11211
20 Ga0070659_100003858 3300005366 Bacteria 10679
21 Ga0070667_100452569 3300005367 Bacteria 1173
22 Ga0070703_10007107 3300005406 Bacteria 3141
23 Ga0070709_10067560 3300005434 Bacteria 2296
24 Ga0070710_10000713 3300005437 Bacteria 15822
25 Ga0070701_10004124 3300005438 Bacteria 5837
26 Ga0070711_100002941 3300005439 Bacteria 9818
27 Ga0070705_100003202 3300005440 Bacteria 8040
28 Ga0070700_100001846 3300005441 Bacteria 10686
29 Ga0070694_100069102 3300005444 Bacteria 2429
30 Ga0070708_100074611 3300005445 Bacteria 3059
31 Ga0070663_100051315 3300005455 Bacteria 2938
32 Ga0070678_100002328 3300005456 Bacteria 10374
33 Ga0070678_100195732 3300005456 Bacteria 1665
34 Ga0070662_100062333 3300005457 Bacteria 2724
35 Ga0070681_10273163 3300005458 Bacteria 1601
36 Ga0068867_100001594 3300005459 Bacteria 15761
37 Ga0070685_10001024 3300005466 Bacteria 15029
38 Ga0070706_100009666 3300005467 Bacteria 8965
39 Ga0070706_100021807 3300005467 Bacteria 5898
40 Ga0070707_100004556 3300005468 Bacteria 12978
41 Ga0070698_100009637 3300005471 Bacteria 10333
42 Ga0070698_100080311 3300005471 Bacteria 3256
43 Ga0070679_100097264 3300005530 Bacteria 2931
44 Ga0070684_100177562 3300005535 Bacteria 1936
45 Ga0068853_100025497 3300005539 Bacteria 4962
46 Ga0068853_100085397 3300005539 Bacteria 2767
47 Ga0070672_100025305 3300005543 Bacteria 4400
48 Ga0070686_100000736 3300005544 Bacteria 18946
49 Ga0070696_100006220 3300005546 Bacteria 7987
50 Ga0070696_100072717 3300005546 Bacteria 2422
51 Ga0070693_100158479 3300005547 Bacteria 1439
52 Ga0070665_100029675 3300005548 Bacteria 5503
53 Ga0068855_100174631 3300005563 Bacteria 2432
54 Ga0068855_100319762 3300005563 Bacteria 1716
55 Ga0068856_100030250 3300005614 Bacteria 5294
56 Ga0068856_100075509 3300005614 Bacteria 3338
57 Ga0068856_100086836 3300005614 Bacteria 3109
58 Ga0068856_100130298 3300005614 Bacteria 2519
59 Ga0070702_100001219 3300005615 Bacteria 10404
60 Ga0070702_100175217 3300005615 Bacteria 1398
61 Ga0068864_100018319 3300005618 Bacteria 5848
62 Ga0068866_10000740 3300005718 Bacteria 14779
63 Ga0068861_100017036 3300005719 Bacteria 5152
64 Ga0068860_100029283 3300005843 Bacteria 5296
65 Ga0068862_100037834 3300005844 Bacteria 4091
66 Ga0081539_10000639 3300005985 Bacteria 70847
67 Ga0070717_10025875 3300006028 Bacteria 4676
68 Ga0070716_100255716 3300006173 Bacteria 1196
69 Ga0070712_100002657 3300006175 Bacteria 11034
70 Ga0070712_100014002 3300006175 Bacteria 5139
71 Ga0070712_100289119 3300006175 Bacteria 1323
72 Ga0097621_100007392 3300006237 Bacteria 7859
73 Ga0075433_10114762 3300006852 Bacteria 2390
74 Ga0075434_100006684 3300006871 Bacteria 10589
75 Ga0075434_100099611 3300006871 Bacteria 2912
76 Ga0075434_100542590 3300006871 Bacteria 1183
77 Ga0068865_100066205 3300006881 Bacteria 2548
78 Ga0075436_100047938 3300006914 Bacteria 2947
79 Ga0075435_100008812 3300007076 Bacteria 7266
80 Ga0075435_100059777 3300007076 Bacteria 3089
81 Ga0111539_10426604 3300009094 Bacteria 1544
82 Ga0111539_10992818 3300009094 Bacteria 976
83 Ga0105245_10008809 3300009098 Bacteria 8800
84 Ga0105247_10094741 3300009101 Bacteria 1900
85 Ga0114129_10025096 3300009147 Bacteria 8447
86 Ga0114129_10441158 3300009147 Bacteria 1709
87 Ga0105243_10005442 3300009148 Bacteria 9934
88 Ga0105241_10050213 3300009174 Bacteria 3179
89 Ga0105242_10007888 3300009176 Bacteria 8193
90 Ga0105248_10010928 3300009177 Bacteria 10016
91 Ga0105237_10207638 3300009545 Bacteria 1959
92 Ga0105249_10001521 3300009553 Bacteria 20340
93 Ga0105249_10297910 3300009553 Bacteria 1616
94 Ga0105239_10006861 3300010375 Bacteria 13141
95 Ga0105239_10171805 3300010375 Bacteria 2424
96 Ga0105246_10043866 3300011119 Bacteria 3036
97 Ga0105246_10245007 3300011119 Bacteria 1419
98 Ga0157373_10109039 3300013100 Bacteria 1946
99 Ga0157369_10007810 3300013105 Bacteria 12312
100 Ga0157369_10183011 3300013105 Bacteria 2204
101 Ga0157369_10797894 3300013105 Bacteria 970
102 Ga0157374_10011970 3300013296 Bacteria 7532
103 Ga0157378_10009603 3300013297 Bacteria 8424
104 Ga0163162_10001978 3300013306 Bacteria 19240
105 Ga0163162_10035609 3300013306 Bacteria 4959
106 Ga0157372_10156631 3300013307 Bacteria 2631
107 Ga0157375_10053173 3300013308 Bacteria 3983
108 Ga0157375_10103272 3300013308 Bacteria 2937
109 Ga0157380_10005054 3300014326 Bacteria 9204
110 Ga0182008_10002834 3300014497 Bacteria 10719
111 Ga0182008_10018548 3300014497 Bacteria 3603
112 Ga0157376_10029176 3300014969 Bacteria 4393
113 Ga0182007_10013713 3300015262 Bacteria 3080
114 Ga0163161_10065006 3300017792 Bacteria 2662
115 Ga0206356_10563923 3300020070 Bacteria 1309
116 Ga0206356_10896669 3300020070 Bacteria 1093
117 Ga0206356_10899208 3300020070 Bacteria 1374
118 Ga0206349_1515719 3300020075 Bacteria 1076
119 Ga0206351_10959794 3300020077 Bacteria 973
120 Ga0206350_10571395 3300020080 Bacteria 1283
121 Ga0206350_10803332 3300020080 Bacteria 1379
122 Ga0206350_10948805 3300020080 Bacteria 1385
123 Ga0206354_11078671 3300020081 Bacteria 1200
124 Ga0224712_10119581 3300022467 Bacteria 1139
125 Ga0224712_10130254 3300022467 Bacteria 1098
126 Ga0207692_10012869 3300025898 Bacteria 3609
127 Ga0207642_10026928 3300025899 Bacteria 2347
128 Ga0207688_10021451 3300025901 Bacteria 3529
129 Ga0207705_10326575 3300025909 Bacteria 1179
130 Ga0207654_10017984 3300025911 Bacteria 3705
131 Ga0207693_10000617 3300025915 Bacteria 31829
132 Ga0207693_10005140 3300025915 Bacteria 10962
133 Ga0207693_10207734 3300025915 Bacteria 1539
134 Ga0207657_10001007 3300025919 Bacteria 29974
135 Ga0207657_10015014 3300025919 Bacteria 7520
136 Ga0207649_10124417 3300025920 Bacteria 1743
137 Ga0207646_10015183 3300025922 Bacteria 7285
138 Ga0207681_10180343 3300025923 Bacteria 1608
139 Ga0207694_10113187 3300025924 Bacteria 2160
140 Ga0207687_10089455 3300025927 Bacteria 2242
141 Ga0207644_10016688 3300025931 Bacteria 4944
142 Ga0207686_10000748 3300025934 Bacteria 20052
143 Ga0207709_10000475 3300025935 Bacteria 36832
144 Ga0207669_10002274 3300025937 Bacteria 8173
145 Ga0207704_10000429 3300025938 Bacteria 18788
146 Ga0207691_10022591 3300025940 Bacteria 5931
147 Ga0207661_10061418 3300025944 Bacteria 3036
148 Ga0207661_10083679 3300025944 Bacteria 2641
149 Ga0207667_10673584 3300025949 Bacteria 1038
150 Ga0207651_10018046 3300025960 Bacteria 4188
151 Ga0207677_10030661 3300026023 Bacteria 3435
152 Ga0207677_10232469 3300026023 Bacteria 1486
153 Ga0207639_10055355 3300026041 Bacteria 3036
154 Ga0207678_10018725 3300026067 Bacteria 6081
155 Ga0207708_10000247 3300026075 Bacteria 42525
156 Ga0207702_10021134 3300026078 Bacteria 5386
157 Ga0207702_10033313 3300026078 Bacteria 4303
158 Ga0207702_10402481 3300026078 Bacteria 1320
159 Ga0207648_10003533 3300026089 Bacteria 16345
160 Ga0207676_10026117 3300026095 Bacteria 4341
161 Ga0207675_100022521 3300026118 Bacteria 5866
162 Ga0207683_10002075 3300026121 Bacteria 17701
163 Ga0207698_10004571 3300026142 Bacteria 8447
164 Ga0268266_10007541 3300028379 Bacteria 9799
165 Ga0268265_10052993 3300028380 Bacteria 3072
166 Ga0307416_100031353 3300032002 Bacteria 4001
167 Ga0373935_0322767 3300035692 Bacteria 1096
168 Ga0373933_0382058 3300035724 Bacteria 917
169 Ga0373937_0120326 3300036401 Bacteria 2447
170 Ga0395899_0007433 3300037312 Bacteria 8462
171 Ga0395899_0030540 3300037312 Bacteria 4052
172 Ga0395900_0001525 3300037418 Bacteria 27540
173 Ga0395900_0047489 3300037418 Bacteria 4420
174 Ga0395900_0094250 3300037418 Bacteria 3075
175 Ga0395900_0120872 3300037418 Bacteria 2687
176 Ga0395898_0001639 3300037466 Bacteria 30312
177 Ga0395898_0017752 3300037466 Bacteria 7262
178 Ga0395898_0038910 3300037466 Bacteria 4710
179 Ga0395898_0120693 3300037466 Bacteria 2511
180 Ga0395898_0139348 3300037466 Bacteria 2322
181 Ga0395905_0004071 3300037471 Bacteria 15324
182 Ga0395905_0047026 3300037471 Bacteria 4045
183 Ga0395905_0096915 3300037471 Bacteria 2769
184 Ga0395905_0181412 3300037471 Bacteria 1976
185 Ga0395901_0005931 3300038443 Bacteria 12373
186 Ga0395901_0014617 3300038443 Bacteria 7978
187 Ga0395901_0023586 3300038443 Bacteria 6308
188 Ga0395901_0124676 3300038443 Bacteria 2706
189 Ga0395901_0144861 3300038443 Bacteria 2497
190 Ga0395901_0209037 3300038443 Bacteria 2043
191 Ga0395901_0224246 3300038443 Bacteria 1964
192 Ga0466965_0067852 3300044683 Bacteria 1790
193 Ga0466961_0034800 3300044693 Bacteria 3234
194 Ga0466963_0003100 3300044694 Bacteria 9423
195 Ga0466964_0107988 3300044706 Bacteria 1237
196 Ga0466964_0210772 3300044706 Bacteria 938
197 Ga0466971_0002471 3300044719 Bacteria 7808
198 Ga0466970_0183499 3300044765 Bacteria 1161
199 Ga0466957_0009046 3300044842 Bacteria 5677
200 Ga0466957_0171249 3300044842 Bacteria 1414
201 Ga0466960_0056782 3300044901 Bacteria 1907
202 Ga0466959_0006040 3300045049 Bacteria 8357
203 Ga0466967_0063028 3300045976 Bacteria 3292
204 Ga0466967_0087310 3300045976 Bacteria 2827
205 Ga0466967_0087919 3300045976 Bacteria 2818
206 Ga0466967_0143643 3300045976 Bacteria 2224
207 Ga0466967_0202370 3300045976 Bacteria 1881
208 Ga0466967_0287663 3300045976 Bacteria 1578
209 Ga0466967_0334726 3300045976 Bacteria 1462
210 Ga0466967_0364507 3300045976 Bacteria 1401
211 Ga0495617_035589 3300046452 Bacteria 1672
212 Ga0495592_0161456 3300046454 Bacteria 1541
213 Ga0495629_0010453 3300046459 Bacteria 6751
214 Ga0495629_0238098 3300046459 Unclassified 1253
215 Ga0495641_0010212 3300046461 Bacteria 5470
216 Ga0495641_0083474 3300046461 Bacteria 1431
217 Ga0495651_0209035 3300046462 Bacteria 1360
218 Ga0495582_0027619 3300046473 Bacteria 3112
219 Ga0495582_0038214 3300046473 Bacteria 2641
220 Ga0495605_0146230 3300046474 Bacteria 1057
221 Ga0495662_0038007 3300046476 Unclassified 2326
222 Ga0495584_0021825 3300046491 Bacteria 3251
223 Ga0495585_0012859 3300046492 Bacteria 4920
224 Ga0495607_0037376 3300046501 Bacteria 2917
225 Ga0495608_0036402 3300046511 Bacteria 3314
226 Ga0495628_0297902 3300046516 Bacteria 1194
227 Ga0495637_0127948 3300046520 Bacteria 972
228 Ga0495644_0061397 3300046523 Bacteria 1412
229 Ga0495652_0200332 3300046529 Bacteria 1515
230 Ga0495640_0004060 3300046533 Bacteria 11712
231 Ga0495587_0005451 3300046536 Bacteria 8299
232 Ga0495645_0140470 3300046543 Bacteria 1685
233 Ga0495667_0178374 3300046559 Bacteria 1364
234 Ga0495667_0213479 3300046559 Bacteria 1233
235 Ga0495656_0017447 3300046615 Bacteria 2739
236 Ga0495656_0209288 3300046615 Bacteria 971
237 Ga0495634_0011424 3300046642 Bacteria 6468
238 Ga0495611_0036747 3300046648 Bacteria 2175
239 Ga0495659_0010553 3300046664 Bacteria 2967
240 Ga0495588_0055085 3300046674 Bacteria 2052
241 Ga0495599_0011884 3300046678 Bacteria 5356
242 Ga0495623_0112355 3300046679 Bacteria 1650
243 Ga0495613_0013074 3300046689 Bacteria 6167
244 Ga0495613_0281014 3300046689 Bacteria 1156
245 Ga0495624_0080800 3300046690 Bacteria 2014
246 Ga0495670_0084132 3300046691 Bacteria 1623
247 Ga0495589_0010694 3300046794 Bacteria 4770
248 Ga0495581_0026326 3300047315 Bacteria 3372
249 Ga0495674_0136752 3300047319 Bacteria 2061
250 Ga0495674_0253810 3300047319 Bacteria 1447
251 Ga0495680_0027367 3300047322 Bacteria 4687
252 Ga0495680_0028304 3300047322 Bacteria 4596
253 Ga0495683_0100258 3300047323 Bacteria 1393
254 Ga0495614_0102922 3300048089 Unclassified 1250
255 Ga0496100_0000413 3300048903 Bacteria 20662
256 Ga0496100_0062415 3300048903 Bacteria 2459
257 Ga0496100_0062843 3300048903 Bacteria 2452
258 Ga0496101_0003535 3300048904 Bacteria 9748
259 Ga0496101_0077399 3300048904 Bacteria 2451
260 Ga0496102_0009445 3300048905 Bacteria 8379
261 Ga0496102_0064485 3300048905 Bacteria 3355
262 Ga0496102_0095665 3300048905 Bacteria 2753
263 Ga0496102_0542046 3300048905 Bacteria 1086
264 Ga0496103_0000978 3300048906 Bacteria 20218
265 Ga0496103_0041431 3300048906 Bacteria 2831
266 Ga0496104_0000432 3300048907 Bacteria 36339
267 Ga0496104_0001809 3300048907 Bacteria 18537
268 Ga0496104_0007640 3300048907 Bacteria 9572
269 Ga0496104_0036819 3300048907 Bacteria 4575
270 Ga0496105_0000348 3300048908 Bacteria 30485
271 Ga0496105_0028485 3300048908 Unclassified 4567
272 Ga0496105_0056400 3300048908 Bacteria 3242
273 Ga0496105_0246796 3300048908 Bacteria 1447
274 Ga0496106_0001300 3300048909 Bacteria 18751
275 Ga0496106_0013997 3300048909 Bacteria 5930
276 Ga0496107_0001337 3300048910 Bacteria 15121
277 Ga0496107_0037215 3300048910 Bacteria 3492
278 Ga0496107_0429384 3300048910 Bacteria 982
279 Ga0496108_0002188 3300048911 Bacteria 15680
280 Ga0496108_0005047 3300048911 Bacteria 10662
281 Ga0496108_0130912 3300048911 Bacteria 2156
282 Ga0496108_0445693 3300048911 Bacteria 1131
283 Ga0496109_0005417 3300048912 Bacteria 10672
284 Ga0496109_0021066 3300048912 Bacteria 5764
285 Ga0496109_0096003 3300048912 Unclassified 2746
286 Ga0496109_0226222 3300048912 Bacteria 1760
287 Ga0496109_1090584 3300048912 Bacteria 735
288 Ga0496110_0000944 3300048913 Bacteria 20341
289 Ga0496110_0093869 3300048913 Bacteria 2686
290 Ga0496110_0133536 3300048913 Bacteria 2242
291 Ga0496111_0000045 3300048914 Bacteria 48903
292 Ga0496111_0002098 3300048914 Bacteria 11897
293 Ga0496112_0000570 3300048915 Bacteria 25364
294 Ga0496112_0000825 3300048915 Bacteria 21994
295 Ga0496112_0013632 3300048915 Bacteria 7511
296 Ga0496112_0015155 3300048915 Bacteria 7184
297 Ga0496112_0053471 3300048915 Bacteria 3966
298 Ga0496112_0063058 3300048915 Bacteria 3656
299 Ga0496112_0160568 3300048915 Bacteria 2214
300 Ga0496113_0000076 3300048916 Bacteria 42925
301 Ga0496113_0022924 3300048916 Bacteria 4424
302 Ga0496113_0112915 3300048916 Bacteria 2117
303 Ga0496113_0275583 3300048916 Bacteria 1345
304 Ga0496114_0008355 3300048917 Bacteria 8200
305 Ga0496114_0041150 3300048917 Bacteria 3829
306 Ga0496115_0001180 3300048918 Bacteria 18754
307 Ga0496115_0086733 3300048918 Bacteria 2554
308 nmdc:mga0yw44_113557_c1 3300050492 Bacteria 1738
309 nmdc:mga05p37_39035_c1 3300050507 Bacteria 5825
310 nmdc:mga05p37_416682_c1 3300050507 Bacteria 1564
311 nmdc:mga09592_469007_c1 3300050508 Bacteria 1085
312 nmdc:mga06r32_242290_c1 3300050510 Bacteria 1790
313 nmdc:mga08y16_226490_c1 3300050511 Bacteria 1934
314 nmdc:mga08y16_332298_c1 3300050511 Bacteria 1563
315 nmdc:mga0n895_12942_c2 3300050512 Bacteria 4931
316 nmdc:mga0n895_201719_c1 3300050512 Bacteria 2020
317 nmdc:mga0rr50_229554_c1 3300050513 Bacteria 1535
318 nmdc:mga0rr50_258058_c1 3300050513 Bacteria 1450
319 nmdc:mga08x19_65900_c1 3300050514 Bacteria 2353
320 nmdc:mga0a205_359218_c1 3300050515 Bacteria 1323
321 nmdc:mga0a205_39178_c1 3300050515 Bacteria 4561
322 nmdc:mga0a205_42709_c1 3300050515 Bacteria 4368
323 Ga0495601_0107537 3300053077 Bacteria 1804
324 Ga0495612_0095807 3300053078 Bacteria 1260
325 Ga0495619_0016893 3300053085 Bacteria 4622
326 Ga0495619_0036419 3300053085 Bacteria 3204
327 Ga0495619_0071342 3300053085 Bacteria 2324
328 Ga0495619_0105684 3300053085 Bacteria 1920
329 Ga0466962_0018017 3300061719 Bacteria 3397
330 Ga0466962_0032432 3300061719 Bacteria 2501
331 Ga0070660_100423955
332 JGI24744J21845_10000181
333 Ga0070683_100123938
334 Ga0070683_100127879
335 Ga0068869_100162965
336 Ga0070680_100013219
337 Ga0070680_100072486
338 Ga0070682_100031114
339 Ga0070682_100038465
340 Ga0068868_100019390
341 Ga0070660_100007296
342 Ga0070660_100014367
343 Ga0070689_100022318
344 Ga0070692_10001128
345 Ga0070668_100068937
346 Ga0070669_100469178
347 Ga0070671_100093109
348 Ga0070673_100022216
349 Ga0070688_100001637
350 Ga0070659_100003858
351 Ga0070667_100452569
352 Ga0070703_10007107
353 Ga0070709_10067560
354 Ga0070710_10000713
355 Ga0070701_10004124
356 Ga0070711_100002941
357 Ga0070705_100003202
358 Ga0070700_100001846
359 Ga0070694_100069102
360 Ga0070708_100074611
361 Ga0070663_100051315
362 Ga0070678_100002328
363 Ga0070678_100195732
364 Ga0070662_100062333
365 Ga0070681_10273163
366 Ga0068867_100001594
367 Ga0070685_10001024
368 Ga0070706_100009666
369 Ga0070706_100021807
370 Ga0070707_100004556
371 Ga0070698_100009637
372 Ga0070698_100080311
373 Ga0070679_100097264
374 Ga0070684_100177562
375 Ga0068853_100025497
376 Ga0068853_100085397
377 Ga0070672_100025305
378 Ga0070686_100000736
379 Ga0070696_100006220
380 Ga0070696_100072717
381 Ga0070693_100158479
382 Ga0070665_100029675
383 Ga0068855_100174631
384 Ga0068855_100319762
385 Ga0068856_100030250
386 Ga0068856_100075509
387 Ga0068856_100086836
388 Ga0068856_100130298
389 Ga0070702_100001219
390 Ga0070702_100175217
391 Ga0068864_100018319
392 Ga0068866_10000740
393 Ga0068861_100017036
394 Ga0068860_100029283
395 Ga0068862_100037834
396 Ga0081539_10000639
397 Ga0070717_10025875
398 Ga0070716_100255716
399 Ga0070712_100002657
400 Ga0070712_100014002
401 Ga0070712_100289119
402 Ga0097621_100007392
403 Ga0075433_10114762
404 Ga0075434_100006684
405 Ga0075434_100099611
406 Ga0075434_100542590
407 Ga0068865_100066205
408 Ga0075436_100047938
409 Ga0075435_100008812
410 Ga0075435_100059777
411 Ga0111539_10426604
412 Ga0111539_10992818
413 Ga0105245_10008809
414 Ga0105247_10094741
415 Ga0114129_10025096
416 Ga0114129_10441158
417 Ga0105243_10005442
418 Ga0105241_10050213
419 Ga0105242_10007888
420 Ga0105248_10010928
421 Ga0105237_10207638
422 Ga0105249_10001521
423 Ga0105249_10297910
424 Ga0105239_10006861
425 Ga0105239_10171805
426 Ga0105246_10043866
427 Ga0105246_10245007
428 Ga0157373_10109039
429 Ga0157369_10007810
430 Ga0157369_10183011
431 Ga0157369_10797894
432 Ga0157374_10011970
433 Ga0157378_10009603
434 Ga0163162_10001978
435 Ga0163162_10035609
436 Ga0157372_10156631
437 Ga0157375_10053173
438 Ga0157375_10103272
439 Ga0157380_10005054
440 Ga0182008_10002834
441 Ga0182008_10018548
442 Ga0157376_10029176
443 Ga0182007_10013713
444 Ga0163161_10065006
445 Ga0206356_10563923
446 Ga0206356_10896669
447 Ga0206356_10899208
448 Ga0206349_1515719
449 Ga0206351_10959794
450 Ga0206350_10571395
451 Ga0206350_10803332
452 Ga0206350_10948805
453 Ga0206354_11078671
454 Ga0224712_10119581
455 Ga0224712_10130254
456 Ga0207692_10012869
457 Ga0207642_10026928
458 Ga0207688_10021451
459 Ga0207705_10326575
460 Ga0207654_10017984
461 Ga0207693_10000617
462 Ga0207693_10005140
463 Ga0207693_10207734
464 Ga0207657_10001007
465 Ga0207657_10015014
466 Ga0207649_10124417
467 Ga0207646_10015183
468 Ga0207681_10180343
469 Ga0207694_10113187
470 Ga0207687_10089455
471 Ga0207644_10016688
472 Ga0207686_10000748
473 Ga0207709_10000475
474 Ga0207669_10002274
475 Ga0207704_10000429
476 Ga0207691_10022591
477 Ga0207661_10061418
478 Ga0207661_10083679
479 Ga0207667_10673584
480 Ga0207651_10018046
481 Ga0207677_10030661
482 Ga0207677_10232469
483 Ga0207639_10055355
484 Ga0207678_10018725
485 Ga0207708_10000247
486 Ga0207702_10021134
487 Ga0207702_10033313
488 Ga0207702_10402481
489 Ga0207648_10003533
490 Ga0207676_10026117
491 Ga0207675_100022521
492 Ga0207683_10002075
493 Ga0207698_10004571
494 Ga0268266_10007541
495 Ga0268265_10052993
496 Ga0307416_100031353
497 Ga0373935_0322767
498 Ga0373933_0382058
499 Ga0373937_0120326
500 Ga0395899_0007433
501 Ga0395899_0030540
502 Ga0395900_0001525
503 Ga0395900_0047489
504 Ga0395900_0094250
505 Ga0395900_0120872
506 Ga0395898_0001639
507 Ga0395898_0017752
508 Ga0395898_0038910
509 Ga0395898_0120693
510 Ga0395898_0139348
511 Ga0395905_0004071
512 Ga0395905_0047026
513 Ga0395905_0096915
514 Ga0395905_0181412
515 Ga0395901_0005931
516 Ga0395901_0014617
517 Ga0395901_0023586
518 Ga0395901_0124676
519 Ga0395901_0144861
520 Ga0395901_0209037
521 Ga0395901_0224246
522 Ga0466965_0067852
523 Ga0466961_0034800
524 Ga0466963_0003100
525 Ga0466964_0107988
526 Ga0466964_0210772
527 Ga0466971_0002471
528 Ga0466970_0183499
529 Ga0466957_0009046
530 Ga0466957_0171249
531 Ga0466960_0056782
532 Ga0466959_0006040
533 Ga0466967_0063028
534 Ga0466967_0087310
535 Ga0466967_0087919
536 Ga0466967_0143643
537 Ga0466967_0202370
538 Ga0466967_0287663
539 Ga0466967_0334726
540 Ga0466967_0364507
541 Ga0495617_035589
542 Ga0495592_0161456
543 Ga0495629_0010453
544 Ga0495629_0238098
545 Ga0495641_0010212
546 Ga0495641_0083474
547 Ga0495651_0209035
548 Ga0495582_0027619
549 Ga0495582_0038214
550 Ga0495605_0146230
551 Ga0495662_0038007
552 Ga0495584_0021825
553 Ga0495585_0012859
554 Ga0495607_0037376
555 Ga0495608_0036402
556 Ga0495628_0297902
557 Ga0495637_0127948
558 Ga0495644_0061397
559 Ga0495652_0200332
560 Ga0495640_0004060
561 Ga0495587_0005451
562 Ga0495645_0140470
563 Ga0495667_0178374
564 Ga0495667_0213479
565 Ga0495656_0017447
566 Ga0495656_0209288
567 Ga0495634_0011424
568 Ga0495611_0036747
569 Ga0495659_0010553
570 Ga0495588_0055085
571 Ga0495599_0011884
572 Ga0495623_0112355
573 Ga0495613_0013074
574 Ga0495613_0281014
575 Ga0495624_0080800
576 Ga0495670_0084132
577 Ga0495589_0010694
578 Ga0495581_0026326
579 Ga0495674_0136752
580 Ga0495674_0253810
581 Ga0495680_0027367
582 Ga0495680_0028304
583 Ga0495683_0100258
584 Ga0495614_0102922
585 Ga0496100_0000413
586 Ga0496100_0062415
587 Ga0496100_0062843
588 Ga0496101_0003535
589 Ga0496101_0077399
590 Ga0496102_0009445
591 Ga0496102_0064485
592 Ga0496102_0095665
593 Ga0496102_0542046
594 Ga0496103_0000978
595 Ga0496103_0041431
596 Ga0496104_0000432
597 Ga0496104_0001809
598 Ga0496104_0007640
599 Ga0496104_0036819
600 Ga0496105_0000348
601 Ga0496105_0028485
602 Ga0496105_0056400
603 Ga0496105_0246796
604 Ga0496106_0001300
605 Ga0496106_0013997
606 Ga0496107_0001337
607 Ga0496107_0037215
608 Ga0496107_0429384
609 Ga0496108_0002188
610 Ga0496108_0005047
611 Ga0496108_0130912
612 Ga0496108_0445693
613 Ga0496109_0005417
614 Ga0496109_0021066
615 Ga0496109_0096003
616 Ga0496109_0226222
617 Ga0496109_1090584
618 Ga0496110_0000944
619 Ga0496110_0093869
620 Ga0496110_0133536
621 Ga0496111_0000045
622 Ga0496111_0002098
623 Ga0496112_0000570
624 Ga0496112_0000825
625 Ga0496112_0013632
626 Ga0496112_0015155
627 Ga0496112_0053471
628 Ga0496112_0063058
629 Ga0496112_0160568
630 Ga0496113_0000076
631 Ga0496113_0022924
632 Ga0496113_0112915
633 Ga0496113_0275583
634 Ga0496114_0008355
635 Ga0496114_0041150
636 Ga0496115_0001180
637 Ga0496115_0086733
638 nmdc:mga0yw44_113557_c1
639 nmdc:mga05p37_39035_c1
640 nmdc:mga05p37_416682_c1
641 nmdc:mga09592_469007_c1
642 nmdc:mga06r32_242290_c1
643 nmdc:mga08y16_226490_c1
644 nmdc:mga08y16_332298_c1
645 nmdc:mga0n895_12942_c2
646 nmdc:mga0n895_201719_c1
647 nmdc:mga0rr50_229554_c1
648 nmdc:mga0rr50_258058_c1
649 nmdc:mga08x19_65900_c1
650 nmdc:mga0a205_359218_c1
651 nmdc:mga0a205_39178_c1
652 nmdc:mga0a205_42709_c1
653 Ga0495601_0107537
654 Ga0495612_0095807
655 Ga0495619_0016893
656 Ga0495619_0036419
657 Ga0495619_0071342
658 Ga0495619_0105684
659 Ga0466962_0018017
660 Ga0466962_0032432

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

149

271

0.88

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

140

274

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2res-assembly1.cif.gz_A tetracenomycin aro/cyc mutant r69a 0.8722 135 270
3nj0-assembly1.cif.gz_A x-ray crystal structure of the pyl2-pyrabactin a complex 0.8635 135 267
3nr4-assembly2.cif.gz_C-2 pyrabactin-bound pyl2 0.8599 135 267
3kl1-assembly1.cif.gz_A crystal structure of abscisic acid receptor pyl2 at 1.55 a 0.856 135 269
3kl1-assembly1.cif.gz_B crystal structure of abscisic acid receptor pyl2 at 1.55 a 0.8474 135 269
ID Description Score Start End Superfamily
2resA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8722 135 270 3.30.530.20
af_Q9USM9_11_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8719 136 270 3.30.530.20
af_Q94K52_78_219_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8717 138 269 3.30.530.20
af_I6Y1P2_6_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8518 138 269 3.30.530.20
af_A0A1D8PNQ2_25_168_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8506 136 270 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A0Q5Z3Y1-F1-model_v4 Cyclase 0.9615 136 282
AF-A0A5C8I9K0-F1-model_v4 SRPBCC family protein 0.9604 137 270
AF-A0A166R6M1-F1-model_v4 Polyketide cyclase / dehydrase family protein 0.9582 135 281
AF-A0A0Q9MB17-F1-model_v4 Cyclase 0.9566 137 285
AF-A0A7X6K7T1-F1-model_v4 SRPBCC family protein 0.9557 137 283

Map