F409815

General Info

Members Datasets Scaffolds Average Seq Length
329 187 658 102

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0560238|Ga0495630_0560238_178_543
Length 121
Sequence MAPVFCVGCLHGWSDLKERKNKMDNKPAQNIQDSFLNTARKDKAVITIYLLSGVKLSGRIRSFDKYSVVLETNNQEQLIFKHAISTVVMARAHTDRPAHAGAPGGAPAPTSSAPSGNTPQG

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
177 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.57
Metatranscriptomes 2.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.26
Rhizosphere 94.83
Stem 0
Stem Tuber 0
Unclassified 34.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0560238 3300046517 Unclassified 876
2 Ga0070680_101645526 3300005336 Bacteria 556
3 Ga0068868_100210189 3300005338 Bacteria 1626
4 Ga0070691_10036255 3300005341 Bacteria 2324
5 Ga0070691_10445083 3300005341 Bacteria 739
6 Ga0070692_10700182 3300005345 Unclassified 682
7 Ga0070668_100451758 3300005347 Bacteria 1105
8 Ga0070667_100189822 3300005367 Bacteria 1820
9 Ga0070709_10058045 3300005434 Unclassified 2454
10 Ga0070709_10114198 3300005434 Bacteria 1820
11 Ga0070709_10249217 3300005434 Bacteria 1279
12 Ga0070709_10254256 3300005434 Unclassified 1267
13 Ga0070709_10388327 3300005434 Unclassified 1039
14 Ga0070714_100002798 3300005435 Bacteria 12869
15 Ga0070714_100170822 3300005435 Bacteria 1973
16 Ga0070714_101683718 3300005435 Unclassified 619
17 Ga0070713_100002561 3300005436 Bacteria 11894
18 Ga0070713_100030882 3300005436 Bacteria 4261
19 Ga0070713_100079307 3300005436 Bacteria 2797
20 Ga0070713_100375010 3300005436 Unclassified 1324
21 Ga0070713_100709637 3300005436 Unclassified 960
22 Ga0070713_101434257 3300005436 Unclassified 670
23 Ga0070713_101993976 3300005436 Bacteria 563
24 Ga0070710_10029399 3300005437 Bacteria 2948
25 Ga0070710_10408766 3300005437 Unclassified 911
26 Ga0070711_100182312 3300005439 Unclassified 1608
27 Ga0070711_100226593 3300005439 Unclassified 1455
28 Ga0070711_101284673 3300005439 Unclassified 635
29 Ga0070711_101399114 3300005439 Bacteria 609
30 Ga0070681_10588808 3300005458 Bacteria 1026
31 Ga0070706_100208995 3300005467 Bacteria 1823
32 Ga0070706_100242947 3300005467 Bacteria 1681
33 Ga0070706_101738873 3300005467 Unclassified 567
34 Ga0070707_100016271 3300005468 Bacteria 6981
35 Ga0070707_100075529 3300005468 Bacteria 3250
36 Ga0070707_100085136 3300005468 Bacteria 3055
37 Ga0070707_100336541 3300005468 Bacteria 1466
38 Ga0070707_100442065 3300005468 Bacteria 1261
39 Ga0070707_100766216 3300005468 Bacteria 928
40 Ga0070698_100366108 3300005471 Unclassified 1374
41 Ga0070698_100809203 3300005471 Unclassified 881
42 Ga0070699_100437579 3300005518 Bacteria 1185
43 Ga0070699_101168005 3300005518 Bacteria 706
44 Ga0070679_100209670 3300005530 Bacteria 1912
45 Ga0070684_100253253 3300005535 Bacteria 1609
46 Ga0070697_100023806 3300005536 Bacteria 4874
47 Ga0070697_100164864 3300005536 Bacteria 1873
48 Ga0070697_100536987 3300005536 Bacteria 1025
49 Ga0068853_100259518 3300005539 Bacteria 1597
50 Ga0070693_100136270 3300005547 Bacteria 1541
51 Ga0070665_102206205 3300005548 Unclassified 554
52 Ga0068855_100061542 3300005563 Bacteria 4386
53 Ga0068855_100084694 3300005563 Bacteria 3669
54 Ga0068857_100295002 3300005577 Bacteria 1494
55 Ga0068854_100070902 3300005578 Bacteria 2548
56 Ga0068854_100275911 3300005578 Bacteria 1352
57 Ga0068854_100386090 3300005578 Bacteria 1155
58 Ga0068856_100138361 3300005614 Unclassified 2441
59 Ga0068856_100271990 3300005614 Bacteria 1710
60 Ga0068856_100582230 3300005614 Bacteria 1140
61 Ga0068856_100773069 3300005614 Unclassified 980
62 Ga0068856_102465902 3300005614 Archaea 527
63 Ga0068852_100518134 3300005616 Bacteria 1189
64 Ga0068866_10580879 3300005718 Bacteria 754
65 Ga0068851_10075681 3300005834 Bacteria 1750
66 Ga0068863_100120141 3300005841 Unclassified 2505
67 Ga0068860_100292236 3300005843 Bacteria 1595
68 Ga0068862_100535287 3300005844 Unclassified 1117
69 Ga0070717_10135046 3300006028 Bacteria 2124
70 Ga0070717_10251841 3300006028 Bacteria 1560
71 Ga0070717_10367602 3300006028 Unclassified 1288
72 Ga0070717_10572517 3300006028 Unclassified 1024
73 Ga0070717_10758849 3300006028 Bacteria 882
74 Ga0070715_10123184 3300006163 Bacteria 1238
75 Ga0070715_10149505 3300006163 Bacteria 1143
76 Ga0070715_10382026 3300006163 Unclassified 778
77 Ga0070716_100001801 3300006173 Bacteria 9710
78 Ga0070716_101417174 3300006173 Bacteria 565
79 Ga0070712_100118979 3300006175 Unclassified 1985
80 Ga0070712_100450941 3300006175 Bacteria 1071
81 Ga0070712_101488011 3300006175 Unclassified 591
82 Ga0070712_101692655 3300006175 Unclassified 554
83 Ga0097621_101746441 3300006237 Bacteria 593
84 Ga0068871_101872769 3300006358 Unclassified 570
85 Ga0075434_100577645 3300006871 Unclassified 1143
86 Ga0075436_100008441 3300006914 Bacteria 7041
87 Ga0075436_100010617 3300006914 Bacteria 6316
88 Ga0075436_100172613 3300006914 Bacteria 1527
89 Ga0075436_100974387 3300006914 Unclassified 636
90 Ga0075435_100154405 3300007076 Unclassified 1931
91 Ga0075435_100254628 3300007076 Bacteria 1495
92 Ga0075435_100643985 3300007076 Unclassified 920
93 Ga0075435_101162173 3300007076 Bacteria 675
94 Ga0075435_101346328 3300007076 Unclassified 625
95 Ga0099794_10330506 3300007265 Bacteria 791
96 Ga0099795_10017122 3300007788 Unclassified 2306
97 Ga0099795_10062706 3300007788 Unclassified 1384
98 Ga0105240_10042090 3300009093 Bacteria 5823
99 Ga0105240_10112990 3300009093 Bacteria 3282
100 Ga0105240_10166096 3300009093 Bacteria 2618
101 Ga0105240_10980028 3300009093 Unclassified 905
102 Ga0105245_10218774 3300009098 Bacteria 1837
103 Ga0105241_10026464 3300009174 Bacteria 4316
104 Ga0105241_10882049 3300009174 Bacteria 829
105 Ga0105237_10080347 3300009545 Bacteria 3251
106 Ga0105237_10317405 3300009545 Unclassified 1561
107 Ga0105237_10964026 3300009545 Bacteria 860
108 Ga0105238_10027611 3300009551 Bacteria 5784
109 Ga0105238_10057076 3300009551 Bacteria 3915
110 Ga0105238_10581945 3300009551 Unclassified 1126
111 Ga0105238_11470535 3300009551 Unclassified 709
112 Ga0105249_11119742 3300009553 Bacteria 857
113 Ga0099796_10101701 3300010159 Bacteria 1082
114 Ga0099796_10252645 3300010159 Unclassified 732
115 Ga0105239_11688474 3300010375 Bacteria 733
116 Ga0105246_10361155 3300011119 Bacteria 1193
117 Ga0105246_11789119 3300011119 Bacteria 587
118 Ga0157373_10042985 3300013100 Unclassified 3228
119 Ga0157373_10308068 3300013100 Unclassified 1125
120 Ga0157370_10013122 3300013104 Bacteria 8548
121 Ga0157370_10908966 3300013104 Unclassified 799
122 Ga0157369_10011758 3300013105 Bacteria 9940
123 Ga0157369_10196603 3300013105 Unclassified 2117
124 Ga0157369_10256157 3300013105 Bacteria 1826
125 Ga0157374_10259773 3300013296 Bacteria 1710
126 Ga0157374_10566973 3300013296 Bacteria 1144
127 Ga0157378_10158823 3300013297 Bacteria 2113
128 Ga0163162_10213994 3300013306 Bacteria 2057
129 Ga0163162_11170346 3300013306 Unclassified 872
130 Ga0157372_10015349 3300013307 Bacteria 8209
131 Ga0157372_10080113 3300013307 Bacteria 3694
132 Ga0157372_10381017 3300013307 Unclassified 1643
133 Ga0157372_10399959 3300013307 Bacteria 1601
134 Ga0157372_10453212 3300013307 Bacteria 1495
135 Ga0163163_10035995 3300014325 Bacteria 4806
136 Ga0157379_11001305 3300014968 Bacteria 797
137 Ga0157376_12730185 3300014969 Unclassified 534
138 Ga0182007_10044671 3300015262 Bacteria 1469
139 Ga0182007_10403297 3300015262 Unclassified 521
140 Ga0206353_11273127 3300020082 Unclassified 539
141 Ga0207685_10112979 3300025905 Bacteria 1180
142 Ga0207685_10855359 3300025905 Unclassified 504
143 Ga0207699_10050093 3300025906 Bacteria 2461
144 Ga0207699_10073262 3300025906 Unclassified 2100
145 Ga0207699_10229876 3300025906 Unclassified 1270
146 Ga0207699_10370632 3300025906 Bacteria 1014
147 Ga0207699_11359924 3300025906 Bacteria 525
148 Ga0207684_10535530 3300025910 Unclassified 1002
149 Ga0207684_11440213 3300025910 Bacteria 563
150 Ga0207695_10006683 3300025913 Bacteria 14888
151 Ga0207695_10032139 3300025913 Bacteria 5747
152 Ga0207695_11389956 3300025913 Unclassified 582
153 Ga0207671_10179327 3300025914 Bacteria 1648
154 Ga0207671_10488386 3300025914 Unclassified 982
155 Ga0207693_10076046 3300025915 Bacteria 2630
156 Ga0207693_10177664 3300025915 Unclassified 1675
157 Ga0207693_10377579 3300025915 Bacteria 1109
158 Ga0207693_10598930 3300025915 Unclassified 858
159 Ga0207663_10479033 3300025916 Bacteria 964
160 Ga0207663_10572118 3300025916 Unclassified 885
161 Ga0207663_11130507 3300025916 Bacteria 630
162 Ga0207660_10635356 3300025917 Bacteria 870
163 Ga0207649_10319536 3300025920 Bacteria 1140
164 Ga0207646_10004437 3300025922 Bacteria 15226
165 Ga0207646_10056986 3300025922 Bacteria 3491
166 Ga0207646_10106126 3300025922 Bacteria 2519
167 Ga0207646_10317255 3300025922 Bacteria 1408
168 Ga0207646_10851619 3300025922 Unclassified 810
169 Ga0207694_10345388 3300025924 Bacteria 1231
170 Ga0207650_10114697 3300025925 Bacteria 2090
171 Ga0207687_10572582 3300025927 Bacteria 949
172 Ga0207700_10013275 3300025928 Bacteria 5352
173 Ga0207700_10039298 3300025928 Bacteria 3443
174 Ga0207700_10048939 3300025928 Bacteria 3141
175 Ga0207700_10498414 3300025928 Unclassified 1078
176 Ga0207664_10001882 3300025929 Bacteria 13797
177 Ga0207664_10049128 3300025929 Bacteria 3320
178 Ga0207664_10119715 3300025929 Bacteria 2201
179 Ga0207664_10387996 3300025929 Bacteria 1241
180 Ga0207664_10957002 3300025929 Bacteria 768
181 Ga0207665_10003172 3300025939 Bacteria 11015
182 Ga0207665_10084287 3300025939 Bacteria 2193
183 Ga0207665_10262970 3300025939 Bacteria 1279
184 Ga0207665_10944219 3300025939 Bacteria 685
185 Ga0207667_10082602 3300025949 Bacteria 3327
186 Ga0207712_11990277 3300025961 Bacteria 520
187 Ga0207640_10097156 3300025981 Bacteria 2055
188 Ga0207640_10180761 3300025981 Bacteria 1581
189 Ga0207677_10051982 3300026023 Bacteria 2781
190 Ga0207677_10204367 3300026023 Bacteria 1572
191 Ga0207639_10350572 3300026041 Bacteria 1318
192 Ga0207639_10583282 3300026041 Bacteria 1029
193 Ga0207702_10048088 3300026078 Bacteria 3597
194 Ga0207702_10214749 3300026078 Bacteria 1790
195 Ga0207641_11190564 3300026088 Bacteria 761
196 Ga0207676_11571661 3300026095 Bacteria 655
197 Ga0207698_10127995 3300026142 Bacteria 2164
198 Ga0209179_1047946 3300027512 Unclassified 911
199 Ga0209588_1207443 3300027671 Unclassified 609
200 Ga0265357_1029550 3300028023 Unclassified 623
201 Ga0268265_10115201 3300028380 Bacteria 2203
202 Ga0268264_10147266 3300028381 Bacteria 2107
203 Ga0265338_10106163 3300028800 Bacteria 2274
204 Ga0265774_106147 3300031011 Viruses 535
205 Ga0265760_10269172 3300031090 Bacteria 595
206 Ga0265325_10009975 3300031241 Bacteria 5522
207 Ga0265340_10012851 3300031247 Bacteria 4414
208 Ga0265340_10067500 3300031247 Bacteria 1700
209 Ga0265340_10077148 3300031247 Bacteria 1573
210 Ga0265339_10422145 3300031249 Unclassified 621
211 Ga0265331_10193863 3300031250 Bacteria 916
212 Ga0265331_10432113 3300031250 Unclassified 591
213 Ga0265327_10460147 3300031251 Unclassified 550
214 Ga0265316_10068317 3300031344 Bacteria 2746
215 Ga0265316_10085314 3300031344 Bacteria 2417
216 Ga0265316_10194969 3300031344 Bacteria 1503
217 Ga0307408_100725255 3300031548 Bacteria 896
218 Ga0265313_10028809 3300031595 Bacteria 2881
219 Ga0265314_10016761 3300031711 Bacteria 5773
220 Ga0265314_10105866 3300031711 Bacteria 1798
221 Ga0373934_0258707 3300035086 Unclassified 720
222 Ga0373934_0397855 3300035086 Unclassified 575
223 Ga0373923_0036320 3300035111 Bacteria 2011
224 Ga0373945_0097790 3300035116 Bacteria 1145
225 Ga0373954_0136720 3300035118 Bacteria 1194
226 Ga0373954_0286694 3300035118 Unclassified 812
227 Ga0373956_0137849 3300035119 Bacteria 1145
228 Ga0373943_0049802 3300035170 Unclassified 2057
229 Ga0373955_0809876 3300035172 Unclassified 576
230 Ga0373935_0006443 3300035692 Bacteria 7009
231 Ga0373927_0006742 3300035695 Bacteria 7815
232 Ga0373933_0256948 3300035724 Unclassified 1126
233 Ga0373933_1115734 3300035724 Unclassified 520
234 Ga0373947_0021601 3300035725 Bacteria 3726
235 Ga0373937_0052494 3300036401 Unclassified 3738
236 Ga0373937_0199887 3300036401 Bacteria 1879
237 Ga0373925_0010486 3300037068 Bacteria 6721
238 Ga0373925_0755625 3300037068 Unclassified 802
239 Ga0395900_0389647 3300037418 Bacteria 1360
240 Ga0395905_0582915 3300037471 Bacteria 1020
241 Ga0395901_1274617 3300038443 Bacteria 698
242 Ga0436365_1171267 3300039437 Bacteria 965
243 Ga0436360_0664705 3300039438 Bacteria 1062
244 Ga0436360_0800779 3300039438 Bacteria 884
245 Ga0436361_0333958 3300039447 Unclassified 529
246 Ga0436363_1182231 3300039450 Bacteria 7926
247 Ga0451839_1001908 3300041496 Bacteria 821
248 Ga0453683_0398312 3300044673 Unclassified 887
249 Ga0466965_0460156 3300044683 Unclassified 709
250 Ga0466966_0536415 3300044684 Bacteria 704
251 Ga0466961_0108649 3300044693 Unclassified 1746
252 Ga0466963_0476044 3300044694 Unclassified 881
253 Ga0466964_0125020 3300044706 Unclassified 1164
254 Ga0466957_0119166 3300044842 Unclassified 1681
255 Ga0466959_0067490 3300045049 Bacteria 2593
256 Ga0451576_0293196 3300045051 Bacteria 1701
257 Ga0451576_0858710 3300045051 Unclassified 953
258 Ga0466958_0188009 3300045836 Bacteria 1312
259 Ga0466967_0004784 3300045976 Bacteria 9220
260 Ga0466967_0005945 3300045976 Bacteria 8562
261 Ga0466967_0258700 3300045976 Unclassified 1665
262 Ga0495629_1038452 3300046459 Unclassified 532
263 Ga0495653_0883417 3300046463 Unclassified 533
264 Ga0495580_0000988 3300046472 Bacteria 24951
265 Ga0495582_0001483 3300046473 Bacteria 13262
266 Ga0495639_0015501 3300046475 Bacteria 3306
267 Ga0495662_0033865 3300046476 Bacteria 2468
268 Ga0495664_0296829 3300046477 Unclassified 976
269 Ga0495608_0431136 3300046511 Unclassified 804
270 Ga0495628_0514792 3300046516 Unclassified 863
271 Ga0495630_0645033 3300046517 Unclassified 811
272 Ga0495652_0699940 3300046529 Unclassified 682
273 Ga0495665_0020852 3300046531 Bacteria 3520
274 Ga0495665_0300349 3300046531 Unclassified 822
275 Ga0495587_0106955 3300046536 Bacteria 1609
276 Ga0495587_0158779 3300046536 Bacteria 1287
277 Ga0495667_0533779 3300046559 Bacteria 734
278 Ga0495635_0396198 3300046663 Unclassified 917
279 Ga0495659_0012909 3300046664 Bacteria 2714
280 Ga0495599_0174550 3300046678 Bacteria 1326
281 Ga0495599_0493205 3300046678 Bacteria 722
282 Ga0495623_0072336 3300046679 Bacteria 2144
283 Ga0495647_0113922 3300046681 Unclassified 1131
284 Ga0495613_0168254 3300046689 Bacteria 1557
285 Ga0495624_0359337 3300046690 Unclassified 876
286 Ga0495600_0198271 3300046809 Bacteria 1290
287 Ga0495581_0109628 3300047315 Bacteria 1605
288 Ga0495581_0452895 3300047315 Unclassified 747
289 Ga0495604_0091297 3300047317 Unclassified 2259
290 Ga0495674_0320933 3300047319 Bacteria 1262
291 Ga0495674_0765046 3300047319 Unclassified 754
292 Ga0495674_1421467 3300047319 Unclassified 516
293 Ga0495680_0487847 3300047322 Bacteria 838
294 Ga0495675_0128043 3300047444 Bacteria 1579
295 Ga0495675_0449725 3300047444 Bacteria 745
296 Ga0495684_0764192 3300047471 Unclassified 635
297 Ga0495602_0269816 3300048088 Bacteria 1258
298 Ga0495602_0504781 3300048088 Unclassified 845
299 Ga0495602_0890063 3300048088 Bacteria 593
300 Ga0495614_0321345 3300048089 Unclassified 718
301 Ga0496102_0056597 3300048905 Bacteria 3577
302 Ga0496102_0172660 3300048905 Bacteria 2035
303 Ga0496102_1707043 3300048905 Unclassified 547
304 Ga0496103_0779954 3300048906 Unclassified 603
305 Ga0496104_0193698 3300048907 Bacteria 1945
306 Ga0496104_0217135 3300048907 Bacteria 1824
307 Ga0496104_0229356 3300048907 Bacteria 1769
308 Ga0496104_1073108 3300048907 Bacteria 709
309 Ga0496105_0014961 3300048908 Bacteria 6176
310 Ga0496107_0317623 3300048910 Bacteria 1159
311 Ga0496111_0040784 3300048914 Bacteria 3330
312 Ga0496111_0377602 3300048914 Bacteria 1048
313 Ga0496112_0007011 3300048915 Bacteria 9951
314 Ga0496112_0103955 3300048915 Unclassified 2811
315 Ga0501297_039062 3300049520 Bacteria 661
316 Ga0501299_155408 3300049522 Bacteria 580
317 nmdc:mga0n895_740186_c1 3300050512 Unclassified 977
318 nmdc:mga0rr50_223402_c1 3300050513 Bacteria 1556
319 nmdc:mga0rr50_993274_c1 3300050513 Unclassified 715
320 nmdc:mga08x19_18814_c1 3300050514 Bacteria 4234
321 nmdc:mga08x19_26586_c1 3300050514 Bacteria 3612
322 nmdc:mga08x19_8802_c1 3300050514 Bacteria 6023
323 Ga0495612_0200201 3300053078 Unclassified 881
324 Ga0587066_165562 3300059490 Unclassified 559
325 Ga0587089_110026 3300059509 Unclassified 508
326 Ga0587092_098541 3300059512 Unclassified 599
327 Ga0587062_139145 3300059639 Bacteria 505
328 Ga0587067_226947 3300059640 Unclassified 508
329 Ga0466962_0237707 3300061719 Bacteria 894
330 Ga0495630_0560238
331 Ga0070680_101645526
332 Ga0068868_100210189
333 Ga0070691_10036255
334 Ga0070691_10445083
335 Ga0070692_10700182
336 Ga0070668_100451758
337 Ga0070667_100189822
338 Ga0070709_10058045
339 Ga0070709_10114198
340 Ga0070709_10249217
341 Ga0070709_10254256
342 Ga0070709_10388327
343 Ga0070714_100002798
344 Ga0070714_100170822
345 Ga0070714_101683718
346 Ga0070713_100002561
347 Ga0070713_100030882
348 Ga0070713_100079307
349 Ga0070713_100375010
350 Ga0070713_100709637
351 Ga0070713_101434257
352 Ga0070713_101993976
353 Ga0070710_10029399
354 Ga0070710_10408766
355 Ga0070711_100182312
356 Ga0070711_100226593
357 Ga0070711_101284673
358 Ga0070711_101399114
359 Ga0070681_10588808
360 Ga0070706_100208995
361 Ga0070706_100242947
362 Ga0070706_101738873
363 Ga0070707_100016271
364 Ga0070707_100075529
365 Ga0070707_100085136
366 Ga0070707_100336541
367 Ga0070707_100442065
368 Ga0070707_100766216
369 Ga0070698_100366108
370 Ga0070698_100809203
371 Ga0070699_100437579
372 Ga0070699_101168005
373 Ga0070679_100209670
374 Ga0070684_100253253
375 Ga0070697_100023806
376 Ga0070697_100164864
377 Ga0070697_100536987
378 Ga0068853_100259518
379 Ga0070693_100136270
380 Ga0070665_102206205
381 Ga0068855_100061542
382 Ga0068855_100084694
383 Ga0068857_100295002
384 Ga0068854_100070902
385 Ga0068854_100275911
386 Ga0068854_100386090
387 Ga0068856_100138361
388 Ga0068856_100271990
389 Ga0068856_100582230
390 Ga0068856_100773069
391 Ga0068856_102465902
392 Ga0068852_100518134
393 Ga0068866_10580879
394 Ga0068851_10075681
395 Ga0068863_100120141
396 Ga0068860_100292236
397 Ga0068862_100535287
398 Ga0070717_10135046
399 Ga0070717_10251841
400 Ga0070717_10367602
401 Ga0070717_10572517
402 Ga0070717_10758849
403 Ga0070715_10123184
404 Ga0070715_10149505
405 Ga0070715_10382026
406 Ga0070716_100001801
407 Ga0070716_101417174
408 Ga0070712_100118979
409 Ga0070712_100450941
410 Ga0070712_101488011
411 Ga0070712_101692655
412 Ga0097621_101746441
413 Ga0068871_101872769
414 Ga0075434_100577645
415 Ga0075436_100008441
416 Ga0075436_100010617
417 Ga0075436_100172613
418 Ga0075436_100974387
419 Ga0075435_100154405
420 Ga0075435_100254628
421 Ga0075435_100643985
422 Ga0075435_101162173
423 Ga0075435_101346328
424 Ga0099794_10330506
425 Ga0099795_10017122
426 Ga0099795_10062706
427 Ga0105240_10042090
428 Ga0105240_10112990
429 Ga0105240_10166096
430 Ga0105240_10980028
431 Ga0105245_10218774
432 Ga0105241_10026464
433 Ga0105241_10882049
434 Ga0105237_10080347
435 Ga0105237_10317405
436 Ga0105237_10964026
437 Ga0105238_10027611
438 Ga0105238_10057076
439 Ga0105238_10581945
440 Ga0105238_11470535
441 Ga0105249_11119742
442 Ga0099796_10101701
443 Ga0099796_10252645
444 Ga0105239_11688474
445 Ga0105246_10361155
446 Ga0105246_11789119
447 Ga0157373_10042985
448 Ga0157373_10308068
449 Ga0157370_10013122
450 Ga0157370_10908966
451 Ga0157369_10011758
452 Ga0157369_10196603
453 Ga0157369_10256157
454 Ga0157374_10259773
455 Ga0157374_10566973
456 Ga0157378_10158823
457 Ga0163162_10213994
458 Ga0163162_11170346
459 Ga0157372_10015349
460 Ga0157372_10080113
461 Ga0157372_10381017
462 Ga0157372_10399959
463 Ga0157372_10453212
464 Ga0163163_10035995
465 Ga0157379_11001305
466 Ga0157376_12730185
467 Ga0182007_10044671
468 Ga0182007_10403297
469 Ga0206353_11273127
470 Ga0207685_10112979
471 Ga0207685_10855359
472 Ga0207699_10050093
473 Ga0207699_10073262
474 Ga0207699_10229876
475 Ga0207699_10370632
476 Ga0207699_11359924
477 Ga0207684_10535530
478 Ga0207684_11440213
479 Ga0207695_10006683
480 Ga0207695_10032139
481 Ga0207695_11389956
482 Ga0207671_10179327
483 Ga0207671_10488386
484 Ga0207693_10076046
485 Ga0207693_10177664
486 Ga0207693_10377579
487 Ga0207693_10598930
488 Ga0207663_10479033
489 Ga0207663_10572118
490 Ga0207663_11130507
491 Ga0207660_10635356
492 Ga0207649_10319536
493 Ga0207646_10004437
494 Ga0207646_10056986
495 Ga0207646_10106126
496 Ga0207646_10317255
497 Ga0207646_10851619
498 Ga0207694_10345388
499 Ga0207650_10114697
500 Ga0207687_10572582
501 Ga0207700_10013275
502 Ga0207700_10039298
503 Ga0207700_10048939
504 Ga0207700_10498414
505 Ga0207664_10001882
506 Ga0207664_10049128
507 Ga0207664_10119715
508 Ga0207664_10387996
509 Ga0207664_10957002
510 Ga0207665_10003172
511 Ga0207665_10084287
512 Ga0207665_10262970
513 Ga0207665_10944219
514 Ga0207667_10082602
515 Ga0207712_11990277
516 Ga0207640_10097156
517 Ga0207640_10180761
518 Ga0207677_10051982
519 Ga0207677_10204367
520 Ga0207639_10350572
521 Ga0207639_10583282
522 Ga0207702_10048088
523 Ga0207702_10214749
524 Ga0207641_11190564
525 Ga0207676_11571661
526 Ga0207698_10127995
527 Ga0209179_1047946
528 Ga0209588_1207443
529 Ga0265357_1029550
530 Ga0268265_10115201
531 Ga0268264_10147266
532 Ga0265338_10106163
533 Ga0265774_106147
534 Ga0265760_10269172
535 Ga0265325_10009975
536 Ga0265340_10012851
537 Ga0265340_10067500
538 Ga0265340_10077148
539 Ga0265339_10422145
540 Ga0265331_10193863
541 Ga0265331_10432113
542 Ga0265327_10460147
543 Ga0265316_10068317
544 Ga0265316_10085314
545 Ga0265316_10194969
546 Ga0307408_100725255
547 Ga0265313_10028809
548 Ga0265314_10016761
549 Ga0265314_10105866
550 Ga0373934_0258707
551 Ga0373934_0397855
552 Ga0373923_0036320
553 Ga0373945_0097790
554 Ga0373954_0136720
555 Ga0373954_0286694
556 Ga0373956_0137849
557 Ga0373943_0049802
558 Ga0373955_0809876
559 Ga0373935_0006443
560 Ga0373927_0006742
561 Ga0373933_0256948
562 Ga0373933_1115734
563 Ga0373947_0021601
564 Ga0373937_0052494
565 Ga0373937_0199887
566 Ga0373925_0010486
567 Ga0373925_0755625
568 Ga0395900_0389647
569 Ga0395905_0582915
570 Ga0395901_1274617
571 Ga0436365_1171267
572 Ga0436360_0664705
573 Ga0436360_0800779
574 Ga0436361_0333958
575 Ga0436363_1182231
576 Ga0451839_1001908
577 Ga0453683_0398312
578 Ga0466965_0460156
579 Ga0466966_0536415
580 Ga0466961_0108649
581 Ga0466963_0476044
582 Ga0466964_0125020
583 Ga0466957_0119166
584 Ga0466959_0067490
585 Ga0451576_0293196
586 Ga0451576_0858710
587 Ga0466958_0188009
588 Ga0466967_0004784
589 Ga0466967_0005945
590 Ga0466967_0258700
591 Ga0495629_1038452
592 Ga0495653_0883417
593 Ga0495580_0000988
594 Ga0495582_0001483
595 Ga0495639_0015501
596 Ga0495662_0033865
597 Ga0495664_0296829
598 Ga0495608_0431136
599 Ga0495628_0514792
600 Ga0495630_0645033
601 Ga0495652_0699940
602 Ga0495665_0020852
603 Ga0495665_0300349
604 Ga0495587_0106955
605 Ga0495587_0158779
606 Ga0495667_0533779
607 Ga0495635_0396198
608 Ga0495659_0012909
609 Ga0495599_0174550
610 Ga0495599_0493205
611 Ga0495623_0072336
612 Ga0495647_0113922
613 Ga0495613_0168254
614 Ga0495624_0359337
615 Ga0495600_0198271
616 Ga0495581_0109628
617 Ga0495581_0452895
618 Ga0495604_0091297
619 Ga0495674_0320933
620 Ga0495674_0765046
621 Ga0495674_1421467
622 Ga0495680_0487847
623 Ga0495675_0128043
624 Ga0495675_0449725
625 Ga0495684_0764192
626 Ga0495602_0269816
627 Ga0495602_0504781
628 Ga0495602_0890063
629 Ga0495614_0321345
630 Ga0496102_0056597
631 Ga0496102_0172660
632 Ga0496102_1707043
633 Ga0496103_0779954
634 Ga0496104_0193698
635 Ga0496104_0217135
636 Ga0496104_0229356
637 Ga0496104_1073108
638 Ga0496105_0014961
639 Ga0496107_0317623
640 Ga0496111_0040784
641 Ga0496111_0377602
642 Ga0496112_0007011
643 Ga0496112_0103955
644 Ga0501297_039062
645 Ga0501299_155408
646 nmdc:mga0n895_740186_c1
647 nmdc:mga0rr50_223402_c1
648 nmdc:mga0rr50_993274_c1
649 nmdc:mga08x19_18814_c1
650 nmdc:mga08x19_26586_c1
651 nmdc:mga08x19_8802_c1
652 Ga0495612_0200201
653 Ga0587066_165562
654 Ga0587089_110026
655 Ga0587092_098541
656 Ga0587062_139145
657 Ga0587067_226947
658 Ga0466962_0237707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17209

Hfq

Hfq protein

31

94

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qsu-assembly1.cif.gz_A structure of staphylococcus aureus hfq in complex with a7 rna 0.9873 8 66
6gwk-assembly2.cif.gz_G the crystal structure of hfq from caulobacter crescentus 0.9765 8 68
4pno-assembly1.cif.gz_A escherichia coli hfq-rna complex at 0.97 a resolution 0.9724 8 69
4juv-assembly1.cif.gz_F crystal structure of escherichia coli hfq distal face 1 mutant 0.9681 7 67
4jli-assembly1.cif.gz_B-2 crystal structure of escherichia coli hfq proximal pore mutant 0.9678 8 69
ID Description Score Start End Superfamily
3qsuF00 Mainly Beta;Roll;SH3 type barrels.; 0.9902 8 66 2.30.30.100
3hfnB00 Mainly Beta;Roll;SH3 type barrels.; 0.9627 9 68 2.30.30.100
3qsuF00 Mainly Beta;Roll;SH3 type barrels.; 0.9582 8 66 2.30.30.100
3hfnB00 Mainly Beta;Roll;SH3 type barrels.; 0.9168 9 68 2.30.30.100
3hsbD00 Mainly Beta;Roll;SH3 type barrels.; 0.9079 8 74 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A243LKA3-F1-model_v4 deleted 0.9921 9 65
AF-A0A023PGF6-F1-model_v4 deleted 0.9907 9 65
AF-A0A854YYD6-F1-model_v4 deleted 0.9906 9 65
AF-C3EE76-F1-model_v4 deleted 0.9902 14 65
AF-A0A6V7RLJ9-F1-model_v4 RNA-binding protein Hfq 0.987 7 66 GO:0003723
GO:0005829
GO:0006355
GO:0043487
GO:0045974

Map