F409756

General Info

Members Datasets Scaffolds Average Seq Length
329 175 658 305

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0218348|Ga0395905_0218348_744_1739
Length 331
Sequence MVNHLAIVKRRSAMILKISFASLVSFFLGAVLFSASSNSAANDPGFVSRNSRAADAAAIRSHIESIFQAFIDGDVQKIYATHSEDWRGFLEGSRVPIKGIDEYMRANGFDWPRPEKAPKPVSYFPSGTGYAVNNFDVQFYSPELAVASFIGDFTRKEGDTTITLRRFRIMDVYAKRKGSWIQVASHTVIDPAWRQERMAQPMTVSPDMREQILNSREAVWKAWFTNDRAALERMIPAEAIAIDDASETWSNRTNILAGAQRFADNGGKLVRLEFPKTELQVYGNTIIVYTTYLYETEVNGQRTTRSGRGTEIFVRRGDELVNTGWQLDSKK

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
133 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
143 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
146 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
147 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
148 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
149 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
150 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
151 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
152 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
153 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
154 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
155 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
156 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
157 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
158 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
159 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
160 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
161 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
162 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
163 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
164 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 3.04
Rhizosphere 96.66
Stem 0
Stem Tuber 0
Unclassified 18.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0218348 3300037471 Bacteria 1785
2 SwRhRL2b_contig_752707 2162886007 Bacteria 1631
3 MRS1b_contig_378277 2162886011 Bacteria 1957
4 JGI24751J29686_10000007 3300002459 Bacteria 129562
5 JGI25406J46586_10008919 3300003203 Unclassified 4512
6 JGI25406J46586_10031626 3300003203 Bacteria 1977
7 Ga0065714_10064429 3300005288 Bacteria 141954
8 Ga0065704_10000690 3300005289 Bacteria 16056
9 Ga0065712_10000615 3300005290 Bacteria 11513
10 Ga0065712_10067729 3300005290 Bacteria 142513
11 Ga0065712_10134139 3300005290 Bacteria 1515
12 Ga0065715_10092861 3300005293 Bacteria 4902
13 Ga0065715_10102609 3300005293 Bacteria 3066
14 Ga0065707_10003739 3300005295 Bacteria 12986
15 Ga0070670_100000197 3300005331 Bacteria 55774
16 Ga0070670_100129330 3300005331 Bacteria 2180
17 Ga0070680_100018752 3300005336 Bacteria 5475
18 Ga0070680_100110674 3300005336 Bacteria 2286
19 Ga0070682_100007610 3300005337 Bacteria 6103
20 Ga0070660_100047779 3300005339 Bacteria 3285
21 Ga0070689_100002866 3300005340 Bacteria 11336
22 Ga0070692_10002797 3300005345 Bacteria 6881
23 Ga0070692_10042769 3300005345 Bacteria 2328
24 Ga0070692_10043851 3300005345 Bacteria 2302
25 Ga0070692_10044585 3300005345 Unclassified 2285
26 Ga0070669_100004083 3300005353 Bacteria 10569
27 Ga0070669_100114685 3300005353 Bacteria 2049
28 Ga0070673_100058403 3300005364 Bacteria 3050
29 Ga0070673_100212101 3300005364 Bacteria 1673
30 Ga0070701_10059467 3300005438 Bacteria 2009
31 Ga0070701_10218131 3300005438 Bacteria 1136
32 Ga0070705_100000804 3300005440 Bacteria 17709
33 Ga0070705_100130538 3300005440 Bacteria 1638
34 Ga0070700_100000282 3300005441 Bacteria 26812
35 Ga0070700_100013945 3300005441 Bacteria 4528
36 Ga0070700_100078531 3300005441 Bacteria 2125
37 Ga0070700_100332446 3300005441 Bacteria 1120
38 Ga0070694_100002733 3300005444 Bacteria 10465
39 Ga0070694_100081574 3300005444 Bacteria 2250
40 Ga0070681_10000383 3300005458 Bacteria 35789
41 Ga0070681_10011129 3300005458 Bacteria 8904
42 Ga0070706_100000309 3300005467 Bacteria 59357
43 Ga0070707_100218542 3300005468 Bacteria 1857
44 Ga0070698_100050225 3300005471 Unclassified 4253
45 Ga0070698_100162093 3300005471 Bacteria 2180
46 Ga0070699_100006469 3300005518 Bacteria 10205
47 Ga0070699_100108350 3300005518 Bacteria 2438
48 Ga0070699_100356356 3300005518 Bacteria 1318
49 Ga0070679_100040721 3300005530 Unclassified 4622
50 Ga0070679_100150383 3300005530 Bacteria 2305
51 Ga0070697_100150652 3300005536 Bacteria 1960
52 Ga0070697_100328426 3300005536 Unclassified 1318
53 Ga0068853_100061703 3300005539 Bacteria 3243
54 Ga0068853_100138159 3300005539 Bacteria 2186
55 Ga0070695_100010210 3300005545 Bacteria 5602
56 Ga0070695_100039181 3300005545 Bacteria 2994
57 Ga0070695_100053240 3300005545 Bacteria 2602
58 Ga0070695_100058431 3300005545 Bacteria 2493
59 Ga0070696_100007252 3300005546 Bacteria 7401
60 Ga0070696_100056127 3300005546 Bacteria 2747
61 Ga0070693_100004927 3300005547 Bacteria 6374
62 Ga0070693_100038149 3300005547 Bacteria 2683
63 Ga0070693_100053373 3300005547 Unclassified 2321
64 Ga0070693_100127951 3300005547 Bacteria 1583
65 Ga0070693_100178654 3300005547 Bacteria 1365
66 Ga0070704_100070317 3300005549 Unclassified 2539
67 Ga0070704_100126938 3300005549 Bacteria 1970
68 Ga0070704_100317568 3300005549 Bacteria 1304
69 Ga0068855_100161458 3300005563 Unclassified 2543
70 Ga0070664_100002453 3300005564 Bacteria 14930
71 Ga0068857_100002893 3300005577 Bacteria 14130
72 Ga0068857_100339324 3300005577 Bacteria 1390
73 Ga0068854_100074582 3300005578 Bacteria 2489
74 Ga0068856_100002356 3300005614 Bacteria 19435
75 Ga0068856_100350570 3300005614 Bacteria 1495
76 Ga0070702_100248400 3300005615 Bacteria 1205
77 Ga0068852_100217424 3300005616 Unclassified 1816
78 Ga0068859_100004587 3300005617 Bacteria 14095
79 Ga0068859_100005524 3300005617 Bacteria 12873
80 Ga0068859_100025817 3300005617 Bacteria 5894
81 Ga0068859_100049836 3300005617 Bacteria 4206
82 Ga0068859_100068073 3300005617 Bacteria 3595
83 Ga0068859_100070810 3300005617 Bacteria 3523
84 Ga0068859_100101504 3300005617 Bacteria 2934
85 Ga0068864_100079203 3300005618 Bacteria 2876
86 Ga0068864_100334740 3300005618 Unclassified 1425
87 Ga0068863_100028670 3300005841 Bacteria 5315
88 Ga0068863_100273792 3300005841 Bacteria 1634
89 Ga0068863_100392359 3300005841 Bacteria 1356
90 Ga0068858_100084701 3300005842 Bacteria 2949
91 Ga0068858_100124320 3300005842 Bacteria 2415
92 Ga0068860_100045395 3300005843 Bacteria 4190
93 Ga0068860_100045973 3300005843 Unclassified 4163
94 Ga0068860_100089193 3300005843 Unclassified 2936
95 Ga0068860_100451200 3300005843 Bacteria 1279
96 Ga0068862_100080640 3300005844 Bacteria 2822
97 Ga0068862_100173983 3300005844 Bacteria 1929
98 Ga0081455_10001203 3300005937 Bacteria 32430
99 Ga0081455_10008748 3300005937 Bacteria 10478
100 Ga0081539_10000281 3300005985 Bacteria 114795
101 Ga0081539_10000346 3300005985 Bacteria 101962
102 Ga0081539_10010403 3300005985 Bacteria 7564
103 Ga0070716_100040551 3300006173 Bacteria 2591
104 Ga0070716_100112484 3300006173 Bacteria 1690
105 Ga0097621_100005248 3300006237 Bacteria 9116
106 Ga0068871_100001358 3300006358 Bacteria 16399
107 Ga0068871_100021562 3300006358 Bacteria 4954
108 Ga0075428_100154544 3300006844 Bacteria 2493
109 Ga0075428_100556481 3300006844 Bacteria 1226
110 Ga0075430_100057070 3300006846 Bacteria 3284
111 Ga0075430_100164133 3300006846 Bacteria 1848
112 Ga0075431_100053427 3300006847 Bacteria 4166
113 Ga0075431_100054627 3300006847 Bacteria 4119
114 Ga0075433_10073943 3300006852 Bacteria 2998
115 Ga0075434_100107134 3300006871 Bacteria 2805
116 Ga0075434_100298079 3300006871 Unclassified 1632
117 Ga0075429_100007407 3300006880 Bacteria 9523
118 Ga0075429_100054418 3300006880 Bacteria 3481
119 Ga0068865_100430938 3300006881 Bacteria 1086
120 Ga0097620_100004587 3300006931 Bacteria 14095
121 Ga0097620_100005524 3300006931 Bacteria 12873
122 Ga0097620_100025815 3300006931 Bacteria 5894
123 Ga0097620_100049835 3300006931 Bacteria 4206
124 Ga0097620_100068076 3300006931 Bacteria 3595
125 Ga0097620_100070811 3300006931 Bacteria 3523
126 Ga0097620_100101506 3300006931 Bacteria 2934
127 Ga0075435_100225937 3300007076 Bacteria 1590
128 Ga0105240_10024550 3300009093 Bacteria 7944
129 Ga0105240_10130081 3300009093 Bacteria 3020
130 Ga0111539_10005824 3300009094 Bacteria 15932
131 Ga0111539_10046528 3300009094 Bacteria 5188
132 Ga0111539_10047734 3300009094 Bacteria 5117
133 Ga0111539_10074831 3300009094 Bacteria 3991
134 Ga0111539_10247234 3300009094 Bacteria 2077
135 Ga0111539_10446741 3300009094 Bacteria 1505
136 Ga0105247_10007707 3300009101 Bacteria 6588
137 Ga0114129_10133240 3300009147 Unclassified 3412
138 Ga0114129_10171768 3300009147 Bacteria 2955
139 Ga0114129_10184114 3300009147 Unclassified 2840
140 Ga0114129_10324839 3300009147 Unclassified 2045
141 Ga0114129_10432252 3300009147 Bacteria 1729
142 Ga0114129_10592558 3300009147 Bacteria 1437
143 Ga0105243_10028161 3300009148 Bacteria 4311
144 Ga0105241_10027277 3300009174 Bacteria 4253
145 Ga0105242_10256576 3300009176 Bacteria 1578
146 Ga0105248_10005168 3300009177 Bacteria 14393
147 Ga0105248_10008788 3300009177 Bacteria 11093
148 Ga0105248_10056070 3300009177 Bacteria 4420
149 Ga0105248_10117775 3300009177 Bacteria 2996
150 Ga0105248_10188602 3300009177 Bacteria 2323
151 Ga0105237_10160875 3300009545 Bacteria 2244
152 Ga0105238_10035215 3300009551 Bacteria 5091
153 Ga0105249_10363901 3300009553 Bacteria 1468
154 Ga0105249_10599644 3300009553 Bacteria 1156
155 Ga0105239_10053576 3300010375 Unclassified 4425
156 Ga0105239_10192149 3300010375 Unclassified 2285
157 Ga0105239_10368435 3300010375 Bacteria 1623
158 Ga0105239_10765136 3300010375 Bacteria 1106
159 Ga0157373_10022735 3300013100 Bacteria 4547
160 Ga0157373_10066068 3300013100 Unclassified 2559
161 Ga0157378_10211324 3300013297 Bacteria 1840
162 Ga0163162_10012958 3300013306 Bacteria 8138
163 Ga0157372_10022739 3300013307 Bacteria 6787
164 Ga0157375_10198115 3300013308 Bacteria 2164
165 Ga0163163_10000238 3300014325 Bacteria 56166
166 Ga0163163_10102073 3300014325 Bacteria 2891
167 Ga0157380_10001520 3300014326 Bacteria 15233
168 Ga0157380_10055910 3300014326 Bacteria 3136
169 Ga0157377_10246863 3300014745 Bacteria 1155
170 Ga0157379_10143956 3300014968 Unclassified 2149
171 Ga0207647_10003766 3300025904 Bacteria 11337
172 Ga0207643_10008149 3300025908 Bacteria 5622
173 Ga0207643_10050835 3300025908 Bacteria 2351
174 Ga0207654_10179614 3300025911 Unclassified 1380
175 Ga0207707_10014213 3300025912 Bacteria 6935
176 Ga0207707_10047966 3300025912 Bacteria 3720
177 Ga0207695_10115075 3300025913 Bacteria 2664
178 Ga0207671_10028023 3300025914 Unclassified 4210
179 Ga0207660_10087663 3300025917 Bacteria 2300
180 Ga0207649_10009011 3300025920 Bacteria 5452
181 Ga0207646_10185997 3300025922 Bacteria 1876
182 Ga0207681_10300701 3300025923 Bacteria 1269
183 Ga0207650_10000009 3300025925 Bacteria 483583
184 Ga0207690_10005187 3300025932 Bacteria 7684
185 Ga0207706_10219667 3300025933 Bacteria 1664
186 Ga0207706_10241689 3300025933 Bacteria 1578
187 Ga0207706_10447929 3300025933 Bacteria 1117
188 Ga0207709_10003681 3300025935 Bacteria 9022
189 Ga0207709_10027553 3300025935 Bacteria 3275
190 Ga0207670_10069326 3300025936 Bacteria 2432
191 Ga0207704_10387528 3300025938 Bacteria 1099
192 Ga0207665_10061460 3300025939 Bacteria 2546
193 Ga0207665_10142162 3300025939 Bacteria 1712
194 Ga0207711_10002332 3300025941 Bacteria 17005
195 Ga0207711_10087582 3300025941 Bacteria 2732
196 Ga0207711_10168432 3300025941 Bacteria 1987
197 Ga0207711_10261957 3300025941 Bacteria 1589
198 Ga0207711_10420534 3300025941 Bacteria 1243
199 Ga0207689_10052877 3300025942 Bacteria 3346
200 Ga0207689_10166578 3300025942 Bacteria 1816
201 Ga0207689_10268188 3300025942 Bacteria 1413
202 Ga0207679_10149044 3300025945 Bacteria 1901
203 Ga0207679_10180536 3300025945 Bacteria 1746
204 Ga0207651_10076019 3300025960 Bacteria 2399
205 Ga0207640_10187069 3300025981 Unclassified 1558
206 Ga0207640_10368926 3300025981 Bacteria 1159
207 Ga0207703_10065943 3300026035 Unclassified 2977
208 Ga0207639_10006246 3300026041 Bacteria 8094
209 Ga0207639_10355727 3300026041 Unclassified 1309
210 Ga0207708_10000306 3300026075 Bacteria 38726
211 Ga0207708_10013281 3300026075 Bacteria 6150
212 Ga0207708_10203258 3300026075 Bacteria 1581
213 Ga0207702_10296631 3300026078 Bacteria 1533
214 Ga0207641_10166049 3300026088 Unclassified 2010
215 Ga0207641_10206251 3300026088 Bacteria 1815
216 Ga0207641_10255760 3300026088 Bacteria 1638
217 Ga0207641_10696834 3300026088 Unclassified 1000
218 Ga0207648_10034054 3300026089 Unclassified 4492
219 Ga0207676_10002763 3300026095 Bacteria 12480
220 Ga0207676_10071354 3300026095 Bacteria 2788
221 Ga0207676_10444704 3300026095 Bacteria 1221
222 Ga0207676_10448849 3300026095 Unclassified 1215
223 Ga0207674_10000054 3300026116 Bacteria 114198
224 Ga0207674_10442595 3300026116 Bacteria 1256
225 Ga0207675_100101648 3300026118 Unclassified 2708
226 Ga0207698_10048456 3300026142 Unclassified 3226
227 Ga0207428_10007773 3300027907 Bacteria 9757
228 Ga0207428_10028931 3300027907 Bacteria 4598
229 Ga0207428_10257736 3300027907 Bacteria 1299
230 Ga0268264_10064773 3300028381 Unclassified 3077
231 Ga0268264_10082249 3300028381 Unclassified 2755
232 Ga0268264_10103826 3300028381 Bacteria 2476
233 Ga0268264_10475565 3300028381 Unclassified 1214
234 Ga0307408_100002962 3300031548 Bacteria 11772
235 Ga0307408_100169789 3300031548 Unclassified 1741
236 Ga0307408_100235437 3300031548 Bacteria 1502
237 Ga0307408_100369014 3300031548 Bacteria 1223
238 Ga0307405_10142218 3300031731 Unclassified 1675
239 Ga0307405_10233464 3300031731 Bacteria 1357
240 Ga0307410_10051301 3300031852 Bacteria 2780
241 Ga0307410_10067344 3300031852 Unclassified 2470
242 Ga0307406_10101418 3300031901 Unclassified 1961
243 Ga0307407_10043551 3300031903 Unclassified 2524
244 Ga0307412_10026244 3300031911 Bacteria 3619
245 Ga0307412_10075131 3300031911 Bacteria 2317
246 Ga0307412_10175438 3300031911 Bacteria 1606
247 Ga0307416_100160065 3300032002 Unclassified 2080
248 Ga0307416_100196358 3300032002 Unclassified 1909
249 Ga0307414_10039397 3300032004 Bacteria 3182
250 Ga0307415_100118693 3300032126 Unclassified 1978
251 Ga0373949_0021229 3300035090 Bacteria 1492
252 Ga0373949_0052889 3300035090 Bacteria 1027
253 Ga0373941_0023643 3300035115 Bacteria 1757
254 Ga0373942_0002598 3300035207 Bacteria 4355
255 Ga0373931_0199379 3300035691 Bacteria 1195
256 Ga0395900_0170540 3300037418 Bacteria 2216
257 Ga0395900_0312359 3300037418 Bacteria 1555
258 Ga0395898_0054716 3300037466 Unclassified 3894
259 Ga0439455_0007190 3300042012 Bacteria 2347
260 Ga0439458_0009069 3300042157 Bacteria 2217
261 Ga0496102_0006461 3300048905 Bacteria 9999
262 Ga0496104_0013070 3300048907 Bacteria 7478
263 Ga0496106_0012867 3300048909 Bacteria 6175
264 Ga0496106_0164239 3300048909 Bacteria 1757
265 Ga0496107_0126966 3300048910 Bacteria 1881
266 Ga0496107_0179152 3300048910 Unclassified 1574
267 Ga0496109_0000026 3300048912 Bacteria 171405
268 Ga0496110_0259475 3300048913 Bacteria 1582
269 Ga0496112_0253375 3300048915 Bacteria 1711
270 Ga0496113_0039089 3300048916 Bacteria 3491
271 Ga0501292_001622 3300049515 Unclassified 2795
272 Ga0501298_007509 3300049521 Bacteria 1808
273 Ga0501298_015177 3300049521 Bacteria 1385
274 Ga0501038_0013420 3300049574 Bacteria 7468
275 Ga0501198_010063 3300049649 Unclassified 1393
276 Ga0501202_005299 3300049652 Unclassified 2285
277 Ga0501208_017578 3300049655 Bacteria 1129
278 Ga0501216_021735 3300049660 Bacteria 1130
279 Ga0501217_000091 3300049661 Bacteria 11156
280 Ga0501223_003978 3300049663 Unclassified 3184
281 Ga0501224_020520 3300049664 Unclassified 984
282 Ga0501227_004128 3300049665 Bacteria 3123
283 Ga0501230_007950 3300049667 Unclassified 1589
284 Ga0501233_008761 3300049668 Unclassified 1958
285 Ga0501233_028039 3300049668 Bacteria 1255
286 Ga0501235_008441 3300049669 Bacteria 2248
287 Ga0501235_038551 3300049669 Bacteria 1089
288 Ga0501249_010979 3300049679 Bacteria 1898
289 Ga0501249_013299 3300049679 Bacteria 1748
290 Ga0501257_006627 3300049686 Bacteria 2571
291 Ga0501260_001579 3300049689 Unclassified 1894
292 Ga0501225_0001353 3300049705 Bacteria 7623
293 Ga0501225_0008543 3300049705 Bacteria 2935
294 Ga0501225_0053691 3300049705 Bacteria 1125
295 Ga0501225_0072806 3300049705 Bacteria 978
296 Ga0501229_005942 3300049706 Bacteria 1507
297 Ga0501268_006977 3300049765 Unclassified 1675
298 Ga0501270_000704 3300049767 Bacteria 2953
299 Ga0501212_009568 3300049851 Bacteria 1368
300 Ga0501226_005043 3300049853 Unclassified 1514
301 nmdc:mga05p37_259509_c1 3300050507 Bacteria 2080
302 nmdc:mga05p37_267114_c1 3300050507 Unclassified 2045
303 nmdc:mga05p37_58192_c1 3300050507 Bacteria 4760
304 nmdc:mga05p37_589675_c1 3300050507 Bacteria 1257
305 nmdc:mga05p37_97329_c1 3300050507 Unclassified 3625
306 nmdc:mga09592_43119_c1 3300050508 Bacteria 3796
307 nmdc:mga09592_70112_c1 3300050508 Bacteria 2974
308 nmdc:mga0qj67_296304_c1 3300050509 Bacteria 1311
309 nmdc:mga06r32_101278_c1 3300050510 Unclassified 2827
310 nmdc:mga06r32_60746_c1 3300050510 Bacteria 3637
311 nmdc:mga06r32_6847_c1 3300050510 Bacteria 10243
312 nmdc:mga08y16_120952_c1 3300050511 Bacteria 2725
313 nmdc:mga08y16_2959_c1 3300050511 Bacteria 17508
314 nmdc:mga08y16_365431_c1 3300050511 Bacteria 1481
315 nmdc:mga08y16_395498_c1 3300050511 Bacteria 1415
316 nmdc:mga08y16_524436_c1 3300050511 Bacteria 1201
317 nmdc:mga0n895_119849_c1 3300050512 Unclassified 2652
318 nmdc:mga0n895_162778_c1 3300050512 Bacteria 2263
319 nmdc:mga0n895_43396_c1 3300050512 Bacteria 4381
320 nmdc:mga0n895_450921_c1 3300050512 Unclassified 1299
321 nmdc:mga0n895_95751_c1 3300050512 Unclassified 2973
322 nmdc:mga0rr50_207468_c1 3300050513 Unclassified 1613
323 nmdc:mga0a205_178546_c1 3300050515 Bacteria 2018
324 nmdc:mga0a205_58214_c1 3300050515 Bacteria 3732
325 nmdc:mga0a205_97026_c1 3300050515 Bacteria 2847
326 Ga0500555_009452 3300053103 Unclassified 2789
327 Ga0501084_0014524 3300054114 Bacteria 6529
328 Ga0530510_0020474 3300061734 Bacteria 4703
329 Ga0530510_0318724 3300061734 Bacteria 1165
330 Ga0395905_0218348
331 SwRhRL2b_contig_752707
332 MRS1b_contig_378277
333 JGI24751J29686_10000007
334 JGI25406J46586_10008919
335 JGI25406J46586_10031626
336 Ga0065714_10064429
337 Ga0065704_10000690
338 Ga0065712_10000615
339 Ga0065712_10067729
340 Ga0065712_10134139
341 Ga0065715_10092861
342 Ga0065715_10102609
343 Ga0065707_10003739
344 Ga0070670_100000197
345 Ga0070670_100129330
346 Ga0070680_100018752
347 Ga0070680_100110674
348 Ga0070682_100007610
349 Ga0070660_100047779
350 Ga0070689_100002866
351 Ga0070692_10002797
352 Ga0070692_10042769
353 Ga0070692_10043851
354 Ga0070692_10044585
355 Ga0070669_100004083
356 Ga0070669_100114685
357 Ga0070673_100058403
358 Ga0070673_100212101
359 Ga0070701_10059467
360 Ga0070701_10218131
361 Ga0070705_100000804
362 Ga0070705_100130538
363 Ga0070700_100000282
364 Ga0070700_100013945
365 Ga0070700_100078531
366 Ga0070700_100332446
367 Ga0070694_100002733
368 Ga0070694_100081574
369 Ga0070681_10000383
370 Ga0070681_10011129
371 Ga0070706_100000309
372 Ga0070707_100218542
373 Ga0070698_100050225
374 Ga0070698_100162093
375 Ga0070699_100006469
376 Ga0070699_100108350
377 Ga0070699_100356356
378 Ga0070679_100040721
379 Ga0070679_100150383
380 Ga0070697_100150652
381 Ga0070697_100328426
382 Ga0068853_100061703
383 Ga0068853_100138159
384 Ga0070695_100010210
385 Ga0070695_100039181
386 Ga0070695_100053240
387 Ga0070695_100058431
388 Ga0070696_100007252
389 Ga0070696_100056127
390 Ga0070693_100004927
391 Ga0070693_100038149
392 Ga0070693_100053373
393 Ga0070693_100127951
394 Ga0070693_100178654
395 Ga0070704_100070317
396 Ga0070704_100126938
397 Ga0070704_100317568
398 Ga0068855_100161458
399 Ga0070664_100002453
400 Ga0068857_100002893
401 Ga0068857_100339324
402 Ga0068854_100074582
403 Ga0068856_100002356
404 Ga0068856_100350570
405 Ga0070702_100248400
406 Ga0068852_100217424
407 Ga0068859_100004587
408 Ga0068859_100005524
409 Ga0068859_100025817
410 Ga0068859_100049836
411 Ga0068859_100068073
412 Ga0068859_100070810
413 Ga0068859_100101504
414 Ga0068864_100079203
415 Ga0068864_100334740
416 Ga0068863_100028670
417 Ga0068863_100273792
418 Ga0068863_100392359
419 Ga0068858_100084701
420 Ga0068858_100124320
421 Ga0068860_100045395
422 Ga0068860_100045973
423 Ga0068860_100089193
424 Ga0068860_100451200
425 Ga0068862_100080640
426 Ga0068862_100173983
427 Ga0081455_10001203
428 Ga0081455_10008748
429 Ga0081539_10000281
430 Ga0081539_10000346
431 Ga0081539_10010403
432 Ga0070716_100040551
433 Ga0070716_100112484
434 Ga0097621_100005248
435 Ga0068871_100001358
436 Ga0068871_100021562
437 Ga0075428_100154544
438 Ga0075428_100556481
439 Ga0075430_100057070
440 Ga0075430_100164133
441 Ga0075431_100053427
442 Ga0075431_100054627
443 Ga0075433_10073943
444 Ga0075434_100107134
445 Ga0075434_100298079
446 Ga0075429_100007407
447 Ga0075429_100054418
448 Ga0068865_100430938
449 Ga0097620_100004587
450 Ga0097620_100005524
451 Ga0097620_100025815
452 Ga0097620_100049835
453 Ga0097620_100068076
454 Ga0097620_100070811
455 Ga0097620_100101506
456 Ga0075435_100225937
457 Ga0105240_10024550
458 Ga0105240_10130081
459 Ga0111539_10005824
460 Ga0111539_10046528
461 Ga0111539_10047734
462 Ga0111539_10074831
463 Ga0111539_10247234
464 Ga0111539_10446741
465 Ga0105247_10007707
466 Ga0114129_10133240
467 Ga0114129_10171768
468 Ga0114129_10184114
469 Ga0114129_10324839
470 Ga0114129_10432252
471 Ga0114129_10592558
472 Ga0105243_10028161
473 Ga0105241_10027277
474 Ga0105242_10256576
475 Ga0105248_10005168
476 Ga0105248_10008788
477 Ga0105248_10056070
478 Ga0105248_10117775
479 Ga0105248_10188602
480 Ga0105237_10160875
481 Ga0105238_10035215
482 Ga0105249_10363901
483 Ga0105249_10599644
484 Ga0105239_10053576
485 Ga0105239_10192149
486 Ga0105239_10368435
487 Ga0105239_10765136
488 Ga0157373_10022735
489 Ga0157373_10066068
490 Ga0157378_10211324
491 Ga0163162_10012958
492 Ga0157372_10022739
493 Ga0157375_10198115
494 Ga0163163_10000238
495 Ga0163163_10102073
496 Ga0157380_10001520
497 Ga0157380_10055910
498 Ga0157377_10246863
499 Ga0157379_10143956
500 Ga0207647_10003766
501 Ga0207643_10008149
502 Ga0207643_10050835
503 Ga0207654_10179614
504 Ga0207707_10014213
505 Ga0207707_10047966
506 Ga0207695_10115075
507 Ga0207671_10028023
508 Ga0207660_10087663
509 Ga0207649_10009011
510 Ga0207646_10185997
511 Ga0207681_10300701
512 Ga0207650_10000009
513 Ga0207690_10005187
514 Ga0207706_10219667
515 Ga0207706_10241689
516 Ga0207706_10447929
517 Ga0207709_10003681
518 Ga0207709_10027553
519 Ga0207670_10069326
520 Ga0207704_10387528
521 Ga0207665_10061460
522 Ga0207665_10142162
523 Ga0207711_10002332
524 Ga0207711_10087582
525 Ga0207711_10168432
526 Ga0207711_10261957
527 Ga0207711_10420534
528 Ga0207689_10052877
529 Ga0207689_10166578
530 Ga0207689_10268188
531 Ga0207679_10149044
532 Ga0207679_10180536
533 Ga0207651_10076019
534 Ga0207640_10187069
535 Ga0207640_10368926
536 Ga0207703_10065943
537 Ga0207639_10006246
538 Ga0207639_10355727
539 Ga0207708_10000306
540 Ga0207708_10013281
541 Ga0207708_10203258
542 Ga0207702_10296631
543 Ga0207641_10166049
544 Ga0207641_10206251
545 Ga0207641_10255760
546 Ga0207641_10696834
547 Ga0207648_10034054
548 Ga0207676_10002763
549 Ga0207676_10071354
550 Ga0207676_10444704
551 Ga0207676_10448849
552 Ga0207674_10000054
553 Ga0207674_10442595
554 Ga0207675_100101648
555 Ga0207698_10048456
556 Ga0207428_10007773
557 Ga0207428_10028931
558 Ga0207428_10257736
559 Ga0268264_10064773
560 Ga0268264_10082249
561 Ga0268264_10103826
562 Ga0268264_10475565
563 Ga0307408_100002962
564 Ga0307408_100169789
565 Ga0307408_100235437
566 Ga0307408_100369014
567 Ga0307405_10142218
568 Ga0307405_10233464
569 Ga0307410_10051301
570 Ga0307410_10067344
571 Ga0307406_10101418
572 Ga0307407_10043551
573 Ga0307412_10026244
574 Ga0307412_10075131
575 Ga0307412_10175438
576 Ga0307416_100160065
577 Ga0307416_100196358
578 Ga0307414_10039397
579 Ga0307415_100118693
580 Ga0373949_0021229
581 Ga0373949_0052889
582 Ga0373941_0023643
583 Ga0373942_0002598
584 Ga0373931_0199379
585 Ga0395900_0170540
586 Ga0395900_0312359
587 Ga0395898_0054716
588 Ga0439455_0007190
589 Ga0439458_0009069
590 Ga0496102_0006461
591 Ga0496104_0013070
592 Ga0496106_0012867
593 Ga0496106_0164239
594 Ga0496107_0126966
595 Ga0496107_0179152
596 Ga0496109_0000026
597 Ga0496110_0259475
598 Ga0496112_0253375
599 Ga0496113_0039089
600 Ga0501292_001622
601 Ga0501298_007509
602 Ga0501298_015177
603 Ga0501038_0013420
604 Ga0501198_010063
605 Ga0501202_005299
606 Ga0501208_017578
607 Ga0501216_021735
608 Ga0501217_000091
609 Ga0501223_003978
610 Ga0501224_020520
611 Ga0501227_004128
612 Ga0501230_007950
613 Ga0501233_008761
614 Ga0501233_028039
615 Ga0501235_008441
616 Ga0501235_038551
617 Ga0501249_010979
618 Ga0501249_013299
619 Ga0501257_006627
620 Ga0501260_001579
621 Ga0501225_0001353
622 Ga0501225_0008543
623 Ga0501225_0053691
624 Ga0501225_0072806
625 Ga0501229_005942
626 Ga0501268_006977
627 Ga0501270_000704
628 Ga0501212_009568
629 Ga0501226_005043
630 nmdc:mga05p37_259509_c1
631 nmdc:mga05p37_267114_c1
632 nmdc:mga05p37_58192_c1
633 nmdc:mga05p37_589675_c1
634 nmdc:mga05p37_97329_c1
635 nmdc:mga09592_43119_c1
636 nmdc:mga09592_70112_c1
637 nmdc:mga0qj67_296304_c1
638 nmdc:mga06r32_101278_c1
639 nmdc:mga06r32_60746_c1
640 nmdc:mga06r32_6847_c1
641 nmdc:mga08y16_120952_c1
642 nmdc:mga08y16_2959_c1
643 nmdc:mga08y16_365431_c1
644 nmdc:mga08y16_395498_c1
645 nmdc:mga08y16_524436_c1
646 nmdc:mga0n895_119849_c1
647 nmdc:mga0n895_162778_c1
648 nmdc:mga0n895_43396_c1
649 nmdc:mga0n895_450921_c1
650 nmdc:mga0n895_95751_c1
651 nmdc:mga0rr50_207468_c1
652 nmdc:mga0a205_178546_c1
653 nmdc:mga0a205_58214_c1
654 nmdc:mga0a205_97026_c1
655 Ga0500555_009452
656 Ga0501084_0014524
657 Ga0530510_0020474
658 Ga0530510_0318724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

212

327

0.91

PF14534

DUF4440

Domain of unknown function (DUF4440)

59

182

0.85

PF13474

SnoaL_3

SnoaL-like domain

213

327

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.8649 176 292
2r4i-assembly1.cif.gz_B crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution 0.8628 168 292
2r4i-assembly1.cif.gz_B crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution 0.8431 168 292
3fsd-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function in nutrient uptake (yp_427473.1) from rhodospirillum rubrum atcc 11170 at 1.70 a resolution 0.8384 176 292
2chc-assembly1.cif.gz_C structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis 0.8382 175 291
ID Description Score Start End Superfamily
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8823 173 292 3.10.450.50
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8579 176 291 3.10.450.50
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8482 173 292 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8468 169 292 3.10.450.50
2chcB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8413 175 291 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7W8MSK6-F1-model_v4 Ketosteroid isomerase-like protein 0.9741 164 295 GO:0016853
AF-A0A7G8BP48-F1-model_v4 Nuclear transport factor 2 family protein 0.9484 166 292
AF-A0A2V2RGZ5-F1-model_v4 DUF4440 domain-containing protein 0.9392 17 295
AF-A0A537R2P2-F1-model_v4 Nuclear transport factor 2 family protein 0.9101 185 292
AF-A0A843RWE4-F1-model_v4 DUF4440 domain-containing protein 0.903 177 292

Map