F409625

General Info

Members Datasets Scaffolds Average Seq Length
329 159 658 238

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100014633|Ga0075429_1000146336
Length 258
Sequence VAGTVAAVRHMPICTTEDKMAKHGKKYTAALAKVDLDKEYSARDAVALAKETSITKFDSTVEVHMRTALDPRQADQQVRDVVVLPHGLGKTVRVLVFAQGEGAAAARSAGADLVADDDETMKKIEGGMLDFDVAIATPDAMGRVGRLGRVLGPRGLMPNPKAGTVVSADNIARAIKEAKAGRVEFRLDKTANIHVSVGKVSFNADQLYENFAALMEAVHKARPAGAKGEYIKRITLTTTMGPGIKVNPGDTYKLEGIE

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
62 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
63 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
70 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
84 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
85 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
86 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
97 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
100 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
101 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
102 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
103 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.66
Metatranscriptomes 3.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.74
Nodule 0
Rhizoplane 0.3
Rhizosphere 96.66
Stem 0
Stem Tuber 0
Unclassified 5.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100014633 3300006880 Bacteria 6800
2 SwRhRL2b_contig_3953429 2162886007 Bacteria 4650
3 JGI25406J46586_10000367 3300003203 Bacteria 20597
4 JGI25407J50210_10036946 3300003373 Bacteria 1256
5 JGI25405J52794_10021316 3300003911 Bacteria 1310
6 Ga0065704_10078404 3300005289 Bacteria 4440
7 Ga0065712_10162628 3300005290 Unclassified 1291
8 Ga0065715_10170008 3300005293 Bacteria 1554
9 Ga0065707_10000587 3300005295 Bacteria 19505
10 Ga0065707_10092154 3300005295 Bacteria 3817
11 Ga0065707_10355975 3300005295 Bacteria 911
12 Ga0070689_100153227 3300005340 Unclassified 1860
13 Ga0070687_100054259 3300005343 Bacteria 2088
14 Ga0070668_100449008 3300005347 Bacteria 1108
15 Ga0070671_100004593 3300005355 Bacteria 10941
16 Ga0070705_100223996 3300005440 Bacteria 1304
17 Ga0070705_100240918 3300005440 Bacteria 1264
18 Ga0070694_100055848 3300005444 Bacteria 2679
19 Ga0070694_100070258 3300005444 Unclassified 2411
20 Ga0068867_100261361 3300005459 Bacteria 1411
21 Ga0070706_100355311 3300005467 Unclassified 1366
22 Ga0070707_100122242 3300005468 Bacteria 2527
23 Ga0070707_100262622 3300005468 Bacteria 1679
24 Ga0070707_100793246 3300005468 Bacteria 911
25 Ga0070698_100008324 3300005471 Bacteria 11209
26 Ga0070698_100044974 3300005471 Bacteria 4519
27 Ga0070698_100137731 3300005471 Bacteria 2394
28 Ga0070699_100003541 3300005518 Bacteria 13803
29 Ga0070699_100035302 3300005518 Bacteria 4322
30 Ga0070699_100120697 3300005518 Bacteria 2305
31 Ga0070699_100276569 3300005518 Bacteria 1503
32 Ga0070699_100513977 3300005518 Bacteria 1088
33 Ga0070697_100364151 3300005536 Bacteria 1250
34 Ga0070695_100065547 3300005545 Bacteria 2365
35 Ga0070695_100154749 3300005545 Bacteria 1603
36 Ga0070696_100041162 3300005546 Bacteria 3191
37 Ga0070696_100162419 3300005546 Bacteria 1647
38 Ga0070696_100358007 3300005546 Bacteria 1132
39 Ga0070696_100697570 3300005546 Bacteria 827
40 Ga0070704_100003031 3300005549 Bacteria 9555
41 Ga0068857_100196826 3300005577 Bacteria 1836
42 Ga0068857_100199871 3300005577 Bacteria 1822
43 Ga0068864_100046272 3300005618 Bacteria 3733
44 Ga0068861_100036368 3300005719 Bacteria 3654
45 Ga0068870_10146240 3300005840 Bacteria 1388
46 Ga0068858_100099119 3300005842 Bacteria 2717
47 Ga0068862_100004463 3300005844 Bacteria 11802
48 Ga0068862_100067977 3300005844 Unclassified 3073
49 Ga0068862_100830137 3300005844 Bacteria 904
50 Ga0081455_10007316 3300005937 Bacteria 11644
51 Ga0081455_10054317 3300005937 Bacteria 3415
52 Ga0081538_10098460 3300005981 Bacteria 1482
53 Ga0081539_10001957 3300005985 Bacteria 31406
54 Ga0081539_10111406 3300005985 Bacteria 1377
55 Ga0075365_10117063 3300006038 Bacteria 1835
56 Ga0075364_10049356 3300006051 Bacteria 2744
57 Ga0075364_10049488 3300006051 Bacteria 2741
58 Ga0075362_10036371 3300006177 Bacteria 2154
59 Ga0075369_10038832 3300006186 Bacteria 2032
60 Ga0075427_10004500 3300006194 Bacteria 1957
61 Ga0075428_100004514 3300006844 Bacteria 15372
62 Ga0075428_100033498 3300006844 Bacteria 5672
63 Ga0075428_100079686 3300006844 Bacteria 3574
64 Ga0075428_100165332 3300006844 Bacteria 2400
65 Ga0075430_100180526 3300006846 Bacteria 1756
66 Ga0075430_100386736 3300006846 Bacteria 1154
67 Ga0075430_100603336 3300006846 Bacteria 906
68 Ga0075431_100026658 3300006847 Bacteria 5928
69 Ga0075431_100028344 3300006847 Bacteria 5753
70 Ga0075431_100194394 3300006847 Bacteria 2078
71 Ga0075431_100787627 3300006847 Bacteria 924
72 Ga0075429_100109304 3300006880 Bacteria 2416
73 Ga0075429_100329717 3300006880 Bacteria 1335
74 Ga0075429_100492811 3300006880 Bacteria 1074
75 Ga0111539_10063480 3300009094 Bacteria 4370
76 Ga0105245_10391231 3300009098 Bacteria 1387
77 Ga0114129_10004898 3300009147 Bacteria 18897
78 Ga0114129_10062088 3300009147 Bacteria 5221
79 Ga0114129_10103353 3300009147 Bacteria 3939
80 Ga0114129_10141497 3300009147 Bacteria 3297
81 Ga0114129_10147114 3300009147 Bacteria 3226
82 Ga0114129_10205246 3300009147 Bacteria 2667
83 Ga0114129_10299130 3300009147 Bacteria 2145
84 Ga0105243_10030780 3300009148 Bacteria 4135
85 Ga0105243_10665754 3300009148 Bacteria 1011
86 Ga0105243_10828487 3300009148 Bacteria 914
87 Ga0105242_10590650 3300009176 Bacteria 1071
88 Ga0105249_10004910 3300009553 Bacteria 11539
89 Ga0105249_10060852 3300009553 Bacteria 3464
90 Ga0105246_10023821 3300011119 Bacteria 3967
91 Ga0163163_10554765 3300014325 Bacteria 1211
92 Ga0163161_10516659 3300017792 Bacteria 975
93 Ga0206354_10348121 3300020081 Bacteria 971
94 Ga0224712_10022966 3300022467 Bacteria 2158
95 Ga0224712_10097688 3300022467 Bacteria 1240
96 Ga0207684_10210627 3300025910 Bacteria 1677
97 Ga0207660_10400533 3300025917 Bacteria 1105
98 Ga0207712_10394268 3300025961 Bacteria 1162
99 Ga0207668_10131170 3300025972 Bacteria 1914
100 Ga0207708_10099456 3300026075 Bacteria 2250
101 Ga0207674_10073966 3300026116 Bacteria 3420
102 Ga0207675_100065675 3300026118 Bacteria 3391
103 Ga0207675_100502983 3300026118 Unclassified 1206
104 Ga0268265_10019052 3300028380 Bacteria 4765
105 Ga0268265_10104798 3300028380 Bacteria 2293
106 Ga0268265_10124486 3300028380 Unclassified 2130
107 Ga0265326_10014825 3300028558 Bacteria 2267
108 Ga0265334_10011438 3300028573 Bacteria 3738
109 Ga0265318_10013800 3300028577 Bacteria 3403
110 Ga0265338_10107338 3300028800 Bacteria 2258
111 Ga0265320_10067806 3300031240 Bacteria 1687
112 Ga0265340_10007384 3300031247 Bacteria 5968
113 Ga0265331_10017435 3300031250 Bacteria 3744
114 Ga0265316_10111523 3300031344 Bacteria 2071
115 Ga0316575_10045949 3300031665 Bacteria 1734
116 Ga0316579_10008407 3300031691 Bacteria 4300
117 Ga0316576_10023326 3300031727 Bacteria 4308
118 Ga0316576_10044976 3300031727 Bacteria 3191
119 Ga0316578_10028920 3300031728 Bacteria 3142
120 Ga0316577_10082433 3300031733 Bacteria 1799
121 Ga0316577_10087737 3300031733 Bacteria 1741
122 Ga0316577_10325191 3300031733 Bacteria 872
123 Ga0307413_10014248 3300031824 Bacteria 4030
124 Ga0307410_10156666 3300031852 Bacteria 1702
125 Ga0307407_10004321 3300031903 Bacteria 6006
126 Ga0307409_100026443 3300031995 Bacteria 4093
127 Ga0307416_100514674 3300032002 Unclassified 1264
128 Ga0307411_10159570 3300032005 Bacteria 1687
129 Ga0316593_10014182 3300032168 Bacteria 2372
130 Ga0316593_10015934 3300032168 Bacteria 2270
131 Ga0316593_10023092 3300032168 Bacteria 1961
132 Ga0316593_10062740 3300032168 Bacteria 1273
133 Ga0316592_1029624 3300033524 Bacteria 1188
134 Ga0316596_1003416 3300033541 Bacteria 3477
135 Ga0316596_1015058 3300033541 Unclassified 1924
136 Ga0316596_1016900 3300033541 Bacteria 1830
137 Ga0373930_0003095 3300034816 Bacteria 2618
138 Ga0373928_0015455 3300035084 Bacteria 1554
139 Ga0373929_0000604 3300035085 Bacteria 6942
140 Ga0373932_0003739 3300035112 Bacteria 3633
141 Ga0373953_0185003 3300035117 Bacteria 899
142 Ga0373961_0039316 3300035241 Bacteria 1359
143 Ga0316574_0187099 3300035398 Bacteria 1332
144 Ga0373924_0114867 3300035410 Bacteria 1166
145 Ga0373931_0000003 3300035691 Bacteria 560286
146 Ga0373931_0001947 3300035691 Bacteria 9058
147 Ga0373937_0073895 3300036401 Bacteria 3145
148 Ga0316582_0008470 3300036647 Bacteria 5531
149 Ga0316582_0107805 3300036647 Bacteria 1851
150 Ga0316582_0276868 3300036647 Bacteria 1151
151 Ga0316584_0043744 3300036712 Bacteria 3340
152 Ga0316584_0124523 3300036712 Bacteria 1925
153 Ga0395905_0588081 3300037471 Bacteria 1015
154 Ga0395905_0736437 3300037471 Bacteria 888
155 Ga0316581_0027481 3300037588 Bacteria 1701
156 Ga0400483_144468 3300039062 Bacteria 9002
157 Ga0439448_0042276 3300042005 Bacteria 1477
158 Ga0439450_001812 3300042008 Bacteria 3216
159 Ga0439454_001606 3300042011 Bacteria 2215
160 Ga0439456_026470 3300042013 Bacteria 1234
161 Ga0439463_005224 3300042016 Bacteria 3229
162 Ga0439460_0009975 3300042461 Bacteria 2422
163 Ga0451577_0016422 3300042876 Bacteria 6858
164 Ga0451577_0036920 3300042876 Bacteria 4399
165 Ga0451577_0042457 3300042876 Bacteria 4079
166 Ga0451577_0061991 3300042876 Bacteria 3335
167 Ga0451577_0069151 3300042876 Bacteria 3149
168 Ga0451577_0212722 3300042876 Bacteria 1747
169 Ga0451577_0226400 3300042876 Bacteria 1691
170 Ga0451577_0230342 3300042876 Bacteria 1675
171 Ga0451577_0263217 3300042876 Bacteria 1561
172 Ga0451577_0308866 3300042876 Bacteria 1433
173 Ga0451577_0472342 3300042876 Bacteria 1139
174 Ga0451577_0564563 3300042876 Bacteria 1033
175 Ga0451577_0606157 3300042876 Unclassified 994
176 Ga0451577_0622987 3300042876 Bacteria 979
177 Ga0451577_0798910 3300042876 Bacteria 852
178 Ga0451577_0869644 3300042876 Bacteria 812
179 Ga0451577_0885676 3300042876 Bacteria 804
180 Ga0453683_0002238 3300044673 Bacteria 15295
181 Ga0453683_0009016 3300044673 Bacteria 6663
182 Ga0453683_0029392 3300044673 Bacteria 3475
183 Ga0453683_0080038 3300044673 Bacteria 2046
184 Ga0453683_0117932 3300044673 Bacteria 1670
185 Ga0453683_0145699 3300044673 Bacteria 1495
186 Ga0453683_0191942 3300044673 Bacteria 1296
187 Ga0453684_0000053 3300044712 Bacteria 545350
188 Ga0453684_0001390 3300044712 Bacteria 70039
189 Ga0453684_0002905 3300044712 Bacteria 40159
190 Ga0453684_0004574 3300044712 Bacteria 28877
191 Ga0453684_0007412 3300044712 Bacteria 20193
192 Ga0453684_0009456 3300044712 Bacteria 17047
193 Ga0453684_0015826 3300044712 Bacteria 11859
194 Ga0453684_0023194 3300044712 Bacteria 9157
195 Ga0453684_0024636 3300044712 Bacteria 8780
196 Ga0453684_0040080 3300044712 Bacteria 6368
197 Ga0453684_0040272 3300044712 Bacteria 6350
198 Ga0453684_0046265 3300044712 Bacteria 5789
199 Ga0453684_0056281 3300044712 Bacteria 5103
200 Ga0453684_0061035 3300044712 Bacteria 4843
201 Ga0453684_0061849 3300044712 Bacteria 4803
202 Ga0453684_0067627 3300044712 Bacteria 4543
203 Ga0453684_0083932 3300044712 Bacteria 3963
204 Ga0453684_0093633 3300044712 Bacteria 3700
205 Ga0453684_0106015 3300044712 Bacteria 3426
206 Ga0453684_0115884 3300044712 Bacteria 3246
207 Ga0453684_0168281 3300044712 Bacteria 2585
208 Ga0453684_0206616 3300044712 Bacteria 2285
209 Ga0453684_0236903 3300044712 Bacteria 2104
210 Ga0453684_0245114 3300044712 Bacteria 2061
211 Ga0453684_0255643 3300044712 Bacteria 2009
212 Ga0453684_0259192 3300044712 Bacteria 1993
213 Ga0453684_0261641 3300044712 Unclassified 1981
214 Ga0453684_0286127 3300044712 Bacteria 1878
215 Ga0453684_0292273 3300044712 Bacteria 1855
216 Ga0453684_0362268 3300044712 Bacteria 1632
217 Ga0453684_0370521 3300044712 Bacteria 1610
218 Ga0453684_0386516 3300044712 Bacteria 1570
219 Ga0453684_0405751 3300044712 Bacteria 1525
220 Ga0453684_0417562 3300044712 Bacteria 1499
221 Ga0453684_0485411 3300044712 Bacteria 1370
222 Ga0453684_0522892 3300044712 Bacteria 1311
223 Ga0453684_0552873 3300044712 Bacteria 1268
224 Ga0453684_0560850 3300044712 Unclassified 1257
225 Ga0451576_0011013 3300045051 Bacteria 10326
226 Ga0451576_0011617 3300045051 Bacteria 9977
227 Ga0451576_0041117 3300045051 Bacteria 4888
228 Ga0451576_0043649 3300045051 Bacteria 4730
229 Ga0451576_0045321 3300045051 Unclassified 4632
230 Ga0451576_0063214 3300045051 Bacteria 3858
231 Ga0451576_0079806 3300045051 Bacteria 3405
232 Ga0451576_0092060 3300045051 Bacteria 3154
233 Ga0451576_0199610 3300045051 Bacteria 2089
234 Ga0451576_0310380 3300045051 Bacteria 1650
235 Ga0451576_0513780 3300045051 Bacteria 1258
236 Ga0451576_0541485 3300045051 Bacteria 1223
237 Ga0451576_0744612 3300045051 Bacteria 1029
238 Ga0495651_0005682 3300046462 Bacteria 9506
239 Ga0495653_0024528 3300046463 Bacteria 4859
240 Ga0495608_0065191 3300046511 Bacteria 2386
241 Ga0495652_0295173 3300046529 Bacteria 1181
242 Ga0495587_0194677 3300046536 Bacteria 1147
243 Ga0495645_0311706 3300046543 Bacteria 1025
244 Ga0495667_0015268 3300046559 Bacteria 5186
245 Ga0495657_0017051 3300046675 Bacteria 5279
246 Ga0495623_0030026 3300046679 Bacteria 3498
247 Ga0495676_0117263 3300047321 Bacteria 1943
248 Ga0495680_0005429 3300047322 Bacteria 12002
249 Ga0495680_0073149 3300047322 Bacteria 2606
250 Ga0495675_0019093 3300047444 Bacteria 4355
251 Ga0495684_0377461 3300047471 Bacteria 1001
252 Ga0496100_0540639 3300048903 Bacteria 901
253 Ga0501032_0244349 3300049569 Bacteria 1166
254 Ga0501033_0083691 3300049570 Bacteria 2338
255 Ga0501034_0004435 3300049571 Bacteria 15613
256 Ga0501034_0011458 3300049571 Bacteria 9188
257 Ga0501034_0012519 3300049571 Bacteria 8758
258 Ga0501036_0008564 3300049572 Bacteria 8389
259 Ga0501039_0009764 3300049575 Bacteria 7311
260 Ga0501040_0102211 3300049576 Bacteria 2000
261 Ga0501040_0444567 3300049576 Bacteria 933
262 Ga0501041_0060371 3300049577 Bacteria 2321
263 Ga0501041_0072088 3300049577 Bacteria 2121
264 Ga0501041_0461874 3300049577 Bacteria 806
265 Ga0501042_0080226 3300049578 Unclassified 2338
266 Ga0501042_0264879 3300049578 Bacteria 1241
267 Ga0501043_0058382 3300049579 Bacteria 3029
268 Ga0501048_0029408 3300049582 Bacteria 3985
269 Ga0501048_0547935 3300049582 Bacteria 830
270 Ga0501068_0422830 3300049584 Bacteria 860
271 Ga0501070_0111025 3300049586 Bacteria 2266
272 Ga0501071_0566198 3300049587 Bacteria 873
273 Ga0501072_0003175 3300049588 Bacteria 12358
274 Ga0501072_0405967 3300049588 Bacteria 1081
275 Ga0501073_0426385 3300049589 Bacteria 917
276 Ga0501074_0079308 3300049590 Bacteria 2356
277 Ga0501074_0092415 3300049590 Bacteria 2167
278 Ga0501074_0194027 3300049590 Bacteria 1448
279 Ga0501075_0023308 3300049591 Bacteria 4531
280 Ga0501075_0035988 3300049591 Bacteria 3693
281 Ga0501075_0062426 3300049591 Bacteria 2808
282 Ga0501075_0122775 3300049591 Bacteria 1977
283 Ga0501075_0208155 3300049591 Bacteria 1492
284 Ga0501076_0013865 3300049592 Bacteria 6052
285 Ga0501076_0020768 3300049592 Bacteria 5028
286 Ga0501076_0147379 3300049592 Bacteria 1914
287 Ga0501077_0026395 3300049593 Bacteria 3686
288 Ga0501079_0023971 3300049741 Bacteria 4681
289 Ga0501079_0044369 3300049741 Bacteria 3431
290 Ga0501080_0095099 3300049742 Bacteria 2767
291 Ga0501081_0062428 3300049743 Bacteria 2584
292 Ga0501081_0201635 3300049743 Bacteria 1443
293 Ga0501081_0286036 3300049743 Bacteria 1208
294 Ga0501081_0456929 3300049743 Bacteria 949
295 Ga0501081_0504725 3300049743 Bacteria 901
296 Ga0501044_0265811 3300049823 Bacteria 1653
297 Ga0501045_0015682 3300049824 Bacteria 5375
298 Ga0501045_0032913 3300049824 Bacteria 3758
299 nmdc:mga03683_109311_c1 3300050489 Bacteria 1221
300 nmdc:mga00v17_24050_c2 3300050491 Bacteria 1836
301 nmdc:mga00v17_44561_c1 3300050491 Bacteria 2676
302 nmdc:mga0yw44_100750_c1 3300050492 Bacteria 1840
303 nmdc:mga05p37_18425_c1 3300050507 Bacteria 8434
304 nmdc:mga05p37_194260_c1 3300050507 Bacteria 2462
305 nmdc:mga05p37_22072_c1 3300050507 Bacteria 7715
306 nmdc:mga05p37_50766_c1 3300050507 Bacteria 5102
307 nmdc:mga05p37_87693_c1 3300050507 Bacteria 3835
308 nmdc:mga05p37_97390_c1 3300050507 Bacteria 3624
309 nmdc:mga09592_1856_c1 3300050508 Bacteria 17016
310 nmdc:mga09592_45050_c1 3300050508 Bacteria 3715
311 nmdc:mga09592_883909_c1 3300050508 Bacteria 752
312 nmdc:mga0qj67_198978_c1 3300050509 Bacteria 1628
313 nmdc:mga0qj67_289596_c1 3300050509 Unclassified 1327
314 nmdc:mga0qj67_436393_c1 3300050509 Bacteria 1055
315 nmdc:mga06r32_10064_c2 3300050510 Bacteria 5832
316 nmdc:mga06r32_112360_c1 3300050510 Bacteria 2681
317 nmdc:mga06r32_217876_c1 3300050510 Bacteria 1897
318 nmdc:mga06r32_347659_c1 3300050510 Unclassified 1160
319 nmdc:mga06r32_87496_c1 3300050510 Bacteria 3040
320 nmdc:mga08y16_239172_c1 3300050511 Bacteria 1877
321 nmdc:mga0a205_105428_c1 3300050515 Bacteria 2718
322 nmdc:mga0a205_330564_c1 3300050515 Unclassified 1394
323 Ga0495595_0026542 3300053084 Bacteria 2574
324 Ga0495619_0017532 3300053085 Bacteria 4535
325 Ga0501084_0013743 3300054114 Bacteria 6700
326 Ga0501082_0008983 3300060353 Bacteria 8626
327 Ga0501082_0069733 3300060353 Bacteria 3027
328 Ga0501082_0142764 3300060353 Bacteria 2078
329 Ga0530510_0033355 3300061734 Bacteria 3707
330 Ga0075429_100014633
331 SwRhRL2b_contig_3953429
332 JGI25406J46586_10000367
333 JGI25407J50210_10036946
334 JGI25405J52794_10021316
335 Ga0065704_10078404
336 Ga0065712_10162628
337 Ga0065715_10170008
338 Ga0065707_10000587
339 Ga0065707_10092154
340 Ga0065707_10355975
341 Ga0070689_100153227
342 Ga0070687_100054259
343 Ga0070668_100449008
344 Ga0070671_100004593
345 Ga0070705_100223996
346 Ga0070705_100240918
347 Ga0070694_100055848
348 Ga0070694_100070258
349 Ga0068867_100261361
350 Ga0070706_100355311
351 Ga0070707_100122242
352 Ga0070707_100262622
353 Ga0070707_100793246
354 Ga0070698_100008324
355 Ga0070698_100044974
356 Ga0070698_100137731
357 Ga0070699_100003541
358 Ga0070699_100035302
359 Ga0070699_100120697
360 Ga0070699_100276569
361 Ga0070699_100513977
362 Ga0070697_100364151
363 Ga0070695_100065547
364 Ga0070695_100154749
365 Ga0070696_100041162
366 Ga0070696_100162419
367 Ga0070696_100358007
368 Ga0070696_100697570
369 Ga0070704_100003031
370 Ga0068857_100196826
371 Ga0068857_100199871
372 Ga0068864_100046272
373 Ga0068861_100036368
374 Ga0068870_10146240
375 Ga0068858_100099119
376 Ga0068862_100004463
377 Ga0068862_100067977
378 Ga0068862_100830137
379 Ga0081455_10007316
380 Ga0081455_10054317
381 Ga0081538_10098460
382 Ga0081539_10001957
383 Ga0081539_10111406
384 Ga0075365_10117063
385 Ga0075364_10049356
386 Ga0075364_10049488
387 Ga0075362_10036371
388 Ga0075369_10038832
389 Ga0075427_10004500
390 Ga0075428_100004514
391 Ga0075428_100033498
392 Ga0075428_100079686
393 Ga0075428_100165332
394 Ga0075430_100180526
395 Ga0075430_100386736
396 Ga0075430_100603336
397 Ga0075431_100026658
398 Ga0075431_100028344
399 Ga0075431_100194394
400 Ga0075431_100787627
401 Ga0075429_100109304
402 Ga0075429_100329717
403 Ga0075429_100492811
404 Ga0111539_10063480
405 Ga0105245_10391231
406 Ga0114129_10004898
407 Ga0114129_10062088
408 Ga0114129_10103353
409 Ga0114129_10141497
410 Ga0114129_10147114
411 Ga0114129_10205246
412 Ga0114129_10299130
413 Ga0105243_10030780
414 Ga0105243_10665754
415 Ga0105243_10828487
416 Ga0105242_10590650
417 Ga0105249_10004910
418 Ga0105249_10060852
419 Ga0105246_10023821
420 Ga0163163_10554765
421 Ga0163161_10516659
422 Ga0206354_10348121
423 Ga0224712_10022966
424 Ga0224712_10097688
425 Ga0207684_10210627
426 Ga0207660_10400533
427 Ga0207712_10394268
428 Ga0207668_10131170
429 Ga0207708_10099456
430 Ga0207674_10073966
431 Ga0207675_100065675
432 Ga0207675_100502983
433 Ga0268265_10019052
434 Ga0268265_10104798
435 Ga0268265_10124486
436 Ga0265326_10014825
437 Ga0265334_10011438
438 Ga0265318_10013800
439 Ga0265338_10107338
440 Ga0265320_10067806
441 Ga0265340_10007384
442 Ga0265331_10017435
443 Ga0265316_10111523
444 Ga0316575_10045949
445 Ga0316579_10008407
446 Ga0316576_10023326
447 Ga0316576_10044976
448 Ga0316578_10028920
449 Ga0316577_10082433
450 Ga0316577_10087737
451 Ga0316577_10325191
452 Ga0307413_10014248
453 Ga0307410_10156666
454 Ga0307407_10004321
455 Ga0307409_100026443
456 Ga0307416_100514674
457 Ga0307411_10159570
458 Ga0316593_10014182
459 Ga0316593_10015934
460 Ga0316593_10023092
461 Ga0316593_10062740
462 Ga0316592_1029624
463 Ga0316596_1003416
464 Ga0316596_1015058
465 Ga0316596_1016900
466 Ga0373930_0003095
467 Ga0373928_0015455
468 Ga0373929_0000604
469 Ga0373932_0003739
470 Ga0373953_0185003
471 Ga0373961_0039316
472 Ga0316574_0187099
473 Ga0373924_0114867
474 Ga0373931_0000003
475 Ga0373931_0001947
476 Ga0373937_0073895
477 Ga0316582_0008470
478 Ga0316582_0107805
479 Ga0316582_0276868
480 Ga0316584_0043744
481 Ga0316584_0124523
482 Ga0395905_0588081
483 Ga0395905_0736437
484 Ga0316581_0027481
485 Ga0400483_144468
486 Ga0439448_0042276
487 Ga0439450_001812
488 Ga0439454_001606
489 Ga0439456_026470
490 Ga0439463_005224
491 Ga0439460_0009975
492 Ga0451577_0016422
493 Ga0451577_0036920
494 Ga0451577_0042457
495 Ga0451577_0061991
496 Ga0451577_0069151
497 Ga0451577_0212722
498 Ga0451577_0226400
499 Ga0451577_0230342
500 Ga0451577_0263217
501 Ga0451577_0308866
502 Ga0451577_0472342
503 Ga0451577_0564563
504 Ga0451577_0606157
505 Ga0451577_0622987
506 Ga0451577_0798910
507 Ga0451577_0869644
508 Ga0451577_0885676
509 Ga0453683_0002238
510 Ga0453683_0009016
511 Ga0453683_0029392
512 Ga0453683_0080038
513 Ga0453683_0117932
514 Ga0453683_0145699
515 Ga0453683_0191942
516 Ga0453684_0000053
517 Ga0453684_0001390
518 Ga0453684_0002905
519 Ga0453684_0004574
520 Ga0453684_0007412
521 Ga0453684_0009456
522 Ga0453684_0015826
523 Ga0453684_0023194
524 Ga0453684_0024636
525 Ga0453684_0040080
526 Ga0453684_0040272
527 Ga0453684_0046265
528 Ga0453684_0056281
529 Ga0453684_0061035
530 Ga0453684_0061849
531 Ga0453684_0067627
532 Ga0453684_0083932
533 Ga0453684_0093633
534 Ga0453684_0106015
535 Ga0453684_0115884
536 Ga0453684_0168281
537 Ga0453684_0206616
538 Ga0453684_0236903
539 Ga0453684_0245114
540 Ga0453684_0255643
541 Ga0453684_0259192
542 Ga0453684_0261641
543 Ga0453684_0286127
544 Ga0453684_0292273
545 Ga0453684_0362268
546 Ga0453684_0370521
547 Ga0453684_0386516
548 Ga0453684_0405751
549 Ga0453684_0417562
550 Ga0453684_0485411
551 Ga0453684_0522892
552 Ga0453684_0552873
553 Ga0453684_0560850
554 Ga0451576_0011013
555 Ga0451576_0011617
556 Ga0451576_0041117
557 Ga0451576_0043649
558 Ga0451576_0045321
559 Ga0451576_0063214
560 Ga0451576_0079806
561 Ga0451576_0092060
562 Ga0451576_0199610
563 Ga0451576_0310380
564 Ga0451576_0513780
565 Ga0451576_0541485
566 Ga0451576_0744612
567 Ga0495651_0005682
568 Ga0495653_0024528
569 Ga0495608_0065191
570 Ga0495652_0295173
571 Ga0495587_0194677
572 Ga0495645_0311706
573 Ga0495667_0015268
574 Ga0495657_0017051
575 Ga0495623_0030026
576 Ga0495676_0117263
577 Ga0495680_0005429
578 Ga0495680_0073149
579 Ga0495675_0019093
580 Ga0495684_0377461
581 Ga0496100_0540639
582 Ga0501032_0244349
583 Ga0501033_0083691
584 Ga0501034_0004435
585 Ga0501034_0011458
586 Ga0501034_0012519
587 Ga0501036_0008564
588 Ga0501039_0009764
589 Ga0501040_0102211
590 Ga0501040_0444567
591 Ga0501041_0060371
592 Ga0501041_0072088
593 Ga0501041_0461874
594 Ga0501042_0080226
595 Ga0501042_0264879
596 Ga0501043_0058382
597 Ga0501048_0029408
598 Ga0501048_0547935
599 Ga0501068_0422830
600 Ga0501070_0111025
601 Ga0501071_0566198
602 Ga0501072_0003175
603 Ga0501072_0405967
604 Ga0501073_0426385
605 Ga0501074_0079308
606 Ga0501074_0092415
607 Ga0501074_0194027
608 Ga0501075_0023308
609 Ga0501075_0035988
610 Ga0501075_0062426
611 Ga0501075_0122775
612 Ga0501075_0208155
613 Ga0501076_0013865
614 Ga0501076_0020768
615 Ga0501076_0147379
616 Ga0501077_0026395
617 Ga0501079_0023971
618 Ga0501079_0044369
619 Ga0501080_0095099
620 Ga0501081_0062428
621 Ga0501081_0201635
622 Ga0501081_0286036
623 Ga0501081_0456929
624 Ga0501081_0504725
625 Ga0501044_0265811
626 Ga0501045_0015682
627 Ga0501045_0032913
628 nmdc:mga03683_109311_c1
629 nmdc:mga00v17_24050_c2
630 nmdc:mga00v17_44561_c1
631 nmdc:mga0yw44_100750_c1
632 nmdc:mga05p37_18425_c1
633 nmdc:mga05p37_194260_c1
634 nmdc:mga05p37_22072_c1
635 nmdc:mga05p37_50766_c1
636 nmdc:mga05p37_87693_c1
637 nmdc:mga05p37_97390_c1
638 nmdc:mga09592_1856_c1
639 nmdc:mga09592_45050_c1
640 nmdc:mga09592_883909_c1
641 nmdc:mga0qj67_198978_c1
642 nmdc:mga0qj67_289596_c1
643 nmdc:mga0qj67_436393_c1
644 nmdc:mga06r32_10064_c2
645 nmdc:mga06r32_112360_c1
646 nmdc:mga06r32_217876_c1
647 nmdc:mga06r32_347659_c1
648 nmdc:mga06r32_87496_c1
649 nmdc:mga08y16_239172_c1
650 nmdc:mga0a205_105428_c1
651 nmdc:mga0a205_330564_c1
652 Ga0495595_0026542
653 Ga0495619_0017532
654 Ga0501084_0013743
655 Ga0501082_0008983
656 Ga0501082_0069733
657 Ga0501082_0142764
658 Ga0530510_0033355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00687

Ribosomal_L1

Ribosomal protein L1p/L10e family

49

242

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vpl-assembly1.cif.gz_A the structure of the complex between the first domain of l1 protein from thermus thermophilus and mrna from methanococcus jannaschii 0.9631 3 230
4wpo-assembly1.cif.gz_AC crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state 0.9604 4 229
4wpo-assembly1.cif.gz_AC crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state 0.9537 4 229
2ov7-assembly3.cif.gz_C the first domain of the ribosomal protein l1 from thermus thermophilus 0.9461 12 230
2vpl-assembly1.cif.gz_A the structure of the complex between the first domain of l1 protein from thermus thermophilus and mrna from methanococcus jannaschii 0.9428 3 230
ID Description Score Start End Superfamily
2wrrC01 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9659 16 229 3.30.190.20
2wrrC01 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9428 16 229 3.30.190.20
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9386 73 158 3.40.50.790
2vplC01 Special;Helix non-globular;Arc Repressor Mutant, subunit A;50S ribosomal protein L1; Chain A, Domain 1 0.9223 3 34 6.10.20.140
af_Q8I5U9_176_267_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9019 74 160 3.40.50.790
ID Description Score Start End GO Terms
AF-F0V938-F1-model_v4 Ribosomal protein L1, related 0.8666 33 232 GO:0005840
GO:1990904
AF-A0A351MZU0-F1-model_v4 deleted 0.8375 54 162
AF-A0A1E3P912-F1-model_v4 Ribosomal protein 0.8186 20 228 GO:0003723
GO:0003735
GO:0005762
GO:0006412
AF-A0A484MFV4-F1-model_v4 Ribosomal protein 0.7981 3 236 GO:0005840
GO:1990904
AF-A0A2M7TEQ2-F1-model_v4 Ribosomal protein 0.7862 2 228 GO:0003723
GO:0003735
GO:0006412
GO:0006417
GO:0015934

Map