F409614

General Info

Members Datasets Scaffolds Average Seq Length
329 227 658 105

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10560443|Ga0075370_105604432
Length 120
Sequence MRSAAEPGLHGVIMRTWRGVVRRTDADRYADYIRETGFTAYGETPGNRGAWLLRRDDGEETEFLTLSLWESRAAIVAFAGDDIEAAVLYPEDAAYLLGTSTITHHDVVDAVADGVGGVSP

Samples

Sample ID Description Type Environment
1 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
93 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
212 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.47
Nodule 0
Rhizoplane 8.81
Rhizosphere 85.41
Stem 0
Stem Tuber 0
Unclassified 6.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075370_10560443 3300006353 Unclassified 691
2 JGI24746J21847_1067843 3300001977 Bacteria 516
3 JGI24739J22299_10200956 3300001989 Bacteria 585
4 JGI24737J22298_10146765 3300001990 Bacteria 696
5 JGI24743J22301_10103602 3300001991 Bacteria 614
6 JGI24735J21928_10124349 3300002067 Bacteria 743
7 JGI24744J21845_10038473 3300002077 Bacteria 899
8 JGI25407J50210_10155399 3300003373 Bacteria 563
9 Ga0070658_10546818 3300005327 Unclassified 1002
10 Ga0070676_10505156 3300005328 Bacteria 859
11 Ga0070683_100754169 3300005329 Bacteria 932
12 Ga0070683_102072293 3300005329 Bacteria 546
13 Ga0070690_100131320 3300005330 Bacteria 1692
14 Ga0068869_100387496 3300005334 Bacteria 1147
15 Ga0068869_102004808 3300005334 Unclassified 519
16 Ga0070666_11161283 3300005335 Bacteria 575
17 Ga0070680_100634159 3300005336 Bacteria 918
18 Ga0070682_100779117 3300005337 Bacteria 775
19 Ga0068868_100061025 3300005338 Bacteria 2986
20 Ga0070660_100504583 3300005339 Bacteria 1006
21 Ga0070689_100547555 3300005340 Bacteria 997
22 Ga0070687_100330919 3300005343 Bacteria 976
23 Ga0070687_101043054 3300005343 Bacteria 595
24 Ga0070692_10927312 3300005345 Bacteria 604
25 Ga0070668_100153113 3300005347 Bacteria 1866
26 Ga0070669_100516043 3300005353 Bacteria 993
27 Ga0070669_100581980 3300005353 Bacteria 936
28 Ga0070675_100134050 3300005354 Bacteria 2113
29 Ga0070671_100905051 3300005355 Bacteria 771
30 Ga0070674_100142256 3300005356 Bacteria 1801
31 Ga0070674_100836966 3300005356 Bacteria 797
32 Ga0070674_100879360 3300005356 Bacteria 779
33 Ga0070673_100919498 3300005364 Bacteria 812
34 Ga0070688_100131606 3300005365 Bacteria 1688
35 Ga0070659_100324512 3300005366 Bacteria 1287
36 Ga0070710_10055615 3300005437 Bacteria 2237
37 Ga0070701_10365143 3300005438 Bacteria 906
38 Ga0070711_100211583 3300005439 Bacteria 1502
39 Ga0070705_100134044 3300005440 Bacteria 1620
40 Ga0070700_100498871 3300005441 Bacteria 936
41 Ga0070700_100799016 3300005441 Bacteria 759
42 Ga0070694_100914794 3300005444 Bacteria 725
43 Ga0070663_100564943 3300005455 Bacteria 952
44 Ga0070678_100443129 3300005456 Bacteria 1136
45 Ga0070678_101353207 3300005456 Bacteria 664
46 Ga0070662_100476729 3300005457 Bacteria 1038
47 Ga0070662_100567655 3300005457 Bacteria 952
48 Ga0068867_100044467 3300005459 Bacteria 3254
49 Ga0070685_10307310 3300005466 Bacteria 1070
50 Ga0070706_100413784 3300005467 Bacteria 1255
51 Ga0070699_100810626 3300005518 Bacteria 857
52 Ga0070684_100143088 3300005535 Bacteria 2163
53 Ga0068853_100298757 3300005539 Bacteria 1488
54 Ga0070686_100742383 3300005544 Bacteria 786
55 Ga0070695_100095796 3300005545 Bacteria 1990
56 Ga0070696_100352434 3300005546 Bacteria 1140
57 Ga0070693_100382047 3300005547 Bacteria 972
58 Ga0070665_101542325 3300005548 Bacteria 672
59 Ga0070704_100000695 3300005549 Bacteria 16346
60 Ga0070704_100433857 3300005549 Bacteria 1128
61 Ga0068855_100602361 3300005563 Bacteria 1185
62 Ga0070664_100590239 3300005564 Bacteria 1030
63 Ga0068854_100136142 3300005578 Bacteria 1880
64 Ga0068854_100926265 3300005578 Bacteria 767
65 Ga0068856_101568033 3300005614 Bacteria 672
66 Ga0070702_100023186 3300005615 Bacteria 3294
67 Ga0070702_100271132 3300005615 Bacteria 1160
68 Ga0070702_100557564 3300005615 Bacteria 852
69 Ga0068852_100096582 3300005616 Bacteria 2656
70 Ga0068852_100330083 3300005616 Bacteria 1484
71 Ga0068859_100576828 3300005617 Bacteria 1218
72 Ga0068864_101831852 3300005618 Bacteria 612
73 Ga0068866_10017148 3300005718 Bacteria 3252
74 Ga0068861_100102951 3300005719 Bacteria 2274
75 Ga0068861_100246022 3300005719 Bacteria 1523
76 Ga0068861_101785456 3300005719 Bacteria 610
77 Ga0068851_10245941 3300005834 Bacteria 1013
78 Ga0068870_10455848 3300005840 Bacteria 844
79 Ga0068858_100334576 3300005842 Bacteria 1448
80 Ga0068858_102192685 3300005842 Unclassified 546
81 Ga0068858_102261127 3300005842 Bacteria 537
82 Ga0068860_100231728 3300005843 Bacteria 1795
83 Ga0068860_101424750 3300005843 Bacteria 714
84 Ga0068862_100683893 3300005844 Bacteria 992
85 Ga0068862_100922840 3300005844 Bacteria 859
86 Ga0081455_10260185 3300005937 Bacteria 1264
87 Ga0081538_10005221 3300005981 Bacteria 11738
88 Ga0081539_10034934 3300005985 Bacteria 3030
89 Ga0075365_10027310 3300006038 Bacteria 3631
90 Ga0075365_10194509 3300006038 Bacteria 1420
91 Ga0075365_10850754 3300006038 Bacteria 643
92 Ga0075363_100104374 3300006048 Bacteria 1571
93 Ga0075363_100342637 3300006048 Bacteria 872
94 Ga0075363_100420518 3300006048 Bacteria 787
95 Ga0075363_100525088 3300006048 Bacteria 705
96 Ga0075364_10120392 3300006051 Bacteria 1757
97 Ga0075432_10127302 3300006058 Bacteria 962
98 Ga0070715_10071597 3300006163 Bacteria 1550
99 Ga0070712_100113046 3300006175 Bacteria 2030
100 Ga0075367_10227840 3300006178 Bacteria 1167
101 Ga0097621_101472411 3300006237 Bacteria 646
102 Ga0075434_101356475 3300006871 Bacteria 721
103 Ga0068865_100284793 3300006881 Bacteria 1317
104 Ga0068865_100736197 3300006881 Bacteria 846
105 Ga0097620_100576823 3300006931 Bacteria 1218
106 Ga0075435_101818683 3300007076 Archaea 535
107 Ga0111539_10178398 3300009094 Bacteria 2481
108 Ga0111539_11137080 3300009094 Bacteria 907
109 Ga0105245_10108550 3300009098 Bacteria 2578
110 Ga0105245_10465345 3300009098 Bacteria 1275
111 Ga0105245_10563207 3300009098 Bacteria 1162
112 Ga0105245_11526733 3300009098 Bacteria 719
113 Ga0105247_10182244 3300009101 Bacteria 1402
114 Ga0105243_10098673 3300009148 Bacteria 2420
115 Ga0105243_10215448 3300009148 Bacteria 1694
116 Ga0105243_11025145 3300009148 Bacteria 829
117 Ga0105243_11233284 3300009148 Bacteria 762
118 Ga0105241_10367639 3300009174 Bacteria 1253
119 Ga0105242_10179701 3300009176 Bacteria 1866
120 Ga0105237_12035534 3300009545 Bacteria 583
121 Ga0105238_10984622 3300009551 Bacteria 864
122 Ga0105249_10493168 3300009553 Bacteria 1269
123 Ga0105249_10496769 3300009553 Bacteria 1265
124 Ga0105249_12168317 3300009553 Bacteria 628
125 Ga0105239_10659219 3300010375 Bacteria 1195
126 Ga0105239_11027548 3300010375 Bacteria 948
127 Ga0105246_10269075 3300011119 Bacteria 1361
128 Ga0105246_10689502 3300011119 Bacteria 894
129 Ga0157336_1022161 3300012477 Bacteria 583
130 Ga0157335_1007114 3300012492 Bacteria 828
131 Ga0157373_11196565 3300013100 Bacteria 573
132 Ga0157374_10456520 3300013296 Bacteria 1279
133 Ga0163162_10137379 3300013306 Bacteria 2556
134 Ga0157372_10320847 3300013307 Bacteria 1804
135 Ga0157372_12716945 3300013307 Bacteria 568
136 Ga0157375_10238482 3300013308 Bacteria 1978
137 Ga0182008_10278864 3300014497 Bacteria 869
138 Ga0157377_10047671 3300014745 Bacteria 2401
139 Ga0157379_10483278 3300014968 Bacteria 1146
140 Ga0157379_10903107 3300014968 Unclassified 838
141 Ga0163161_10951979 3300017792 Bacteria 730
142 Ga0206353_10981136 3300020082 Bacteria 897
143 Ga0207656_10386191 3300025321 Bacteria 702
144 Ga0207710_10047466 3300025900 Bacteria 1920
145 Ga0207688_10019172 3300025901 Bacteria 3724
146 Ga0207680_11160627 3300025903 Bacteria 551
147 Ga0207647_10139030 3300025904 Bacteria 1424
148 Ga0207645_10120434 3300025907 Bacteria 1703
149 Ga0207643_10011724 3300025908 Bacteria 4735
150 Ga0207705_11094922 3300025909 Bacteria 614
151 Ga0207654_10559091 3300025911 Archaea 813
152 Ga0207693_10661101 3300025915 Bacteria 811
153 Ga0207663_10024808 3300025916 Bacteria 3458
154 Ga0207660_10904066 3300025917 Bacteria 720
155 Ga0207662_10041850 3300025918 Bacteria 2698
156 Ga0207657_10392725 3300025919 Bacteria 1091
157 Ga0207652_10411665 3300025921 Bacteria 1220
158 Ga0207681_10790250 3300025923 Bacteria 792
159 Ga0207694_10818560 3300025924 Bacteria 787
160 Ga0207659_11008143 3300025926 Bacteria 716
161 Ga0207687_10010311 3300025927 Bacteria 6106
162 Ga0207687_10137983 3300025927 Bacteria 1847
163 Ga0207644_10741840 3300025931 Bacteria 820
164 Ga0207690_10069106 3300025932 Bacteria 2429
165 Ga0207690_11483770 3300025932 Bacteria 567
166 Ga0207686_10273608 3300025934 Bacteria 1243
167 Ga0207686_11006443 3300025934 Bacteria 676
168 Ga0207709_10966415 3300025935 Bacteria 695
169 Ga0207709_11515334 3300025935 Bacteria 556
170 Ga0207670_10058115 3300025936 Bacteria 2626
171 Ga0207670_11938511 3300025936 Bacteria 501
172 Ga0207669_10085157 3300025937 Bacteria 2040
173 Ga0207669_10724633 3300025937 Bacteria 819
174 Ga0207704_10072241 3300025938 Bacteria 2192
175 Ga0207704_10269658 3300025938 Bacteria 1288
176 Ga0207704_11628102 3300025938 Bacteria 555
177 Ga0207691_10563927 3300025940 Bacteria 965
178 Ga0207691_11383530 3300025940 Bacteria 579
179 Ga0207689_10044365 3300025942 Bacteria 3676
180 Ga0207689_10099103 3300025942 Bacteria 2394
181 Ga0207689_11519289 3300025942 Unclassified 559
182 Ga0207661_10288704 3300025944 Bacteria 1468
183 Ga0207679_10401267 3300025945 Bacteria 1206
184 Ga0207679_10529293 3300025945 Bacteria 1055
185 Ga0207667_10579714 3300025949 Bacteria 1132
186 Ga0207712_10369776 3300025961 Bacteria 1197
187 Ga0207668_10738796 3300025972 Bacteria 867
188 Ga0207677_10527617 3300026023 Bacteria 1025
189 Ga0207703_10067574 3300026035 Bacteria 2942
190 Ga0207703_11217488 3300026035 Bacteria 724
191 Ga0207639_10428424 3300026041 Bacteria 1197
192 Ga0207639_11770308 3300026041 Bacteria 578
193 Ga0207678_10424348 3300026067 Bacteria 1153
194 Ga0207678_10430422 3300026067 Bacteria 1145
195 Ga0207708_10019178 3300026075 Bacteria 5152
196 Ga0207708_10168555 3300026075 Bacteria 1733
197 Ga0207708_11800657 3300026075 Bacteria 537
198 Ga0207702_10167984 3300026078 Bacteria 2009
199 Ga0207641_11994580 3300026088 Unclassified 582
200 Ga0207648_10036033 3300026089 Bacteria 4359
201 Ga0207648_11729825 3300026089 Bacteria 587
202 Ga0207676_10319131 3300026095 Bacteria 1425
203 Ga0207675_100053601 3300026118 Bacteria 3763
204 Ga0207675_100807767 3300026118 Bacteria 951
205 Ga0207683_10078434 3300026121 Bacteria 2926
206 Ga0207698_12369417 3300026142 Bacteria 542
207 Ga0207428_10511081 3300027907 Bacteria 872
208 Ga0268266_11298954 3300028379 Bacteria 703
209 Ga0268265_10378642 3300028380 Bacteria 1301
210 Ga0268264_10708230 3300028381 Bacteria 1000
211 Ga0268264_10775335 3300028381 Bacteria 957
212 Ga0307405_10699891 3300031731 Bacteria 839
213 Ga0307413_10435273 3300031824 Bacteria 1037
214 Ga0307410_10089597 3300031852 Bacteria 2180
215 Ga0307410_10142302 3300031852 Bacteria 1776
216 Ga0307406_10211800 3300031901 Bacteria 1434
217 Ga0307406_11534711 3300031901 Unclassified 587
218 Ga0307407_10108535 3300031903 Bacteria 1738
219 Ga0307412_10038233 3300031911 Unclassified 3089
220 Ga0307409_100000711 3300031995 Bacteria 14843
221 Ga0307409_101329130 3300031995 Unclassified 744
222 Ga0307416_100013684 3300032002 Bacteria 5523
223 Ga0307416_100064071 3300032002 Bacteria 3014
224 Ga0307416_101044934 3300032002 Bacteria 921
225 Ga0307414_10096744 3300032004 Bacteria 2210
226 Ga0307415_100019528 3300032126 Bacteria 4116
227 Ga0307415_100036488 3300032126 Bacteria 3222
228 Ga0307415_100311755 3300032126 Bacteria 1308
229 Ga0307415_101411195 3300032126 Bacteria 663
230 Ga0307415_101805110 3300032126 Bacteria 592
231 Ga0373926_0321283 3300035083 Unclassified 606
232 Ga0373935_0650250 3300035692 Bacteria 773
233 Ga0373947_0115513 3300035725 Bacteria 1701
234 Ga0373925_0079123 3300037068 Bacteria 2497
235 Ga0395899_0171866 3300037312 Bacteria 1526
236 Ga0395899_0584883 3300037312 Unclassified 713
237 Ga0395900_0019234 3300037418 Bacteria 6964
238 Ga0395900_0488666 3300037418 Bacteria 1183
239 Ga0395900_0737377 3300037418 Bacteria 916
240 Ga0395898_0204498 3300037466 Bacteria 1884
241 Ga0395898_0208730 3300037466 Bacteria 1863
242 Ga0395898_1011104 3300037466 Bacteria 767
243 Ga0395905_0066386 3300037471 Bacteria 3379
244 Ga0395905_1218414 3300037471 Unclassified 656
245 Ga0395901_0096099 3300038443 Bacteria 3105
246 Ga0395901_0191333 3300038443 Bacteria 2146
247 Ga0395901_0194582 3300038443 Bacteria 2126
248 Ga0395901_1558192 3300038443 Bacteria 615
249 Ga0395901_1661366 3300038443 Bacteria 591
250 Ga0451847_1020717 3300041503 Bacteria 775
251 Ga0466967_0967610 3300045976 Bacteria 847
252 Ga0495603_0225673 3300046455 Bacteria 1080
253 Ga0495641_0107622 3300046461 Bacteria 1244
254 Ga0495641_0528253 3300046461 Bacteria 538
255 Ga0495582_0550809 3300046473 Bacteria 667
256 Ga0495584_0264353 3300046491 Bacteria 875
257 Ga0495596_0215679 3300046500 Unclassified 745
258 Ga0495620_0170631 3300046515 Bacteria 844
259 Ga0495643_0273490 3300046522 Bacteria 780
260 Ga0495656_0689366 3300046615 Unclassified 549
261 Ga0495588_0395966 3300046674 Bacteria 725
262 Ga0496100_0262800 3300048903 Bacteria 1280
263 Ga0496101_0537122 3300048904 Bacteria 924
264 Ga0496102_0436909 3300048905 Bacteria 1228
265 Ga0496102_0440179 3300048905 Bacteria 1223
266 Ga0496103_0280132 3300048906 Bacteria 1072
267 Ga0496105_0128085 3300048908 Bacteria 2093
268 Ga0496105_0186829 3300048908 Bacteria 1696
269 Ga0496105_0472655 3300048908 Bacteria 987
270 Ga0496106_0163599 3300048909 Bacteria 1760
271 Ga0496106_0447032 3300048909 Bacteria 1038
272 Ga0496106_0460560 3300048909 Bacteria 1021
273 Ga0496107_0123070 3300048910 Bacteria 1911
274 Ga0496107_0296903 3300048910 Bacteria 1202
275 Ga0496108_0593263 3300048911 Bacteria 965
276 Ga0496109_0161916 3300048912 Bacteria 2096
277 Ga0496109_0619262 3300048912 Bacteria 1019
278 Ga0496109_1498389 3300048912 Bacteria 609
279 Ga0496110_0105892 3300048913 Bacteria 2523
280 Ga0496110_0195439 3300048913 Bacteria 1837
281 Ga0496110_0568679 3300048913 Bacteria 1029
282 Ga0496111_0076682 3300048914 Bacteria 2437
283 Ga0496111_0534592 3300048914 Bacteria 861
284 Ga0496112_0130270 3300048915 Bacteria 2486
285 Ga0496112_0519435 3300048915 Unclassified 1125
286 Ga0496112_0649876 3300048915 Bacteria 984
287 Ga0496113_1167604 3300048916 Bacteria 602
288 Ga0496114_0119959 3300048917 Bacteria 2261
289 Ga0496114_0554319 3300048917 Bacteria 1015
290 Ga0496115_0991883 3300048918 Bacteria 642
291 Ga0501036_0030865 3300049572 Bacteria 4528
292 Ga0501038_0124149 3300049574 Bacteria 2126
293 Ga0501039_0059944 3300049575 Bacteria 2947
294 Ga0501046_0139309 3300049580 Bacteria 1837
295 Ga0501046_0150341 3300049580 Bacteria 1757
296 Ga0501047_0052732 3300049581 Bacteria 3932
297 Ga0501048_0022120 3300049582 Bacteria 4652
298 Ga0501048_0964068 3300049582 Bacteria 613
299 Ga0501069_0209907 3300049585 Bacteria 1130
300 Ga0501070_0208924 3300049586 Bacteria 1603
301 Ga0501071_0056787 3300049587 Bacteria 2828
302 Ga0501071_0672646 3300049587 Unclassified 797
303 Ga0501072_0137026 3300049588 Bacteria 1951
304 Ga0501073_0949017 3300049589 Unclassified 592
305 Ga0501074_0083670 3300049590 Bacteria 2287
306 Ga0501076_1144805 3300049592 Bacteria 640
307 Ga0501257_109889 3300049686 Bacteria 730
308 Ga0501245_120028 3300049708 Bacteria 553
309 Ga0501079_0025680 3300049741 Bacteria 4516
310 Ga0501035_0172802 3300049822 Bacteria 1866
311 Ga0501044_1188853 3300049823 Bacteria 631
312 Ga0501045_0083130 3300049824 Bacteria 2361
313 Ga0501045_0140360 3300049824 Bacteria 1797
314 Ga0501204_090575 3300049850 Unclassified 533
315 nmdc:mga03n38_105899_c1 3300050490 Unclassified 1363
316 nmdc:mga03n38_63094_c1 3300050490 Bacteria 1692
317 nmdc:mga00v17_553331_c1 3300050491 Bacteria 744
318 nmdc:mga0yw44_1037072_c1 3300050492 Bacteria 555
319 nmdc:mga0yw44_164610_c1 3300050492 Bacteria 1453
320 nmdc:mga0yw44_181694_c1 3300050492 Bacteria 1385
321 nmdc:mga0yw44_874580_c1 3300050492 Bacteria 610
322 nmdc:mga07m45_102289_c1 3300050496 Bacteria 1645
323 nmdc:mga08y16_157843_c1 3300050511 Bacteria 2357
324 nmdc:mga08y16_331832_c1 3300050511 Bacteria 1564
325 nmdc:mga0n895_1297852_c1 3300050512 Archaea 699
326 nmdc:mga0a205_624714_c1 3300050515 Bacteria 929
327 Ga0495655_0180168 3300053083 Bacteria 681
328 Ga0501084_0020385 3300054114 Bacteria 5529
329 Ga0501082_0076601 3300060353 Bacteria 2883
330 Ga0075370_10560443
331 JGI24746J21847_1067843
332 JGI24739J22299_10200956
333 JGI24737J22298_10146765
334 JGI24743J22301_10103602
335 JGI24735J21928_10124349
336 JGI24744J21845_10038473
337 JGI25407J50210_10155399
338 Ga0070658_10546818
339 Ga0070676_10505156
340 Ga0070683_100754169
341 Ga0070683_102072293
342 Ga0070690_100131320
343 Ga0068869_100387496
344 Ga0068869_102004808
345 Ga0070666_11161283
346 Ga0070680_100634159
347 Ga0070682_100779117
348 Ga0068868_100061025
349 Ga0070660_100504583
350 Ga0070689_100547555
351 Ga0070687_100330919
352 Ga0070687_101043054
353 Ga0070692_10927312
354 Ga0070668_100153113
355 Ga0070669_100516043
356 Ga0070669_100581980
357 Ga0070675_100134050
358 Ga0070671_100905051
359 Ga0070674_100142256
360 Ga0070674_100836966
361 Ga0070674_100879360
362 Ga0070673_100919498
363 Ga0070688_100131606
364 Ga0070659_100324512
365 Ga0070710_10055615
366 Ga0070701_10365143
367 Ga0070711_100211583
368 Ga0070705_100134044
369 Ga0070700_100498871
370 Ga0070700_100799016
371 Ga0070694_100914794
372 Ga0070663_100564943
373 Ga0070678_100443129
374 Ga0070678_101353207
375 Ga0070662_100476729
376 Ga0070662_100567655
377 Ga0068867_100044467
378 Ga0070685_10307310
379 Ga0070706_100413784
380 Ga0070699_100810626
381 Ga0070684_100143088
382 Ga0068853_100298757
383 Ga0070686_100742383
384 Ga0070695_100095796
385 Ga0070696_100352434
386 Ga0070693_100382047
387 Ga0070665_101542325
388 Ga0070704_100000695
389 Ga0070704_100433857
390 Ga0068855_100602361
391 Ga0070664_100590239
392 Ga0068854_100136142
393 Ga0068854_100926265
394 Ga0068856_101568033
395 Ga0070702_100023186
396 Ga0070702_100271132
397 Ga0070702_100557564
398 Ga0068852_100096582
399 Ga0068852_100330083
400 Ga0068859_100576828
401 Ga0068864_101831852
402 Ga0068866_10017148
403 Ga0068861_100102951
404 Ga0068861_100246022
405 Ga0068861_101785456
406 Ga0068851_10245941
407 Ga0068870_10455848
408 Ga0068858_100334576
409 Ga0068858_102192685
410 Ga0068858_102261127
411 Ga0068860_100231728
412 Ga0068860_101424750
413 Ga0068862_100683893
414 Ga0068862_100922840
415 Ga0081455_10260185
416 Ga0081538_10005221
417 Ga0081539_10034934
418 Ga0075365_10027310
419 Ga0075365_10194509
420 Ga0075365_10850754
421 Ga0075363_100104374
422 Ga0075363_100342637
423 Ga0075363_100420518
424 Ga0075363_100525088
425 Ga0075364_10120392
426 Ga0075432_10127302
427 Ga0070715_10071597
428 Ga0070712_100113046
429 Ga0075367_10227840
430 Ga0097621_101472411
431 Ga0075434_101356475
432 Ga0068865_100284793
433 Ga0068865_100736197
434 Ga0097620_100576823
435 Ga0075435_101818683
436 Ga0111539_10178398
437 Ga0111539_11137080
438 Ga0105245_10108550
439 Ga0105245_10465345
440 Ga0105245_10563207
441 Ga0105245_11526733
442 Ga0105247_10182244
443 Ga0105243_10098673
444 Ga0105243_10215448
445 Ga0105243_11025145
446 Ga0105243_11233284
447 Ga0105241_10367639
448 Ga0105242_10179701
449 Ga0105237_12035534
450 Ga0105238_10984622
451 Ga0105249_10493168
452 Ga0105249_10496769
453 Ga0105249_12168317
454 Ga0105239_10659219
455 Ga0105239_11027548
456 Ga0105246_10269075
457 Ga0105246_10689502
458 Ga0157336_1022161
459 Ga0157335_1007114
460 Ga0157373_11196565
461 Ga0157374_10456520
462 Ga0163162_10137379
463 Ga0157372_10320847
464 Ga0157372_12716945
465 Ga0157375_10238482
466 Ga0182008_10278864
467 Ga0157377_10047671
468 Ga0157379_10483278
469 Ga0157379_10903107
470 Ga0163161_10951979
471 Ga0206353_10981136
472 Ga0207656_10386191
473 Ga0207710_10047466
474 Ga0207688_10019172
475 Ga0207680_11160627
476 Ga0207647_10139030
477 Ga0207645_10120434
478 Ga0207643_10011724
479 Ga0207705_11094922
480 Ga0207654_10559091
481 Ga0207693_10661101
482 Ga0207663_10024808
483 Ga0207660_10904066
484 Ga0207662_10041850
485 Ga0207657_10392725
486 Ga0207652_10411665
487 Ga0207681_10790250
488 Ga0207694_10818560
489 Ga0207659_11008143
490 Ga0207687_10010311
491 Ga0207687_10137983
492 Ga0207644_10741840
493 Ga0207690_10069106
494 Ga0207690_11483770
495 Ga0207686_10273608
496 Ga0207686_11006443
497 Ga0207709_10966415
498 Ga0207709_11515334
499 Ga0207670_10058115
500 Ga0207670_11938511
501 Ga0207669_10085157
502 Ga0207669_10724633
503 Ga0207704_10072241
504 Ga0207704_10269658
505 Ga0207704_11628102
506 Ga0207691_10563927
507 Ga0207691_11383530
508 Ga0207689_10044365
509 Ga0207689_10099103
510 Ga0207689_11519289
511 Ga0207661_10288704
512 Ga0207679_10401267
513 Ga0207679_10529293
514 Ga0207667_10579714
515 Ga0207712_10369776
516 Ga0207668_10738796
517 Ga0207677_10527617
518 Ga0207703_10067574
519 Ga0207703_11217488
520 Ga0207639_10428424
521 Ga0207639_11770308
522 Ga0207678_10424348
523 Ga0207678_10430422
524 Ga0207708_10019178
525 Ga0207708_10168555
526 Ga0207708_11800657
527 Ga0207702_10167984
528 Ga0207641_11994580
529 Ga0207648_10036033
530 Ga0207648_11729825
531 Ga0207676_10319131
532 Ga0207675_100053601
533 Ga0207675_100807767
534 Ga0207683_10078434
535 Ga0207698_12369417
536 Ga0207428_10511081
537 Ga0268266_11298954
538 Ga0268265_10378642
539 Ga0268264_10708230
540 Ga0268264_10775335
541 Ga0307405_10699891
542 Ga0307413_10435273
543 Ga0307410_10089597
544 Ga0307410_10142302
545 Ga0307406_10211800
546 Ga0307406_11534711
547 Ga0307407_10108535
548 Ga0307412_10038233
549 Ga0307409_100000711
550 Ga0307409_101329130
551 Ga0307416_100013684
552 Ga0307416_100064071
553 Ga0307416_101044934
554 Ga0307414_10096744
555 Ga0307415_100019528
556 Ga0307415_100036488
557 Ga0307415_100311755
558 Ga0307415_101411195
559 Ga0307415_101805110
560 Ga0373926_0321283
561 Ga0373935_0650250
562 Ga0373947_0115513
563 Ga0373925_0079123
564 Ga0395899_0171866
565 Ga0395899_0584883
566 Ga0395900_0019234
567 Ga0395900_0488666
568 Ga0395900_0737377
569 Ga0395898_0204498
570 Ga0395898_0208730
571 Ga0395898_1011104
572 Ga0395905_0066386
573 Ga0395905_1218414
574 Ga0395901_0096099
575 Ga0395901_0191333
576 Ga0395901_0194582
577 Ga0395901_1558192
578 Ga0395901_1661366
579 Ga0451847_1020717
580 Ga0466967_0967610
581 Ga0495603_0225673
582 Ga0495641_0107622
583 Ga0495641_0528253
584 Ga0495582_0550809
585 Ga0495584_0264353
586 Ga0495596_0215679
587 Ga0495620_0170631
588 Ga0495643_0273490
589 Ga0495656_0689366
590 Ga0495588_0395966
591 Ga0496100_0262800
592 Ga0496101_0537122
593 Ga0496102_0436909
594 Ga0496102_0440179
595 Ga0496103_0280132
596 Ga0496105_0128085
597 Ga0496105_0186829
598 Ga0496105_0472655
599 Ga0496106_0163599
600 Ga0496106_0447032
601 Ga0496106_0460560
602 Ga0496107_0123070
603 Ga0496107_0296903
604 Ga0496108_0593263
605 Ga0496109_0161916
606 Ga0496109_0619262
607 Ga0496109_1498389
608 Ga0496110_0105892
609 Ga0496110_0195439
610 Ga0496110_0568679
611 Ga0496111_0076682
612 Ga0496111_0534592
613 Ga0496112_0130270
614 Ga0496112_0519435
615 Ga0496112_0649876
616 Ga0496113_1167604
617 Ga0496114_0119959
618 Ga0496114_0554319
619 Ga0496115_0991883
620 Ga0501036_0030865
621 Ga0501038_0124149
622 Ga0501039_0059944
623 Ga0501046_0139309
624 Ga0501046_0150341
625 Ga0501047_0052732
626 Ga0501048_0022120
627 Ga0501048_0964068
628 Ga0501069_0209907
629 Ga0501070_0208924
630 Ga0501071_0056787
631 Ga0501071_0672646
632 Ga0501072_0137026
633 Ga0501073_0949017
634 Ga0501074_0083670
635 Ga0501076_1144805
636 Ga0501257_109889
637 Ga0501245_120028
638 Ga0501079_0025680
639 Ga0501035_0172802
640 Ga0501044_1188853
641 Ga0501045_0083130
642 Ga0501045_0140360
643 Ga0501204_090575
644 nmdc:mga03n38_105899_c1
645 nmdc:mga03n38_63094_c1
646 nmdc:mga00v17_553331_c1
647 nmdc:mga0yw44_1037072_c1
648 nmdc:mga0yw44_164610_c1
649 nmdc:mga0yw44_181694_c1
650 nmdc:mga0yw44_874580_c1
651 nmdc:mga07m45_102289_c1
652 nmdc:mga08y16_157843_c1
653 nmdc:mga08y16_331832_c1
654 nmdc:mga0n895_1297852_c1
655 nmdc:mga0a205_624714_c1
656 Ga0495655_0180168
657 Ga0501084_0020385
658 Ga0501082_0076601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tvz-assembly2.cif.gz_B structure of bacillus subtilis hmob 0.8458 2 68
3tvz-assembly1.cif.gz_A structure of bacillus subtilis hmob 0.7926 2 97
6qne-assembly1.cif.gz_A y102g mutated sulfur oxygenase reductase from acidianus ambivalens 0.7835 2 73
8tdm-assembly1.cif.gz_A cryo-em structure of atmsl10-k539e 0.7736 3 59
1xbw-assembly2.cif.gz_C 1.9a crystal structure of the protein isdg from staphylococcus aureus aureus, structural genomics, mcsg 0.7621 2 102
ID Description Score Start End Superfamily
af_C6KTA2_1_145_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8218 2 72 3.30.70.100
3fgvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7746 1 98 3.30.70.100
3fgvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7671 1 98 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7455 2 99 3.30.70.100
3bm7A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7444 2 99 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4Q5ZJH6-F1-model_v4 deleted 0.983 1 71
AF-A0A536LI84-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9829 1 105
AF-A0A536LI84-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9737 1 105
AF-A0A2P8GVK3-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9735 2 99
AF-A0A7G9L2M8-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9695 2 100

Map