F409582

General Info

Members Datasets Scaffolds Average Seq Length
329 192 658 68

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100841765|Ga0070684_1008417652
Length 78
Sequence VPALRVAAGRLMGALTALHRSLDQELVALLRGASLECLACGEFVMHAQGGNVFCPECGSQLADENALEDGVPLGVQAG

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
50 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.83
Metatranscriptomes 5.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.43
Rhizosphere 97.26
Stem 0
Stem Tuber 0
Unclassified 10.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100841765 3300005535 Bacteria 858
2 Ga0058862_10225718 3300004803 Bacteria 520
3 Ga0070658_10374235 3300005327 Bacteria 1221
4 Ga0070683_100161155 3300005329 Bacteria 2128
5 Ga0070683_100361372 3300005329 Bacteria 1383
6 Ga0070683_100411038 3300005329 Bacteria 1291
7 Ga0070683_101354501 3300005329 Unclassified 684
8 Ga0070683_101830238 3300005329 Unclassified 583
9 Ga0070680_100275310 3300005336 Bacteria 1425
10 Ga0070680_100453478 3300005336 Bacteria 1095
11 Ga0070680_100659352 3300005336 Bacteria 899
12 Ga0070660_100006830 3300005339 Bacteria 7917
13 Ga0070660_100304658 3300005339 Bacteria 1307
14 Ga0070660_100351191 3300005339 Bacteria 1214
15 Ga0070660_101651190 3300005339 Bacteria 545
16 Ga0070661_100514444 3300005344 Bacteria 959
17 Ga0070661_101544520 3300005344 Bacteria 560
18 Ga0070659_100473942 3300005366 Bacteria 1064
19 Ga0070709_10325413 3300005434 Bacteria 1129
20 Ga0070714_100780549 3300005435 Bacteria 924
21 Ga0070713_100377179 3300005436 Bacteria 1321
22 Ga0070713_100941814 3300005436 Unclassified 832
23 Ga0070713_100985819 3300005436 Bacteria 813
24 Ga0070710_10881468 3300005437 Bacteria 645
25 Ga0070711_100663003 3300005439 Bacteria 876
26 Ga0070711_100694120 3300005439 Bacteria 856
27 Ga0070711_101677086 3300005439 Bacteria 557
28 Ga0070708_100828611 3300005445 Bacteria 869
29 Ga0070708_101556156 3300005445 Bacteria 616
30 Ga0070663_100669284 3300005455 Bacteria 880
31 Ga0070663_102103399 3300005455 Bacteria 509
32 Ga0070678_100636611 3300005456 Unclassified 955
33 Ga0070681_10517431 3300005458 Bacteria 1106
34 Ga0070681_11164507 3300005458 Bacteria 692
35 Ga0070681_11979361 3300005458 Unclassified 511
36 Ga0068867_100193935 3300005459 Bacteria 1622
37 Ga0070706_100205864 3300005467 Bacteria 1837
38 Ga0070706_100880456 3300005467 Unclassified 827
39 Ga0070707_100248616 3300005468 Bacteria 1730
40 Ga0070707_100472720 3300005468 Bacteria 1215
41 Ga0070707_101551533 3300005468 Unclassified 629
42 Ga0070698_100244237 3300005471 Bacteria 1728
43 Ga0070698_102034156 3300005471 Bacteria 528
44 Ga0070699_100580026 3300005518 Bacteria 1022
45 Ga0070699_101957431 3300005518 Bacteria 536
46 Ga0070679_100584318 3300005530 Bacteria 1060
47 Ga0070679_100983966 3300005530 Bacteria 787
48 Ga0070679_101369248 3300005530 Bacteria 654
49 Ga0070679_101994015 3300005530 Unclassified 529
50 Ga0070684_100195733 3300005535 Bacteria 1841
51 Ga0070684_100671107 3300005535 Bacteria 965
52 Ga0070684_100738738 3300005535 Bacteria 918
53 Ga0070684_100833985 3300005535 Bacteria 863
54 Ga0068853_101082997 3300005539 Bacteria 772
55 Ga0070695_100555391 3300005545 Bacteria 896
56 Ga0070696_100102292 3300005546 Bacteria 2054
57 Ga0070665_100478405 3300005548 Bacteria 1256
58 Ga0070704_100057435 3300005549 Bacteria 2767
59 Ga0068855_100837537 3300005563 Bacteria 975
60 Ga0068857_100763452 3300005577 Bacteria 921
61 Ga0068854_100138461 3300005578 Bacteria 1865
62 Ga0068854_100925285 3300005578 Bacteria 768
63 Ga0068854_101013256 3300005578 Bacteria 736
64 Ga0068856_100494860 3300005614 Bacteria 1243
65 Ga0068852_100537809 3300005616 Bacteria 1167
66 Ga0068852_101291098 3300005616 Bacteria 752
67 Ga0068852_102003842 3300005616 Bacteria 601
68 Ga0068861_100004687 3300005719 Bacteria 9190
69 Ga0068870_10736506 3300005840 Bacteria 683
70 Ga0068860_102490585 3300005843 Unclassified 537
71 Ga0081455_10044296 3300005937 Bacteria 3884
72 Ga0081538_10282478 3300005981 Bacteria 616
73 Ga0070717_10123015 3300006028 Bacteria 2224
74 Ga0070717_10737332 3300006028 Bacteria 896
75 Ga0070712_100298765 3300006175 Bacteria 1302
76 Ga0070712_101652025 3300006175 Unclassified 561
77 Ga0075433_10168391 3300006852 Bacteria 1950
78 Ga0075434_100811679 3300006871 Bacteria 951
79 Ga0075435_100116186 3300007076 Bacteria 2229
80 Ga0105240_10131489 3300009093 Bacteria 3001
81 Ga0105240_10134295 3300009093 Bacteria 2964
82 Ga0105240_11766180 3300009093 Bacteria 645
83 Ga0105247_11833411 3300009101 Bacteria 506
84 Ga0105241_10269210 3300009174 Bacteria 1451
85 Ga0105241_12022897 3300009174 Bacteria 568
86 Ga0105238_10091823 3300009551 Bacteria 3023
87 Ga0105239_10072533 3300010375 Bacteria 3785
88 Ga0157320_1025140 3300012481 Bacteria 569
89 Ga0157327_1008840 3300012512 Bacteria 912
90 Ga0157373_10102529 3300013100 Bacteria 2013
91 Ga0157370_10086969 3300013104 Bacteria 2936
92 Ga0157370_10733957 3300013104 Bacteria 900
93 Ga0157369_10730274 3300013105 Bacteria 1019
94 Ga0157378_11678409 3300013297 Bacteria 682
95 Ga0157372_10272877 3300013307 Bacteria 1966
96 Ga0157372_11485945 3300013307 Bacteria 781
97 Ga0157372_12279602 3300013307 Bacteria 622
98 Ga0157372_12375025 3300013307 Unclassified 609
99 Ga0157375_12955111 3300013308 Unclassified 568
100 Ga0182008_10121806 3300014497 Bacteria 1297
101 Ga0182008_10763752 3300014497 Bacteria 558
102 Ga0182008_10964220 3300014497 Bacteria 506
103 Ga0206356_10073040 3300020070 Bacteria 562
104 Ga0206356_11482178 3300020070 Bacteria 1051
105 Ga0206356_11766390 3300020070 Bacteria 530
106 Ga0206349_1587513 3300020075 Bacteria 1035
107 Ga0206351_10613080 3300020077 Unclassified 510
108 Ga0206352_10209231 3300020078 Bacteria 1011
109 Ga0206354_10011748 3300020081 Bacteria 843
110 Ga0206354_10697009 3300020081 Bacteria 752
111 Ga0206354_11307900 3300020081 Bacteria 1195
112 Ga0206354_11502104 3300020081 Bacteria 509
113 Ga0206353_10734485 3300020082 Unclassified 561
114 Ga0206353_11310412 3300020082 Bacteria 930
115 Ga0206353_11415739 3300020082 Bacteria 1064
116 Ga0213874_10313440 3300021377 Bacteria 593
117 Ga0224712_10138863 3300022467 Bacteria 1068
118 Ga0207692_10371499 3300025898 Bacteria 886
119 Ga0207692_10618519 3300025898 Bacteria 698
120 Ga0207692_11198715 3300025898 Bacteria 504
121 Ga0207705_10090158 3300025909 Bacteria 2244
122 Ga0207684_10417222 3300025910 Bacteria 1153
123 Ga0207654_10897107 3300025911 Unclassified 643
124 Ga0207707_10004189 3300025912 Bacteria 12772
125 Ga0207695_10745900 3300025913 Bacteria 859
126 Ga0207695_11105088 3300025913 Bacteria 673
127 Ga0207695_11292799 3300025913 Bacteria 610
128 Ga0207671_10263878 3300025914 Bacteria 1356
129 Ga0207663_10019651 3300025916 Bacteria 3812
130 Ga0207663_10101815 3300025916 Bacteria 1931
131 Ga0207663_11541047 3300025916 Bacteria 535
132 Ga0207660_10080107 3300025917 Bacteria 2397
133 Ga0207660_10216018 3300025917 Bacteria 1503
134 Ga0207660_10386458 3300025917 Bacteria 1125
135 Ga0207657_10011098 3300025919 Bacteria 8955
136 Ga0207657_10273780 3300025919 Bacteria 1341
137 Ga0207649_10752886 3300025920 Bacteria 758
138 Ga0207652_10574312 3300025921 Bacteria 1012
139 Ga0207652_11257060 3300025921 Bacteria 643
140 Ga0207694_10249147 3300025924 Bacteria 1453
141 Ga0207700_10645130 3300025928 Bacteria 944
142 Ga0207700_10698284 3300025928 Bacteria 906
143 Ga0207700_10712238 3300025928 Bacteria 896
144 Ga0207700_11067496 3300025928 Bacteria 722
145 Ga0207664_10216786 3300025929 Bacteria 1658
146 Ga0207664_10238173 3300025929 Bacteria 1584
147 Ga0207664_10310612 3300025929 Bacteria 1389
148 Ga0207664_11823915 3300025929 Bacteria 531
149 Ga0207690_10775100 3300025932 Bacteria 792
150 Ga0207706_10010088 3300025933 Bacteria 8651
151 Ga0207709_10416133 3300025935 Unclassified 1031
152 Ga0207661_10406310 3300025944 Bacteria 1235
153 Ga0207661_10797424 3300025944 Bacteria 869
154 Ga0207661_11574851 3300025944 Unclassified 601
155 Ga0207661_11980107 3300025944 Unclassified 528
156 Ga0207667_10206611 3300025949 Bacteria 2013
157 Ga0207667_11081352 3300025949 Bacteria 786
158 Ga0207668_10474804 3300025972 Unclassified 1071
159 Ga0207640_10062299 3300025981 Bacteria 2474
160 Ga0207677_10312169 3300026023 Bacteria 1303
161 Ga0207678_10518378 3300026067 Bacteria 1040
162 Ga0207702_10729426 3300026078 Bacteria 977
163 Ga0207702_12252058 3300026078 Bacteria 533
164 Ga0207674_10572707 3300026116 Bacteria 1091
165 Ga0207675_100000512 3300026118 Bacteria 37635
166 Ga0207698_10086854 3300026142 Bacteria 2545
167 Ga0268266_10210663 3300028379 Bacteria 1782
168 Ga0265337_1185365 3300028556 Bacteria 565
169 Ga0265334_10066778 3300028573 Bacteria 1345
170 Ga0265318_10066182 3300028577 Bacteria 1343
171 Ga0265318_10387523 3300028577 Bacteria 510
172 Ga0265322_10001322 3300028654 Bacteria 8295
173 Ga0265322_10040248 3300028654 Bacteria 1330
174 Ga0265336_10070652 3300028666 Bacteria 1044
175 Ga0265336_10147123 3300028666 Bacteria 701
176 Ga0265338_10014535 3300028800 Bacteria 8748
177 Ga0265338_10037040 3300028800 Bacteria 4652
178 Ga0265330_10123194 3300031235 Bacteria 1104
179 Ga0265330_10197430 3300031235 Bacteria 851
180 Ga0265320_10155166 3300031240 Bacteria 1033
181 Ga0265320_10571292 3300031240 Bacteria 500
182 Ga0265325_10028103 3300031241 Bacteria 3035
183 Ga0265329_10024996 3300031242 Bacteria 1980
184 Ga0265340_10225122 3300031247 Bacteria 840
185 Ga0265339_10035621 3300031249 Bacteria 2791
186 Ga0265327_10116712 3300031251 Bacteria 1269
187 Ga0265316_10021756 3300031344 Bacteria 5423
188 Ga0265313_10034998 3300031595 Bacteria 2533
189 Ga0265314_10003990 3300031711 Bacteria 13955
190 Ga0265342_10048311 3300031712 Bacteria 2552
191 Ga0373924_0124986 3300035410 Bacteria 1118
192 Ga0373924_0384869 3300035410 Bacteria 626
193 Ga0373947_0251068 3300035725 Unclassified 1170
194 Ga0395899_0104045 3300037312 Bacteria 2046
195 Ga0395899_0687387 3300037312 Unclassified 643
196 Ga0395900_0272876 3300037418 Bacteria 1685
197 Ga0395900_0584610 3300037418 Bacteria 1058
198 Ga0395900_0720064 3300037418 Bacteria 930
199 Ga0395898_0066602 3300037466 Bacteria 3488
200 Ga0395898_1049590 3300037466 Bacteria 749
201 Ga0395905_0003398 3300037471 Bacteria 17046
202 Ga0395905_0540907 3300037471 Bacteria 1066
203 Ga0395905_0556447 3300037471 Bacteria 1048
204 Ga0395901_0005189 3300038443 Bacteria 13146
205 Ga0395901_0442710 3300038443 Bacteria 1330
206 Ga0395901_0445997 3300038443 Bacteria 1324
207 Ga0395901_0605970 3300038443 Bacteria 1104
208 Ga0395901_1268818 3300038443 Bacteria 700
209 Ga0466963_0305620 3300044694 Bacteria 1119
210 Ga0466963_0773900 3300044694 Bacteria 677
211 Ga0466963_1285239 3300044694 Bacteria 514
212 Ga0466963_1338686 3300044694 Bacteria 502
213 Ga0466963_1350178 3300044694 Bacteria 500
214 Ga0466971_0182812 3300044719 Bacteria 986
215 Ga0466968_0087963 3300044735 Bacteria 1373
216 Ga0466957_0936148 3300044842 Unclassified 620
217 Ga0466957_0976426 3300044842 Bacteria 608
218 Ga0466960_0205593 3300044901 Bacteria 1078
219 Ga0466959_0079355 3300045049 Bacteria 2367
220 Ga0466959_0503874 3300045049 Bacteria 818
221 Ga0466958_0390336 3300045836 Bacteria 898
222 Ga0466967_0163544 3300045976 Bacteria 2090
223 Ga0466967_0280556 3300045976 Bacteria 1598
224 Ga0466967_0792897 3300045976 Bacteria 940
225 Ga0466967_1337847 3300045976 Bacteria 713
226 Ga0466967_2381856 3300045976 Bacteria 525
227 Ga0495592_0114167 3300046454 Bacteria 1908
228 Ga0495592_0178534 3300046454 Bacteria 1448
229 Ga0495603_0560072 3300046455 Unclassified 654
230 Ga0495629_0188400 3300046459 Bacteria 1428
231 Ga0495629_0209373 3300046459 Bacteria 1347
232 Ga0495629_0521781 3300046459 Unclassified 799
233 Ga0495651_0038386 3300046462 Bacteria 3729
234 Ga0495651_0324475 3300046462 Bacteria 1025
235 Ga0495653_0036071 3300046463 Bacteria 3898
236 Ga0495653_0273182 3300046463 Bacteria 1112
237 Ga0495582_0494220 3300046473 Unclassified 707
238 Ga0495639_0201466 3300046475 Bacteria 974
239 Ga0495662_0105367 3300046476 Bacteria 1380
240 Ga0495664_0094743 3300046477 Bacteria 1797
241 Ga0495664_0313817 3300046477 Unclassified 946
242 Ga0495594_0057797 3300046499 Bacteria 2142
243 Ga0495594_0659139 3300046499 Unclassified 592
244 Ga0495607_0138896 3300046501 Bacteria 1256
245 Ga0495608_0015441 3300046511 Bacteria 5296
246 Ga0495608_0934814 3300046511 Bacteria 506
247 Ga0495618_0374914 3300046514 Unclassified 874
248 Ga0495618_0441770 3300046514 Bacteria 790
249 Ga0495628_0078059 3300046516 Bacteria 2575
250 Ga0495628_0174936 3300046516 Bacteria 1626
251 Ga0495630_0000487 3300046517 Bacteria 29460
252 Ga0495630_0026700 3300046517 Bacteria 4278
253 Ga0495666_0074338 3300046526 Bacteria 1612
254 Ga0495652_0269549 3300046529 Bacteria 1252
255 Ga0495652_0881803 3300046529 Bacteria 591
256 Ga0495652_0998744 3300046529 Bacteria 547
257 Ga0495640_0012100 3300046533 Bacteria 6609
258 Ga0495586_0020783 3300046535 Bacteria 3497
259 Ga0495586_0655884 3300046535 Bacteria 606
260 Ga0495587_0241248 3300046536 Bacteria 1017
261 Ga0495587_0500330 3300046536 Bacteria 672
262 Ga0495622_0255639 3300046557 Bacteria 770
263 Ga0495667_0006264 3300046559 Bacteria 8067
264 Ga0495667_0128940 3300046559 Bacteria 1632
265 Ga0495634_0044273 3300046642 Bacteria 3013
266 Ga0495634_0068432 3300046642 Bacteria 2346
267 Ga0495635_0181619 3300046663 Bacteria 1430
268 Ga0495657_0702954 3300046675 Bacteria 581
269 Ga0495599_0270356 3300046678 Bacteria 1031
270 Ga0495599_0427317 3300046678 Bacteria 786
271 Ga0495623_0526572 3300046679 Bacteria 621
272 Ga0495646_0109397 3300046680 Bacteria 1575
273 Ga0495646_0406374 3300046680 Bacteria 707
274 Ga0495658_0048295 3300046683 Bacteria 2399
275 Ga0495658_0971886 3300046683 Bacteria 542
276 Ga0495613_0061524 3300046689 Bacteria 2749
277 Ga0495613_0293510 3300046689 Bacteria 1126
278 Ga0495624_0205293 3300046690 Bacteria 1196
279 Ga0495604_0016554 3300047317 Bacteria 5895
280 Ga0495604_0419502 3300047317 Bacteria 879
281 Ga0495674_0008409 3300047319 Bacteria 9832
282 Ga0495674_0107946 3300047319 Bacteria 2362
283 Ga0495674_0423401 3300047319 Bacteria 1072
284 Ga0495674_0497350 3300047319 Bacteria 975
285 Ga0495680_0044308 3300047322 Bacteria 3518
286 Ga0495680_0392231 3300047322 Unclassified 960
287 Ga0495680_0413160 3300047322 Unclassified 929
288 Ga0495675_0715550 3300047444 Bacteria 560
289 Ga0495684_0025474 3300047471 Bacteria 4546
290 Ga0495684_0627860 3300047471 Bacteria 721
291 Ga0495593_0585006 3300047673 Bacteria 560
292 Ga0495602_0940028 3300048088 Unclassified 573
293 Ga0496105_1052948 3300048908 Bacteria 606
294 Ga0496109_1067378 3300048912 Bacteria 745
295 Ga0496111_1183085 3300048914 Bacteria 542
296 Ga0496112_0137486 3300048915 Bacteria 2413
297 Ga0496112_0631964 3300048915 Bacteria 1001
298 Ga0496112_0751456 3300048915 Bacteria 901
299 Ga0496115_0045342 3300048918 Bacteria 3509
300 Ga0496115_0178495 3300048918 Bacteria 1756
301 Ga0501033_0223720 3300049570 Bacteria 1339
302 Ga0501039_0419318 3300049575 Bacteria 1051
303 Ga0501040_0988712 3300049576 Bacteria 610
304 Ga0501042_0429009 3300049578 Bacteria 958
305 Ga0501046_0457736 3300049580 Bacteria 917
306 Ga0501048_0342817 3300049582 Bacteria 1065
307 Ga0501069_0309955 3300049585 Bacteria 926
308 Ga0501069_0372323 3300049585 Bacteria 843
309 Ga0501070_0001858 3300049586 Bacteria 18636
310 Ga0501071_0070626 3300049587 Bacteria 2544
311 Ga0501072_0024969 3300049588 Bacteria 4653
312 Ga0501074_0092614 3300049590 Bacteria 2164
313 Ga0501075_0179737 3300049591 Bacteria 1614
314 Ga0501076_0049696 3300049592 Bacteria 3317
315 Ga0501079_0814561 3300049741 Bacteria 735
316 Ga0501080_0557274 3300049742 Bacteria 1020
317 Ga0501080_1244105 3300049742 Bacteria 639
318 Ga0501044_1369274 3300049823 Bacteria 573
319 Ga0501045_0138452 3300049824 Bacteria 1810
320 Ga0495601_0152337 3300053077 Bacteria 1509
321 Ga0495601_0200100 3300053077 Bacteria 1305
322 Ga0495601_0882997 3300053077 Unclassified 565
323 Ga0495595_0183850 3300053084 Viruses 1037
324 Ga0495619_0231436 3300053085 Bacteria 1280
325 Ga0495619_0359710 3300053085 Unclassified 1006
326 Ga0495619_0565039 3300053085 Unclassified 780
327 Ga0587115_034398 3300059626 Bacteria 767
328 Ga0587071_118365 3300060344 Bacteria 630
329 Ga0501082_0266735 3300060353 Bacteria 1490
330 Ga0070684_100841765
331 Ga0058862_10225718
332 Ga0070658_10374235
333 Ga0070683_100161155
334 Ga0070683_100361372
335 Ga0070683_100411038
336 Ga0070683_101354501
337 Ga0070683_101830238
338 Ga0070680_100275310
339 Ga0070680_100453478
340 Ga0070680_100659352
341 Ga0070660_100006830
342 Ga0070660_100304658
343 Ga0070660_100351191
344 Ga0070660_101651190
345 Ga0070661_100514444
346 Ga0070661_101544520
347 Ga0070659_100473942
348 Ga0070709_10325413
349 Ga0070714_100780549
350 Ga0070713_100377179
351 Ga0070713_100941814
352 Ga0070713_100985819
353 Ga0070710_10881468
354 Ga0070711_100663003
355 Ga0070711_100694120
356 Ga0070711_101677086
357 Ga0070708_100828611
358 Ga0070708_101556156
359 Ga0070663_100669284
360 Ga0070663_102103399
361 Ga0070678_100636611
362 Ga0070681_10517431
363 Ga0070681_11164507
364 Ga0070681_11979361
365 Ga0068867_100193935
366 Ga0070706_100205864
367 Ga0070706_100880456
368 Ga0070707_100248616
369 Ga0070707_100472720
370 Ga0070707_101551533
371 Ga0070698_100244237
372 Ga0070698_102034156
373 Ga0070699_100580026
374 Ga0070699_101957431
375 Ga0070679_100584318
376 Ga0070679_100983966
377 Ga0070679_101369248
378 Ga0070679_101994015
379 Ga0070684_100195733
380 Ga0070684_100671107
381 Ga0070684_100738738
382 Ga0070684_100833985
383 Ga0068853_101082997
384 Ga0070695_100555391
385 Ga0070696_100102292
386 Ga0070665_100478405
387 Ga0070704_100057435
388 Ga0068855_100837537
389 Ga0068857_100763452
390 Ga0068854_100138461
391 Ga0068854_100925285
392 Ga0068854_101013256
393 Ga0068856_100494860
394 Ga0068852_100537809
395 Ga0068852_101291098
396 Ga0068852_102003842
397 Ga0068861_100004687
398 Ga0068870_10736506
399 Ga0068860_102490585
400 Ga0081455_10044296
401 Ga0081538_10282478
402 Ga0070717_10123015
403 Ga0070717_10737332
404 Ga0070712_100298765
405 Ga0070712_101652025
406 Ga0075433_10168391
407 Ga0075434_100811679
408 Ga0075435_100116186
409 Ga0105240_10131489
410 Ga0105240_10134295
411 Ga0105240_11766180
412 Ga0105247_11833411
413 Ga0105241_10269210
414 Ga0105241_12022897
415 Ga0105238_10091823
416 Ga0105239_10072533
417 Ga0157320_1025140
418 Ga0157327_1008840
419 Ga0157373_10102529
420 Ga0157370_10086969
421 Ga0157370_10733957
422 Ga0157369_10730274
423 Ga0157378_11678409
424 Ga0157372_10272877
425 Ga0157372_11485945
426 Ga0157372_12279602
427 Ga0157372_12375025
428 Ga0157375_12955111
429 Ga0182008_10121806
430 Ga0182008_10763752
431 Ga0182008_10964220
432 Ga0206356_10073040
433 Ga0206356_11482178
434 Ga0206356_11766390
435 Ga0206349_1587513
436 Ga0206351_10613080
437 Ga0206352_10209231
438 Ga0206354_10011748
439 Ga0206354_10697009
440 Ga0206354_11307900
441 Ga0206354_11502104
442 Ga0206353_10734485
443 Ga0206353_11310412
444 Ga0206353_11415739
445 Ga0213874_10313440
446 Ga0224712_10138863
447 Ga0207692_10371499
448 Ga0207692_10618519
449 Ga0207692_11198715
450 Ga0207705_10090158
451 Ga0207684_10417222
452 Ga0207654_10897107
453 Ga0207707_10004189
454 Ga0207695_10745900
455 Ga0207695_11105088
456 Ga0207695_11292799
457 Ga0207671_10263878
458 Ga0207663_10019651
459 Ga0207663_10101815
460 Ga0207663_11541047
461 Ga0207660_10080107
462 Ga0207660_10216018
463 Ga0207660_10386458
464 Ga0207657_10011098
465 Ga0207657_10273780
466 Ga0207649_10752886
467 Ga0207652_10574312
468 Ga0207652_11257060
469 Ga0207694_10249147
470 Ga0207700_10645130
471 Ga0207700_10698284
472 Ga0207700_10712238
473 Ga0207700_11067496
474 Ga0207664_10216786
475 Ga0207664_10238173
476 Ga0207664_10310612
477 Ga0207664_11823915
478 Ga0207690_10775100
479 Ga0207706_10010088
480 Ga0207709_10416133
481 Ga0207661_10406310
482 Ga0207661_10797424
483 Ga0207661_11574851
484 Ga0207661_11980107
485 Ga0207667_10206611
486 Ga0207667_11081352
487 Ga0207668_10474804
488 Ga0207640_10062299
489 Ga0207677_10312169
490 Ga0207678_10518378
491 Ga0207702_10729426
492 Ga0207702_12252058
493 Ga0207674_10572707
494 Ga0207675_100000512
495 Ga0207698_10086854
496 Ga0268266_10210663
497 Ga0265337_1185365
498 Ga0265334_10066778
499 Ga0265318_10066182
500 Ga0265318_10387523
501 Ga0265322_10001322
502 Ga0265322_10040248
503 Ga0265336_10070652
504 Ga0265336_10147123
505 Ga0265338_10014535
506 Ga0265338_10037040
507 Ga0265330_10123194
508 Ga0265330_10197430
509 Ga0265320_10155166
510 Ga0265320_10571292
511 Ga0265325_10028103
512 Ga0265329_10024996
513 Ga0265340_10225122
514 Ga0265339_10035621
515 Ga0265327_10116712
516 Ga0265316_10021756
517 Ga0265313_10034998
518 Ga0265314_10003990
519 Ga0265342_10048311
520 Ga0373924_0124986
521 Ga0373924_0384869
522 Ga0373947_0251068
523 Ga0395899_0104045
524 Ga0395899_0687387
525 Ga0395900_0272876
526 Ga0395900_0584610
527 Ga0395900_0720064
528 Ga0395898_0066602
529 Ga0395898_1049590
530 Ga0395905_0003398
531 Ga0395905_0540907
532 Ga0395905_0556447
533 Ga0395901_0005189
534 Ga0395901_0442710
535 Ga0395901_0445997
536 Ga0395901_0605970
537 Ga0395901_1268818
538 Ga0466963_0305620
539 Ga0466963_0773900
540 Ga0466963_1285239
541 Ga0466963_1338686
542 Ga0466963_1350178
543 Ga0466971_0182812
544 Ga0466968_0087963
545 Ga0466957_0936148
546 Ga0466957_0976426
547 Ga0466960_0205593
548 Ga0466959_0079355
549 Ga0466959_0503874
550 Ga0466958_0390336
551 Ga0466967_0163544
552 Ga0466967_0280556
553 Ga0466967_0792897
554 Ga0466967_1337847
555 Ga0466967_2381856
556 Ga0495592_0114167
557 Ga0495592_0178534
558 Ga0495603_0560072
559 Ga0495629_0188400
560 Ga0495629_0209373
561 Ga0495629_0521781
562 Ga0495651_0038386
563 Ga0495651_0324475
564 Ga0495653_0036071
565 Ga0495653_0273182
566 Ga0495582_0494220
567 Ga0495639_0201466
568 Ga0495662_0105367
569 Ga0495664_0094743
570 Ga0495664_0313817
571 Ga0495594_0057797
572 Ga0495594_0659139
573 Ga0495607_0138896
574 Ga0495608_0015441
575 Ga0495608_0934814
576 Ga0495618_0374914
577 Ga0495618_0441770
578 Ga0495628_0078059
579 Ga0495628_0174936
580 Ga0495630_0000487
581 Ga0495630_0026700
582 Ga0495666_0074338
583 Ga0495652_0269549
584 Ga0495652_0881803
585 Ga0495652_0998744
586 Ga0495640_0012100
587 Ga0495586_0020783
588 Ga0495586_0655884
589 Ga0495587_0241248
590 Ga0495587_0500330
591 Ga0495622_0255639
592 Ga0495667_0006264
593 Ga0495667_0128940
594 Ga0495634_0044273
595 Ga0495634_0068432
596 Ga0495635_0181619
597 Ga0495657_0702954
598 Ga0495599_0270356
599 Ga0495599_0427317
600 Ga0495623_0526572
601 Ga0495646_0109397
602 Ga0495646_0406374
603 Ga0495658_0048295
604 Ga0495658_0971886
605 Ga0495613_0061524
606 Ga0495613_0293510
607 Ga0495624_0205293
608 Ga0495604_0016554
609 Ga0495604_0419502
610 Ga0495674_0008409
611 Ga0495674_0107946
612 Ga0495674_0423401
613 Ga0495674_0497350
614 Ga0495680_0044308
615 Ga0495680_0392231
616 Ga0495680_0413160
617 Ga0495675_0715550
618 Ga0495684_0025474
619 Ga0495684_0627860
620 Ga0495593_0585006
621 Ga0495602_0940028
622 Ga0496105_1052948
623 Ga0496109_1067378
624 Ga0496111_1183085
625 Ga0496112_0137486
626 Ga0496112_0631964
627 Ga0496112_0751456
628 Ga0496115_0045342
629 Ga0496115_0178495
630 Ga0501033_0223720
631 Ga0501039_0419318
632 Ga0501040_0988712
633 Ga0501042_0429009
634 Ga0501046_0457736
635 Ga0501048_0342817
636 Ga0501069_0309955
637 Ga0501069_0372323
638 Ga0501070_0001858
639 Ga0501071_0070626
640 Ga0501072_0024969
641 Ga0501074_0092614
642 Ga0501075_0179737
643 Ga0501076_0049696
644 Ga0501079_0814561
645 Ga0501080_0557274
646 Ga0501080_1244105
647 Ga0501044_1369274
648 Ga0501045_0138452
649 Ga0495601_0152337
650 Ga0495601_0200100
651 Ga0495601_0882997
652 Ga0495595_0183850
653 Ga0495619_0231436
654 Ga0495619_0359710
655 Ga0495619_0565039
656 Ga0587115_034398
657 Ga0587071_118365
658 Ga0501082_0266735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map