F409428

General Info

Members Datasets Scaffolds Average Seq Length
328 178 656 223

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0168001|Ga0501067_0168001_162_944
Length 260
Sequence VTDETRNGHAAPHAAIGNENARQADETSAATPAPTAATASIGLTEASLEALLFVAERPLTRREIATLAGVDRDTVDQLLGDLEVSLRERGIQLLVSGDRVELTTSAEGGPLIARYVGADAIRLSPAALETLAIVAYRQPVTKAAIERIRGVDSDYTIRALMHRRLVVELGRADAPGRPFLYGTGFDFLERFAMSSLEELPPLDVDVAARIAEEGGSATQEAVADEATMHGAGESGAQESPDERPLVGFPIAEAEPSRDDG

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 10.06
Rhizosphere 89.63
Stem 0
Stem Tuber 0
Unclassified 10.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0168001 3300049583 Bacteria 1222
2 Ga0070683_100307394 3300005329 Bacteria 1508
3 Ga0070683_100601822 3300005329 Unclassified 1052
4 Ga0070690_100037290 3300005330 Bacteria 3063
5 Ga0070690_100498310 3300005330 Unclassified 911
6 Ga0070670_100087288 3300005331 Bacteria 2681
7 Ga0068869_100162783 3300005334 Unclassified 1738
8 Ga0070680_100064421 3300005336 Bacteria 3004
9 Ga0070682_100084932 3300005337 Bacteria 2058
10 Ga0068868_100048766 3300005338 Bacteria 3322
11 Ga0070689_100169461 3300005340 Unclassified 1769
12 Ga0070687_100002225 3300005343 Bacteria 7192
13 Ga0070687_100145127 3300005343 Unclassified 1386
14 Ga0070687_100573735 3300005343 Bacteria 771
15 Ga0070661_100072083 3300005344 Unclassified 2542
16 Ga0070669_100026835 3300005353 Bacteria 4145
17 Ga0070675_100048577 3300005354 Bacteria 3480
18 Ga0070671_100134095 3300005355 Unclassified 2087
19 Ga0070673_100018140 3300005364 Bacteria 5023
20 Ga0070673_100351030 3300005364 Bacteria 1309
21 Ga0070688_100005335 3300005365 Bacteria 6757
22 Ga0070659_100021492 3300005366 Bacteria 4915
23 Ga0070667_100146753 3300005367 Bacteria 2070
24 Ga0070703_10015652 3300005406 Bacteria 2172
25 Ga0070710_10270407 3300005437 Bacteria 1099
26 Ga0070705_100005730 3300005440 Bacteria 6066
27 Ga0070705_100048088 3300005440 Bacteria 2469
28 Ga0070705_100151187 3300005440 Bacteria 1540
29 Ga0070705_100238683 3300005440 Bacteria 1269
30 Ga0070700_100040248 3300005441 Bacteria 2860
31 Ga0070700_100319611 3300005441 Bacteria 1140
32 Ga0070708_100035398 3300005445 Bacteria 4350
33 Ga0070708_100235013 3300005445 Bacteria 1720
34 Ga0070708_100399556 3300005445 Bacteria 1296
35 Ga0070663_100197198 3300005455 Unclassified 1569
36 Ga0070678_100095957 3300005456 Bacteria 2286
37 Ga0068867_100028277 3300005459 Bacteria 4036
38 Ga0070685_10029292 3300005466 Bacteria 3057
39 Ga0070706_100052473 3300005467 Bacteria 3763
40 Ga0070706_100141517 3300005467 Bacteria 2245
41 Ga0070706_100152418 3300005467 Bacteria 2158
42 Ga0070707_100001515 3300005468 Bacteria 22648
43 Ga0070707_100018801 3300005468 Bacteria 6505
44 Ga0070707_100153629 3300005468 Bacteria 2241
45 Ga0070707_100535902 3300005468 Bacteria 1133
46 Ga0070698_100017324 3300005471 Bacteria 7592
47 Ga0070698_100034245 3300005471 Bacteria 5260
48 Ga0070698_100813095 3300005471 Bacteria 879
49 Ga0070699_100001116 3300005518 Bacteria 25013
50 Ga0070699_100005074 3300005518 Bacteria 11591
51 Ga0070699_100022160 3300005518 Bacteria 5473
52 Ga0070699_100161311 3300005518 Bacteria 1984
53 Ga0070699_100353122 3300005518 Bacteria 1325
54 Ga0070699_100783935 3300005518 Bacteria 872
55 Ga0070684_100460703 3300005535 Bacteria 1175
56 Ga0070697_100030489 3300005536 Bacteria 4333
57 Ga0070697_100059832 3300005536 Bacteria 3103
58 Ga0068853_100310307 3300005539 Bacteria 1460
59 Ga0070695_100004556 3300005545 Bacteria 8138
60 Ga0070695_100019692 3300005545 Bacteria 4113
61 Ga0070695_100264482 3300005545 Bacteria 1257
62 Ga0070695_100382127 3300005545 Unclassified 1063
63 Ga0070696_100031130 3300005546 Bacteria 3655
64 Ga0070696_100041697 3300005546 Bacteria 3171
65 Ga0070696_100072227 3300005546 Bacteria 2430
66 Ga0070704_100016435 3300005549 Bacteria 4676
67 Ga0070704_100108617 3300005549 Bacteria 2107
68 Ga0070704_100156195 3300005549 Bacteria 1799
69 Ga0070704_100316852 3300005549 Bacteria 1305
70 Ga0070704_100441024 3300005549 Bacteria 1119
71 Ga0068855_100990519 3300005563 Bacteria 884
72 Ga0068857_100360977 3300005577 Bacteria 1346
73 Ga0068854_100280389 3300005578 Bacteria 1342
74 Ga0068854_100791644 3300005578 Bacteria 826
75 Ga0070702_100013086 3300005615 Bacteria 4180
76 Ga0068859_100034108 3300005617 Bacteria 5109
77 Ga0068864_100030193 3300005618 Bacteria 4594
78 Ga0068864_100609953 3300005618 Bacteria 1060
79 Ga0068870_10005772 3300005840 Bacteria 5427
80 Ga0068863_100574770 3300005841 Bacteria 1114
81 Ga0068858_100235767 3300005842 Bacteria 1735
82 Ga0068860_100231074 3300005843 Bacteria 1797
83 Ga0068860_100300238 3300005843 Bacteria 1573
84 Ga0068862_100471896 3300005844 Unclassified 1186
85 Ga0081539_10013133 3300005985 Bacteria 6277
86 Ga0075428_100056549 3300006844 Bacteria 4297
87 Ga0075428_100299548 3300006844 Unclassified 1729
88 Ga0075433_10165413 3300006852 Bacteria 1969
89 Ga0075433_10166052 3300006852 Bacteria 1965
90 Ga0075433_10256507 3300006852 Bacteria 1551
91 Ga0075433_10494045 3300006852 Bacteria 1077
92 Ga0075434_100212615 3300006871 Bacteria 1954
93 Ga0075434_100439264 3300006871 Bacteria 1326
94 Ga0075429_100280728 3300006880 Bacteria 1459
95 Ga0068865_100010204 3300006881 Bacteria 5839
96 Ga0068865_100063278 3300006881 Bacteria 2600
97 Ga0097620_100034107 3300006931 Bacteria 5109
98 Ga0075435_100019827 3300007076 Bacteria 5144
99 Ga0111539_10023213 3300009094 Bacteria 7619
100 Ga0111539_10118122 3300009094 Bacteria 3108
101 Ga0111539_10430094 3300009094 Bacteria 1537
102 Ga0111539_11818865 3300009094 Unclassified 706
103 Ga0105245_10005398 3300009098 Bacteria 11233
104 Ga0105245_10136743 3300009098 Bacteria 2304
105 Ga0105245_10257253 3300009098 Bacteria 1698
106 Ga0105247_10242463 3300009101 Bacteria 1229
107 Ga0114129_10000135 3300009147 Bacteria 76177
108 Ga0114129_10286438 3300009147 Unclassified 2200
109 Ga0114129_10509551 3300009147 Bacteria 1570
110 Ga0105243_10013599 3300009148 Bacteria 6156
111 Ga0105243_10322963 3300009148 Bacteria 1407
112 Ga0105243_10429426 3300009148 Bacteria 1234
113 Ga0105243_11008549 3300009148 Bacteria 836
114 Ga0105242_10063109 3300009176 Bacteria 3051
115 Ga0105238_10215522 3300009551 Unclassified 1896
116 Ga0105239_10015283 3300010375 Bacteria 8506
117 Ga0157373_10627603 3300013100 Bacteria 784
118 Ga0157378_10022198 3300013297 Bacteria 5586
119 Ga0157378_10058560 3300013297 Bacteria 3436
120 Ga0163162_10875722 3300013306 Unclassified 1012
121 Ga0157372_11126763 3300013307 Bacteria 907
122 Ga0157375_10080494 3300013308 Bacteria 3296
123 Ga0163163_10034076 3300014325 Bacteria 4929
124 Ga0157380_10068230 3300014326 Bacteria 2866
125 Ga0157380_10145939 3300014326 Bacteria 2039
126 Ga0157380_10239928 3300014326 Bacteria 1633
127 Ga0157377_10089095 3300014745 Unclassified 1818
128 Ga0157377_10115866 3300014745 Bacteria 1617
129 Ga0157379_10027858 3300014968 Bacteria 5029
130 Ga0157379_10057584 3300014968 Bacteria 3473
131 Ga0207653_10006297 3300025885 Bacteria 3702
132 Ga0207643_10004916 3300025908 Bacteria 7147
133 Ga0207684_10017257 3300025910 Bacteria 6193
134 Ga0207684_10022853 3300025910 Bacteria 5340
135 Ga0207684_10087310 3300025910 Bacteria 2657
136 Ga0207684_10127057 3300025910 Bacteria 2188
137 Ga0207684_10512269 3300025910 Bacteria 1028
138 Ga0207707_10157003 3300025912 Bacteria 1989
139 Ga0207660_10000001 3300025917 Bacteria 1034169
140 Ga0207660_10313142 3300025917 Bacteria 1252
141 Ga0207662_10001171 3300025918 Bacteria 12450
142 Ga0207657_10060394 3300025919 Bacteria 3253
143 Ga0207649_10080626 3300025920 Unclassified 2105
144 Ga0207652_10191886 3300025921 Bacteria 1838
145 Ga0207646_10002816 3300025922 Bacteria 20240
146 Ga0207646_10696354 3300025922 Bacteria 909
147 Ga0207650_10058385 3300025925 Bacteria 2873
148 Ga0207659_10059120 3300025926 Bacteria 2754
149 Ga0207690_10008669 3300025932 Bacteria 6031
150 Ga0207706_10010482 3300025933 Bacteria 8469
151 Ga0207706_10103040 3300025933 Unclassified 2511
152 Ga0207686_10074571 3300025934 Bacteria 2193
153 Ga0207709_10035823 3300025935 Unclassified 2937
154 Ga0207709_10166741 3300025935 Bacteria 1542
155 Ga0207709_10518324 3300025935 Bacteria 933
156 Ga0207669_10096684 3300025937 Bacteria 1939
157 Ga0207665_10175659 3300025939 Bacteria 1549
158 Ga0207689_10164472 3300025942 Bacteria 1828
159 Ga0207689_10180050 3300025942 Unclassified 1743
160 Ga0207661_10284329 3300025944 Bacteria 1479
161 Ga0207679_10443392 3300025945 Unclassified 1150
162 Ga0207651_10664559 3300025960 Bacteria 915
163 Ga0207651_10709720 3300025960 Bacteria 887
164 Ga0207712_10233693 3300025961 Bacteria 1477
165 Ga0207640_10135595 3300025981 Bacteria 1786
166 Ga0207640_10270161 3300025981 Bacteria 1330
167 Ga0207640_10290368 3300025981 Bacteria 1289
168 Ga0207677_10173068 3300026023 Unclassified 1690
169 Ga0207703_10309714 3300026035 Bacteria 1443
170 Ga0207703_10345437 3300026035 Bacteria 1369
171 Ga0207639_10346971 3300026041 Bacteria 1325
172 Ga0207678_10083007 3300026067 Bacteria 2741
173 Ga0207708_10016937 3300026075 Bacteria 5487
174 Ga0207708_10102677 3300026075 Bacteria 2214
175 Ga0207641_10603623 3300026088 Bacteria 1075
176 Ga0207648_10002379 3300026089 Bacteria 20244
177 Ga0207676_10026582 3300026095 Bacteria 4305
178 Ga0207676_10099705 3300026095 Unclassified 2405
179 Ga0207676_10249190 3300026095 Bacteria 1598
180 Ga0207674_10031496 3300026116 Bacteria 5571
181 Ga0207675_100013788 3300026118 Bacteria 7539
182 Ga0207675_100482760 3300026118 Unclassified 1232
183 Ga0207675_100683338 3300026118 Bacteria 1034
184 Ga0207683_10097004 3300026121 Bacteria 2629
185 Ga0207683_10515454 3300026121 Bacteria 1105
186 Ga0207428_10376496 3300027907 Unclassified 1042
187 Ga0268264_10284078 3300028381 Bacteria 1551
188 Ga0268264_10724488 3300028381 Unclassified 989
189 Ga0265326_10015662 3300028558 Bacteria 2196
190 Ga0265319_1022310 3300028563 Bacteria 2309
191 Ga0265323_10100796 3300028653 Unclassified 956
192 Ga0265336_10102072 3300028666 Bacteria 855
193 Ga0265329_10005481 3300031242 Bacteria 5124
194 Ga0265316_10022427 3300031344 Bacteria 5323
195 Ga0307408_100125937 3300031548 Bacteria 1992
196 Ga0265342_10011464 3300031712 Bacteria 6067
197 Ga0307405_10132206 3300031731 Bacteria 1726
198 Ga0307413_10138056 3300031824 Bacteria 1680
199 Ga0307413_10195798 3300031824 Bacteria 1455
200 Ga0307409_100690750 3300031995 Bacteria 1019
201 Ga0307409_100948097 3300031995 Bacteria 876
202 Ga0307416_100002026 3300032002 Bacteria 11394
203 Ga0373931_0038999 3300035691 Bacteria 2488
204 Ga0395901_0305770 3300038443 Bacteria 1648
205 Ga0450910_001927 3300042147 Bacteria 2686
206 Ga0450910_005954 3300042147 Bacteria 1673
207 Ga0495628_0143714 3300046516 Bacteria 1820
208 Ga0495628_0422214 3300046516 Bacteria 972
209 Ga0495630_0265608 3300046517 Bacteria 1311
210 Ga0495656_0108715 3300046615 Bacteria 1293
211 Ga0495674_0544784 3300047319 Bacteria 924
212 Ga0496100_0109474 3300048903 Bacteria 1917
213 Ga0496101_0165796 3300048904 Unclassified 1696
214 Ga0496101_0370032 3300048904 Bacteria 1127
215 Ga0496102_0387550 3300048905 Bacteria 1315
216 Ga0496103_0012635 3300048906 Bacteria 5009
217 Ga0496103_0041828 3300048906 Bacteria 2818
218 Ga0496103_0141879 3300048906 Bacteria 1537
219 Ga0496105_0088800 3300048908 Bacteria 2554
220 Ga0496105_0148376 3300048908 Bacteria 1928
221 Ga0496106_0054949 3300048909 Bacteria 3009
222 Ga0496106_0101211 3300048909 Unclassified 2235
223 Ga0496108_0233097 3300048911 Bacteria 1601
224 Ga0496109_0002718 3300048912 Bacteria 14823
225 Ga0496109_0022410 3300048912 Bacteria 5594
226 Ga0496109_0188592 3300048912 Bacteria 1937
227 Ga0496109_0410396 3300048912 Bacteria 1280
228 Ga0496110_0082690 3300048913 Bacteria 2864
229 Ga0496110_0161053 3300048913 Bacteria 2034
230 Ga0496110_0223975 3300048913 Bacteria 1711
231 Ga0496110_0877660 3300048913 Bacteria 803
232 Ga0496111_0039839 3300048914 Bacteria 3371
233 Ga0496112_0000005 3300048915 Bacteria 525541
234 Ga0496112_0276196 3300048915 Bacteria 1628
235 Ga0496112_0374518 3300048915 Unclassified 1365
236 Ga0496112_0374812 3300048915 Bacteria 1364
237 Ga0496112_0658003 3300048915 Unclassified 977
238 Ga0496113_0049752 3300048916 Bacteria 3122
239 Ga0496113_0051833 3300048916 Bacteria 3063
240 Ga0496113_0333050 3300048916 Bacteria 1217
241 Ga0496113_0451070 3300048916 Unclassified 1033
242 Ga0496114_0036067 3300048917 Bacteria 4087
243 Ga0496114_0045667 3300048917 Bacteria 3640
244 Ga0496114_0939202 3300048917 Bacteria 747
245 Ga0501037_0195707 3300049573 Bacteria 1430
246 Ga0501038_0083975 3300049574 Bacteria 2680
247 Ga0501038_0196780 3300049574 Bacteria 1620
248 Ga0501038_0284410 3300049574 Bacteria 1301
249 Ga0501039_0024280 3300049575 Bacteria 4655
250 Ga0501039_0217814 3300049575 Bacteria 1501
251 Ga0501039_0571553 3300049575 Bacteria 887
252 Ga0501039_0762063 3300049575 Bacteria 756
253 Ga0501040_0131651 3300049576 Bacteria 1759
254 Ga0501040_0229808 3300049576 Bacteria 1321
255 Ga0501041_0059593 3300049577 Bacteria 2336
256 Ga0501041_0071272 3300049577 Bacteria 2134
257 Ga0501042_0571384 3300049578 Bacteria 822
258 Ga0501043_0143053 3300049579 Bacteria 1873
259 Ga0501046_0435789 3300049580 Bacteria 943
260 Ga0501046_0526327 3300049580 Bacteria 845
261 Ga0501048_0040939 3300049582 Bacteria 3319
262 Ga0501048_0124441 3300049582 Bacteria 1823
263 Ga0501048_0419836 3300049582 Bacteria 957
264 Ga0501067_0005087 3300049583 Bacteria 7304
265 Ga0501068_0323791 3300049584 Bacteria 988
266 Ga0501069_0008703 3300049585 Bacteria 5346
267 Ga0501069_0050845 3300049585 Bacteria 2305
268 Ga0501070_0246302 3300049586 Bacteria 1463
269 Ga0501071_0065006 3300049587 Bacteria 2648
270 Ga0501071_0069208 3300049587 Bacteria 2570
271 Ga0501072_0007094 3300049588 Bacteria 8501
272 Ga0501073_0173600 3300049589 Bacteria 1492
273 Ga0501073_0367709 3300049589 Bacteria 993
274 Ga0501074_0087229 3300049590 Bacteria 2235
275 Ga0501074_0537063 3300049590 Bacteria 828
276 Ga0501074_0537710 3300049590 Unclassified 827
277 Ga0501075_0111680 3300049591 Bacteria 2078
278 Ga0501075_0117332 3300049591 Bacteria 2023
279 Ga0501075_0118575 3300049591 Bacteria 2012
280 Ga0501075_0275439 3300049591 Bacteria 1282
281 Ga0501075_0627135 3300049591 Bacteria 820
282 Ga0501076_0029431 3300049592 Bacteria 4272
283 Ga0501076_0107623 3300049592 Bacteria 2251
284 Ga0501076_0298617 3300049592 Unclassified 1320
285 Ga0501076_0342940 3300049592 Bacteria 1226
286 Ga0501077_0139534 3300049593 Bacteria 1537
287 Ga0501077_0265738 3300049593 Bacteria 1091
288 Ga0501079_0020674 3300049741 Bacteria 5032
289 Ga0501079_0050132 3300049741 Bacteria 3223
290 Ga0501080_0050256 3300049742 Bacteria 3881
291 Ga0501080_0417932 3300049742 Bacteria 1205
292 Ga0501081_0165996 3300049743 Bacteria 1593
293 Ga0501081_0445244 3300049743 Bacteria 962
294 Ga0501081_0515341 3300049743 Bacteria 892
295 Ga0501045_0021684 3300049824 Bacteria 4598
296 Ga0501045_0022671 3300049824 Bacteria 4497
297 Ga0501045_0096912 3300049824 Bacteria 2182
298 Ga0501045_0107679 3300049824 Bacteria 2065
299 Ga0501045_0160410 3300049824 Bacteria 1674
300 Ga0501045_0206154 3300049824 Bacteria 1465
301 nmdc:mga0yw44_113259_c1 3300050492 Bacteria 1740
302 nmdc:mga05p37_44_c1 3300050507 Bacteria 107032
303 nmdc:mga05p37_674312_c1 3300050507 Unclassified 1153
304 nmdc:mga09592_753612_c1 3300050508 Bacteria 826
305 nmdc:mga08y16_1270201_c1 3300050511 Unclassified 704
306 nmdc:mga08y16_28267_c1 3300050511 Bacteria 5910
307 nmdc:mga08y16_371685_c1 3300050511 Bacteria 1466
308 nmdc:mga0n895_1066722_c1 3300050512 Bacteria 786
309 nmdc:mga0n895_185301_c1 3300050512 Bacteria 2112
310 nmdc:mga0n895_77474_c1 3300050512 Bacteria 3307
311 nmdc:mga0rr50_370591_c1 3300050513 Bacteria 1206
312 nmdc:mga0rr50_586733_c1 3300050513 Bacteria 950
313 nmdc:mga0rr50_793491_c1 3300050513 Bacteria 808
314 nmdc:mga0a205_23506_c1 3300050515 Bacteria 5847
315 Ga0495612_0036516 3300053078 Bacteria 1994
316 Ga0495595_0170752 3300053084 Bacteria 1076
317 Ga0495619_0030467 3300053085 Bacteria 3493
318 Ga0501084_0107126 3300054114 Bacteria 2348
319 Ga0501084_0170811 3300054114 Bacteria 1835
320 Ga0501084_0319584 3300054114 Bacteria 1311
321 Ga0501082_0020782 3300060353 Bacteria 5661
322 Ga0501082_0055519 3300060353 Bacteria 3412
323 Ga0501082_0101879 3300060353 Bacteria 2484
324 Ga0501082_0304281 3300060353 Bacteria 1388
325 Ga0501082_0446965 3300060353 Bacteria 1129
326 Ga0530510_0015999 3300061734 Bacteria 5302
327 Ga0530510_0065158 3300061734 Bacteria 2639
328 Ga0530510_0213637 3300061734 Bacteria 1433
329 Ga0501067_0168001
330 Ga0070683_100307394
331 Ga0070683_100601822
332 Ga0070690_100037290
333 Ga0070690_100498310
334 Ga0070670_100087288
335 Ga0068869_100162783
336 Ga0070680_100064421
337 Ga0070682_100084932
338 Ga0068868_100048766
339 Ga0070689_100169461
340 Ga0070687_100002225
341 Ga0070687_100145127
342 Ga0070687_100573735
343 Ga0070661_100072083
344 Ga0070669_100026835
345 Ga0070675_100048577
346 Ga0070671_100134095
347 Ga0070673_100018140
348 Ga0070673_100351030
349 Ga0070688_100005335
350 Ga0070659_100021492
351 Ga0070667_100146753
352 Ga0070703_10015652
353 Ga0070710_10270407
354 Ga0070705_100005730
355 Ga0070705_100048088
356 Ga0070705_100151187
357 Ga0070705_100238683
358 Ga0070700_100040248
359 Ga0070700_100319611
360 Ga0070708_100035398
361 Ga0070708_100235013
362 Ga0070708_100399556
363 Ga0070663_100197198
364 Ga0070678_100095957
365 Ga0068867_100028277
366 Ga0070685_10029292
367 Ga0070706_100052473
368 Ga0070706_100141517
369 Ga0070706_100152418
370 Ga0070707_100001515
371 Ga0070707_100018801
372 Ga0070707_100153629
373 Ga0070707_100535902
374 Ga0070698_100017324
375 Ga0070698_100034245
376 Ga0070698_100813095
377 Ga0070699_100001116
378 Ga0070699_100005074
379 Ga0070699_100022160
380 Ga0070699_100161311
381 Ga0070699_100353122
382 Ga0070699_100783935
383 Ga0070684_100460703
384 Ga0070697_100030489
385 Ga0070697_100059832
386 Ga0068853_100310307
387 Ga0070695_100004556
388 Ga0070695_100019692
389 Ga0070695_100264482
390 Ga0070695_100382127
391 Ga0070696_100031130
392 Ga0070696_100041697
393 Ga0070696_100072227
394 Ga0070704_100016435
395 Ga0070704_100108617
396 Ga0070704_100156195
397 Ga0070704_100316852
398 Ga0070704_100441024
399 Ga0068855_100990519
400 Ga0068857_100360977
401 Ga0068854_100280389
402 Ga0068854_100791644
403 Ga0070702_100013086
404 Ga0068859_100034108
405 Ga0068864_100030193
406 Ga0068864_100609953
407 Ga0068870_10005772
408 Ga0068863_100574770
409 Ga0068858_100235767
410 Ga0068860_100231074
411 Ga0068860_100300238
412 Ga0068862_100471896
413 Ga0081539_10013133
414 Ga0075428_100056549
415 Ga0075428_100299548
416 Ga0075433_10165413
417 Ga0075433_10166052
418 Ga0075433_10256507
419 Ga0075433_10494045
420 Ga0075434_100212615
421 Ga0075434_100439264
422 Ga0075429_100280728
423 Ga0068865_100010204
424 Ga0068865_100063278
425 Ga0097620_100034107
426 Ga0075435_100019827
427 Ga0111539_10023213
428 Ga0111539_10118122
429 Ga0111539_10430094
430 Ga0111539_11818865
431 Ga0105245_10005398
432 Ga0105245_10136743
433 Ga0105245_10257253
434 Ga0105247_10242463
435 Ga0114129_10000135
436 Ga0114129_10286438
437 Ga0114129_10509551
438 Ga0105243_10013599
439 Ga0105243_10322963
440 Ga0105243_10429426
441 Ga0105243_11008549
442 Ga0105242_10063109
443 Ga0105238_10215522
444 Ga0105239_10015283
445 Ga0157373_10627603
446 Ga0157378_10022198
447 Ga0157378_10058560
448 Ga0163162_10875722
449 Ga0157372_11126763
450 Ga0157375_10080494
451 Ga0163163_10034076
452 Ga0157380_10068230
453 Ga0157380_10145939
454 Ga0157380_10239928
455 Ga0157377_10089095
456 Ga0157377_10115866
457 Ga0157379_10027858
458 Ga0157379_10057584
459 Ga0207653_10006297
460 Ga0207643_10004916
461 Ga0207684_10017257
462 Ga0207684_10022853
463 Ga0207684_10087310
464 Ga0207684_10127057
465 Ga0207684_10512269
466 Ga0207707_10157003
467 Ga0207660_10000001
468 Ga0207660_10313142
469 Ga0207662_10001171
470 Ga0207657_10060394
471 Ga0207649_10080626
472 Ga0207652_10191886
473 Ga0207646_10002816
474 Ga0207646_10696354
475 Ga0207650_10058385
476 Ga0207659_10059120
477 Ga0207690_10008669
478 Ga0207706_10010482
479 Ga0207706_10103040
480 Ga0207686_10074571
481 Ga0207709_10035823
482 Ga0207709_10166741
483 Ga0207709_10518324
484 Ga0207669_10096684
485 Ga0207665_10175659
486 Ga0207689_10164472
487 Ga0207689_10180050
488 Ga0207661_10284329
489 Ga0207679_10443392
490 Ga0207651_10664559
491 Ga0207651_10709720
492 Ga0207712_10233693
493 Ga0207640_10135595
494 Ga0207640_10270161
495 Ga0207640_10290368
496 Ga0207677_10173068
497 Ga0207703_10309714
498 Ga0207703_10345437
499 Ga0207639_10346971
500 Ga0207678_10083007
501 Ga0207708_10016937
502 Ga0207708_10102677
503 Ga0207641_10603623
504 Ga0207648_10002379
505 Ga0207676_10026582
506 Ga0207676_10099705
507 Ga0207676_10249190
508 Ga0207674_10031496
509 Ga0207675_100013788
510 Ga0207675_100482760
511 Ga0207675_100683338
512 Ga0207683_10097004
513 Ga0207683_10515454
514 Ga0207428_10376496
515 Ga0268264_10284078
516 Ga0268264_10724488
517 Ga0265326_10015662
518 Ga0265319_1022310
519 Ga0265323_10100796
520 Ga0265336_10102072
521 Ga0265329_10005481
522 Ga0265316_10022427
523 Ga0307408_100125937
524 Ga0265342_10011464
525 Ga0307405_10132206
526 Ga0307413_10138056
527 Ga0307413_10195798
528 Ga0307409_100690750
529 Ga0307409_100948097
530 Ga0307416_100002026
531 Ga0373931_0038999
532 Ga0395901_0305770
533 Ga0450910_001927
534 Ga0450910_005954
535 Ga0495628_0143714
536 Ga0495628_0422214
537 Ga0495630_0265608
538 Ga0495656_0108715
539 Ga0495674_0544784
540 Ga0496100_0109474
541 Ga0496101_0165796
542 Ga0496101_0370032
543 Ga0496102_0387550
544 Ga0496103_0012635
545 Ga0496103_0041828
546 Ga0496103_0141879
547 Ga0496105_0088800
548 Ga0496105_0148376
549 Ga0496106_0054949
550 Ga0496106_0101211
551 Ga0496108_0233097
552 Ga0496109_0002718
553 Ga0496109_0022410
554 Ga0496109_0188592
555 Ga0496109_0410396
556 Ga0496110_0082690
557 Ga0496110_0161053
558 Ga0496110_0223975
559 Ga0496110_0877660
560 Ga0496111_0039839
561 Ga0496112_0000005
562 Ga0496112_0276196
563 Ga0496112_0374518
564 Ga0496112_0374812
565 Ga0496112_0658003
566 Ga0496113_0049752
567 Ga0496113_0051833
568 Ga0496113_0333050
569 Ga0496113_0451070
570 Ga0496114_0036067
571 Ga0496114_0045667
572 Ga0496114_0939202
573 Ga0501037_0195707
574 Ga0501038_0083975
575 Ga0501038_0196780
576 Ga0501038_0284410
577 Ga0501039_0024280
578 Ga0501039_0217814
579 Ga0501039_0571553
580 Ga0501039_0762063
581 Ga0501040_0131651
582 Ga0501040_0229808
583 Ga0501041_0059593
584 Ga0501041_0071272
585 Ga0501042_0571384
586 Ga0501043_0143053
587 Ga0501046_0435789
588 Ga0501046_0526327
589 Ga0501048_0040939
590 Ga0501048_0124441
591 Ga0501048_0419836
592 Ga0501067_0005087
593 Ga0501068_0323791
594 Ga0501069_0008703
595 Ga0501069_0050845
596 Ga0501070_0246302
597 Ga0501071_0065006
598 Ga0501071_0069208
599 Ga0501072_0007094
600 Ga0501073_0173600
601 Ga0501073_0367709
602 Ga0501074_0087229
603 Ga0501074_0537063
604 Ga0501074_0537710
605 Ga0501075_0111680
606 Ga0501075_0117332
607 Ga0501075_0118575
608 Ga0501075_0275439
609 Ga0501075_0627135
610 Ga0501076_0029431
611 Ga0501076_0107623
612 Ga0501076_0298617
613 Ga0501076_0342940
614 Ga0501077_0139534
615 Ga0501077_0265738
616 Ga0501079_0020674
617 Ga0501079_0050132
618 Ga0501080_0050256
619 Ga0501080_0417932
620 Ga0501081_0165996
621 Ga0501081_0445244
622 Ga0501081_0515341
623 Ga0501045_0021684
624 Ga0501045_0022671
625 Ga0501045_0096912
626 Ga0501045_0107679
627 Ga0501045_0160410
628 Ga0501045_0206154
629 nmdc:mga0yw44_113259_c1
630 nmdc:mga05p37_44_c1
631 nmdc:mga05p37_674312_c1
632 nmdc:mga09592_753612_c1
633 nmdc:mga08y16_1270201_c1
634 nmdc:mga08y16_28267_c1
635 nmdc:mga08y16_371685_c1
636 nmdc:mga0n895_1066722_c1
637 nmdc:mga0n895_185301_c1
638 nmdc:mga0n895_77474_c1
639 nmdc:mga0rr50_370591_c1
640 nmdc:mga0rr50_586733_c1
641 nmdc:mga0rr50_793491_c1
642 nmdc:mga0a205_23506_c1
643 Ga0495612_0036516
644 Ga0495595_0170752
645 Ga0495619_0030467
646 Ga0501084_0107126
647 Ga0501084_0170811
648 Ga0501084_0319584
649 Ga0501082_0020782
650 Ga0501082_0055519
651 Ga0501082_0101879
652 Ga0501082_0304281
653 Ga0501082_0446965
654 Ga0530510_0015999
655 Ga0530510_0065158
656 Ga0530510_0213637

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04079

SMC_ScpB

Segregation and condensation complex subunit ScpB

46

202

0.99

Map