F409363

General Info

Members Datasets Scaffolds Average Seq Length
328 145 656 53

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0073960|Ga0466972_0073960_1273_1449
Length 58
Sequence MYVWIWRHLPGTLALKFLQVALLVALVSALLLFVIFPWVEPHLPINKVTVPGGSQGHS

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
102 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
103 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
145 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.73
Metatranscriptomes 3.66
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.3
Rhizoplane 9.15
Rhizosphere 86.28
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0073960 3300044658 Bacteria 1624
2 JGI24735J21928_10029574 3300002067 Bacteria 1630
3 rootH1_10341323 3300003323 Bacteria 1474
4 Ga0070658_11790522 3300005327 Bacteria 531
5 Ga0070683_100443432 3300005329 Bacteria 1239
6 Ga0070683_101213858 3300005329 Bacteria 725
7 Ga0070682_100295208 3300005337 Bacteria 1187
8 Ga0070682_100691680 3300005337 Bacteria 817
9 Ga0070659_101752624 3300005366 Bacteria 556
10 Ga0070714_100000007 3300005435 Bacteria 285654
11 Ga0070714_100468073 3300005435 Bacteria 1199
12 Ga0070713_100132970 3300005436 Bacteria 2196
13 Ga0070713_101103525 3300005436 Bacteria 767
14 Ga0070710_11190008 3300005437 Bacteria 563
15 Ga0070711_100905615 3300005439 Bacteria 753
16 Ga0070700_100000015 3300005441 Bacteria 149873
17 Ga0070663_100201974 3300005455 Bacteria 1552
18 Ga0070663_100327988 3300005455 Bacteria 1233
19 Ga0070681_11266374 3300005458 Bacteria 660
20 Ga0070679_100431484 3300005530 Bacteria 1263
21 Ga0070684_100470153 3300005535 Bacteria 1163
22 Ga0070684_101665743 3300005535 Bacteria 602
23 Ga0068853_100292501 3300005539 Bacteria 1504
24 Ga0068855_100029229 3300005563 Bacteria 6591
25 Ga0068855_100063791 3300005563 Bacteria 4298
26 Ga0068855_100157346 3300005563 Bacteria 2581
27 Ga0068855_100318515 3300005563 Bacteria 1719
28 Ga0068856_100037633 3300005614 Bacteria 4747
29 Ga0068856_100053116 3300005614 Bacteria 3996
30 Ga0068856_100717405 3300005614 Bacteria 1020
31 Ga0068852_100578454 3300005616 Bacteria 1126
32 Ga0068852_101009941 3300005616 Bacteria 851
33 Ga0068859_100005537 3300005617 Bacteria 12863
34 Ga0068864_100831619 3300005618 Bacteria 909
35 Ga0081455_10005961 3300005937 Bacteria 13213
36 Ga0081455_10121978 3300005937 Bacteria 2052
37 Ga0081540_1070359 3300005983 Bacteria 1621
38 Ga0070717_11702132 3300006028 Bacteria 571
39 Ga0070712_100525103 3300006175 Bacteria 995
40 Ga0097620_100005537 3300006931 Bacteria 12863
41 Ga0105240_10198666 3300009093 Bacteria 2352
42 Ga0105240_10746254 3300009093 Bacteria 1064
43 Ga0105240_11397042 3300009093 Bacteria 736
44 Ga0105247_10147486 3300009101 Bacteria 1547
45 Ga0105241_10263960 3300009174 Bacteria 1464
46 Ga0105237_10045084 3300009545 Bacteria 4439
47 Ga0105237_10067460 3300009545 Bacteria 3571
48 Ga0105238_10468072 3300009551 Bacteria 1259
49 Ga0105238_11648366 3300009551 Bacteria 672
50 Ga0105239_10099499 3300010375 Bacteria 3215
51 Ga0105239_12180099 3300010375 Bacteria 644
52 Ga0105239_12821995 3300010375 Bacteria 567
53 Ga0105239_13489092 3300010375 Bacteria 511
54 Ga0157370_10034574 3300013104 Bacteria 4918
55 Ga0157369_10041490 3300013105 Bacteria 5023
56 Ga0157369_11560006 3300013105 Bacteria 672
57 Ga0157369_11943936 3300013105 Bacteria 597
58 Ga0157374_10214998 3300013296 Bacteria 1885
59 Ga0157374_12345768 3300013296 Bacteria 561
60 Ga0157374_12747135 3300013296 Bacteria 520
61 Ga0157372_11748606 3300013307 Bacteria 715
62 Ga0157372_12230952 3300013307 Bacteria 629
63 Ga0157372_12426988 3300013307 Bacteria 602
64 Ga0163163_10068327 3300014325 Bacteria 3536
65 Ga0182008_10547534 3300014497 Bacteria 642
66 Ga0197907_10296837 3300020069 Bacteria 2024
67 Ga0197907_11412992 3300020069 Bacteria 517
68 Ga0206352_10951310 3300020078 Bacteria 556
69 Ga0206350_10389114 3300020080 Bacteria 901
70 Ga0206354_11012011 3300020081 Bacteria 644
71 Ga0206353_11014344 3300020082 Bacteria 2731
72 Ga0206353_11738750 3300020082 Bacteria 3462
73 Ga0206353_11914109 3300020082 Bacteria 527
74 Ga0154015_1027858 3300020610 Bacteria 556
75 Ga0213876_10383749 3300021384 Bacteria 747
76 Ga0224712_10075847 3300022467 Bacteria 1376
77 Ga0207710_10424873 3300025900 Bacteria 684
78 Ga0207647_10049071 3300025904 Bacteria 2620
79 Ga0207647_10112691 3300025904 Bacteria 1607
80 Ga0207647_10317146 3300025904 Bacteria 886
81 Ga0207647_10531199 3300025904 Bacteria 654
82 Ga0207647_10563928 3300025904 Bacteria 631
83 Ga0207705_10629798 3300025909 Bacteria 834
84 Ga0207684_10666216 3300025910 Bacteria 886
85 Ga0207695_10133511 3300025913 Bacteria 2437
86 Ga0207695_10235447 3300025913 Bacteria 1734
87 Ga0207695_10653465 3300025913 Bacteria 932
88 Ga0207671_10047155 3300025914 Bacteria 3189
89 Ga0207671_10116611 3300025914 Bacteria 2037
90 Ga0207657_10723598 3300025919 Bacteria 772
91 Ga0207652_10181478 3300025921 Bacteria 1892
92 Ga0207652_11013369 3300025921 Bacteria 729
93 Ga0207694_10340766 3300025924 Bacteria 1240
94 Ga0207694_11282310 3300025924 Bacteria 620
95 Ga0207700_10055443 3300025928 Bacteria 2979
96 Ga0207700_10604691 3300025928 Bacteria 976
97 Ga0207664_10000014 3300025929 Bacteria 249865
98 Ga0207664_10574089 3300025929 Bacteria 1012
99 Ga0207661_10730229 3300025944 Bacteria 911
100 Ga0207667_10016164 3300025949 Bacteria 8438
101 Ga0207667_10044349 3300025949 Bacteria 4713
102 Ga0207667_10129001 3300025949 Bacteria 2604
103 Ga0207667_10340520 3300025949 Bacteria 1530
104 Ga0207667_10674572 3300025949 Bacteria 1038
105 Ga0207667_10855413 3300025949 Bacteria 903
106 Ga0207639_10200328 3300026041 Bacteria 1712
107 Ga0207678_10214800 3300026067 Bacteria 1646
108 Ga0207678_10225980 3300026067 Bacteria 1602
109 Ga0207708_10000004 3300026075 Bacteria 293087
110 Ga0207702_10028331 3300026078 Bacteria 4655
111 Ga0207702_10042101 3300026078 Bacteria 3830
112 Ga0207702_10778796 3300026078 Bacteria 945
113 Ga0207702_11297743 3300026078 Bacteria 722
114 Ga0207676_10609026 3300026095 Bacteria 1050
115 Ga0207698_10566976 3300026142 Bacteria 1115
116 Ga0268266_11729360 3300028379 Bacteria 600
117 Ga0307405_10104928 3300031731 Bacteria 1903
118 Ga0307413_10277415 3300031824 Bacteria 1259
119 Ga0307410_10043225 3300031852 Bacteria 2984
120 Ga0307410_10449930 3300031852 Bacteria 1050
121 Ga0307410_11180310 3300031852 Bacteria 666
122 Ga0307410_11766448 3300031852 Bacteria 549
123 Ga0307406_10197343 3300031901 Bacteria 1478
124 Ga0307406_10662603 3300031901 Bacteria 867
125 Ga0307407_10059703 3300031903 Bacteria 2222
126 Ga0307407_10293221 3300031903 Bacteria 1131
127 Ga0307407_10540983 3300031903 Bacteria 859
128 Ga0307407_10881470 3300031903 Bacteria 685
129 Ga0307412_10975300 3300031911 Bacteria 747
130 Ga0307409_100236915 3300031995 Bacteria 1658
131 Ga0307409_101070116 3300031995 Bacteria 827
132 Ga0307409_101640096 3300031995 Bacteria 671
133 Ga0307409_101895305 3300031995 Bacteria 625
134 Ga0307416_100033709 3300032002 Bacteria 3886
135 Ga0307416_100234446 3300032002 Bacteria 1772
136 Ga0307416_100328422 3300032002 Bacteria 1536
137 Ga0307416_100569497 3300032002 Bacteria 1208
138 Ga0307416_101357355 3300032002 Bacteria 817
139 Ga0307416_102057079 3300032002 Bacteria 673
140 Ga0307416_103586644 3300032002 Bacteria 519
141 Ga0307414_10744321 3300032004 Bacteria 890
142 Ga0307414_12035476 3300032004 Bacteria 536
143 Ga0307411_10099686 3300032005 Unclassified 2051
144 Ga0307411_10232772 3300032005 Bacteria 1437
145 Ga0307411_11007409 3300032005 Bacteria 746
146 Ga0307415_100346046 3300032126 Bacteria 1249
147 Ga0307415_100447777 3300032126 Bacteria 1115
148 Ga0307415_100631543 3300032126 Bacteria 957
149 Ga0307415_102406273 3300032126 Bacteria 518
150 Ga0395898_0269449 3300037466 Bacteria 1624
151 Ga0395901_1825472 3300038443 Bacteria 557
152 Ga0436365_0913223 3300039437 Bacteria 8347
153 Ga0436365_0983865 3300039437 Bacteria 1190
154 Ga0436365_0985866 3300039437 Bacteria 795
155 Ga0466969_0442179 3300044656 Bacteria 591
156 Ga0466972_0024996 3300044658 Bacteria 2963
157 Ga0466972_0111178 3300044658 Bacteria 1295
158 Ga0466972_0117418 3300044658 Bacteria 1255
159 Ga0466972_0142988 3300044658 Bacteria 1126
160 Ga0466972_0161459 3300044658 Bacteria 1053
161 Ga0466972_0218854 3300044658 Bacteria 891
162 Ga0466972_0636104 3300044658 Bacteria 505
163 Ga0466965_0476451 3300044683 Bacteria 698
164 Ga0466965_0733526 3300044683 Unclassified 569
165 Ga0466966_0008372 3300044684 Bacteria 6851
166 Ga0466966_0034150 3300044684 Bacteria 3291
167 Ga0466966_0264891 3300044684 Bacteria 1034
168 Ga0466966_0744434 3300044684 Bacteria 591
169 Ga0466961_0011669 3300044693 Bacteria 5616
170 Ga0466961_0027726 3300044693 Bacteria 3644
171 Ga0466961_0047459 3300044693 Bacteria 2746
172 Ga0466961_0061041 3300044693 Bacteria 2396
173 Ga0466961_0109567 3300044693 Bacteria 1738
174 Ga0466961_0229845 3300044693 Bacteria 1142
175 Ga0466961_0289962 3300044693 Bacteria 1001
176 Ga0466961_0461361 3300044693 Bacteria 768
177 Ga0466963_0003475 3300044694 Bacteria 9034
178 Ga0466963_0004261 3300044694 Bacteria 8302
179 Ga0466963_0048793 3300044694 Bacteria 2799
180 Ga0466963_0148944 3300044694 Bacteria 1625
181 Ga0466963_0192065 3300044694 Bacteria 1426
182 Ga0466963_0226027 3300044694 Bacteria 1311
183 Ga0466963_0320676 3300044694 Bacteria 1090
184 Ga0466963_0496972 3300044694 Bacteria 861
185 Ga0466963_0907359 3300044694 Archaea 621
186 Ga0466964_0034004 3300044706 Bacteria 2033
187 Ga0466964_0036036 3300044706 Bacteria 1982
188 Ga0466964_0105427 3300044706 Bacteria 1249
189 Ga0466964_0251874 3300044706 Bacteria 871
190 Ga0466964_0911623 3300044706 Bacteria 503
191 Ga0466971_0020145 3300044719 Bacteria 2965
192 Ga0466971_0049331 3300044719 Bacteria 1894
193 Ga0466971_0643433 3300044719 Bacteria 531
194 Ga0466968_0421193 3300044735 Bacteria 657
195 Ga0466968_0531656 3300044735 Bacteria 588
196 Ga0466970_0038750 3300044765 Bacteria 2529
197 Ga0466970_0153740 3300044765 Bacteria 1271
198 Ga0466970_0163272 3300044765 Bacteria 1232
199 Ga0466970_0212100 3300044765 Bacteria 1079
200 Ga0466970_0233229 3300044765 Bacteria 1029
201 Ga0466957_0054732 3300044842 Bacteria 2436
202 Ga0466957_0058123 3300044842 Bacteria 2369
203 Ga0466957_0066887 3300044842 Bacteria 2216
204 Ga0466957_0168939 3300044842 Bacteria 1424
205 Ga0466957_0491034 3300044842 Bacteria 850
206 Ga0466957_0660226 3300044842 Bacteria 736
207 Ga0466957_0761178 3300044842 Bacteria 686
208 Ga0466957_1114349 3300044842 Bacteria 569
209 Ga0466957_1345595 3300044842 Bacteria 519
210 Ga0466960_0019465 3300044901 Bacteria 2992
211 Ga0466960_0054877 3300044901 Bacteria 1936
212 Ga0466960_0302920 3300044901 Bacteria 901
213 Ga0466960_0346660 3300044901 Bacteria 846
214 Ga0466960_0377394 3300044901 Bacteria 813
215 Ga0466960_0485207 3300044901 Bacteria 722
216 Ga0466959_0046784 3300045049 Bacteria 3184
217 Ga0466959_0052239 3300045049 Bacteria 2994
218 Ga0466959_0075139 3300045049 Bacteria 2442
219 Ga0466959_0188014 3300045049 Bacteria 1442
220 Ga0466959_0235482 3300045049 Bacteria 1266
221 Ga0466959_0456003 3300045049 Bacteria 866
222 Ga0466959_0531108 3300045049 Bacteria 794
223 Ga0466959_0677384 3300045049 Bacteria 692
224 Ga0466958_0005612 3300045836 Bacteria 6768
225 Ga0466958_0028927 3300045836 Bacteria 3287
226 Ga0466958_0108109 3300045836 Bacteria 1735
227 Ga0466958_0175945 3300045836 Bacteria 1357
228 Ga0466958_0227945 3300045836 Bacteria 1189
229 Ga0466958_0366405 3300045836 Bacteria 928
230 Ga0466958_0430896 3300045836 Bacteria 853
231 Ga0466958_0495002 3300045836 Bacteria 793
232 Ga0466958_0652171 3300045836 Bacteria 685
233 Ga0466958_0692098 3300045836 Bacteria 664
234 Ga0466958_1036164 3300045836 Bacteria 535
235 Ga0466967_0003165 3300045976 Bacteria 10611
236 Ga0466967_0003498 3300045976 Bacteria 10264
237 Ga0466967_0014692 3300045976 Bacteria 6112
238 Ga0466967_0023393 3300045976 Bacteria 5062
239 Ga0466967_0043245 3300045976 Bacteria 3899
240 Ga0466967_0044495 3300045976 Bacteria 3852
241 Ga0466967_0077261 3300045976 Bacteria 2997
242 Ga0466967_0245118 3300045976 Bacteria 1710
243 Ga0466967_0386413 3300045976 Bacteria 1360
244 Ga0466967_0560869 3300045976 Bacteria 1125
245 Ga0466967_0673380 3300045976 Bacteria 1024
246 Ga0466967_0987812 3300045976 Bacteria 838
247 Ga0466967_1048074 3300045976 Bacteria 812
248 Ga0466967_1736891 3300045976 Bacteria 621
249 Ga0466967_2554737 3300045976 Bacteria 505
250 Ga0495641_0170982 3300046461 Bacteria 972
251 Ga0495653_0533336 3300046463 Bacteria 728
252 Ga0495596_0339006 3300046500 Bacteria 585
253 Ga0495663_0362508 3300046525 Bacteria 529
254 Ga0495666_0358596 3300046526 Bacteria 656
255 Ga0495598_0031262 3300046537 Bacteria 1497
256 Ga0495656_0539577 3300046615 Bacteria 621
257 Ga0495615_0263462 3300048090 Bacteria 549
258 Ga0496100_0585639 3300048903 Bacteria 865
259 Ga0496101_0040865 3300048904 Bacteria 3304
260 Ga0496102_0000013 3300048905 Bacteria 311668
261 Ga0496102_0006944 3300048905 Bacteria 9658
262 Ga0496102_0090068 3300048905 Bacteria 2839
263 Ga0496102_0118532 3300048905 Bacteria 2471
264 Ga0496103_0000105 3300048906 Bacteria 92467
265 Ga0496103_0006042 3300048906 Bacteria 7235
266 Ga0496104_0257211 3300048907 Bacteria 1659
267 Ga0496104_0819660 3300048907 Bacteria 836
268 Ga0496105_1315637 3300048908 Bacteria 527
269 Ga0496105_1346405 3300048908 Bacteria 519
270 Ga0496105_1366101 3300048908 Bacteria 514
271 Ga0496107_1265774 3300048910 Bacteria 528
272 Ga0496108_0019270 3300048911 Bacteria 5601
273 Ga0496108_0157261 3300048911 Bacteria 1963
274 Ga0496109_0041487 3300048912 Bacteria 4168
275 Ga0496109_0110946 3300048912 Bacteria 2550
276 Ga0496109_1492719 3300048912 Bacteria 611
277 Ga0496110_0279113 3300048913 Bacteria 1521
278 Ga0496110_0862547 3300048913 Bacteria 811
279 Ga0496111_0018183 3300048914 Bacteria 4867
280 Ga0496112_0076219 3300048915 Bacteria 3317
281 Ga0496112_0242179 3300048915 Bacteria 1756
282 Ga0496112_1300926 3300048915 Bacteria 643
283 Ga0496113_0132451 3300048916 Bacteria 1957
284 Ga0496114_0206029 3300048917 Bacteria 1724
285 Ga0496114_0439493 3300048917 Bacteria 1155
286 Ga0496114_0646667 3300048917 Bacteria 930
287 Ga0496115_0564341 3300048918 Bacteria 908
288 Ga0496116_0066010 3300048919 Bacteria 2318
289 Ga0496117_0448343 3300048920 Bacteria 639
290 Ga0496118_0021828 3300048921 Bacteria 5619
291 Ga0496118_0063820 3300048921 Bacteria 2708
292 Ga0496119_0000022 3300048922 Bacteria 269878
293 Ga0496120_0004177 3300048923 Bacteria 12372
294 Ga0496120_0119467 3300048923 Bacteria 1365
295 Ga0496121_0027311 3300048924 Bacteria 5343
296 Ga0496121_0073126 3300048924 Bacteria 2749
297 Ga0501031_0002328 3300049568 Bacteria 12028
298 Ga0501031_0070197 3300049568 Bacteria 2282
299 Ga0501031_0106228 3300049568 Bacteria 1833
300 Ga0501032_0021101 3300049569 Bacteria 4530
301 Ga0501033_0066969 3300049570 Bacteria 2641
302 Ga0501034_0126565 3300049571 Bacteria 2540
303 Ga0501036_0065546 3300049572 Bacteria 3074
304 Ga0501037_0031261 3300049573 Bacteria 3931
305 Ga0501037_0476309 3300049573 Bacteria 849
306 Ga0501038_0008223 3300049574 Bacteria 9601
307 Ga0501043_0010084 3300049579 Bacteria 7408
308 Ga0501046_0070040 3300049580 Bacteria 2728
309 Ga0501047_0124292 3300049581 Bacteria 2460
310 Ga0501047_0662929 3300049581 Bacteria 862
311 Ga0501048_0000435 3300049582 Bacteria 29287
312 Ga0501067_0603590 3300049583 Bacteria 616
313 Ga0501070_0702367 3300049586 Bacteria 800
314 Ga0501070_0856688 3300049586 Bacteria 711
315 Ga0501071_1247809 3300049587 Bacteria 574
316 Ga0501035_0049441 3300049822 Bacteria 3768
317 Ga0501035_0064743 3300049822 Bacteria 3248
318 Ga0501035_0255810 3300049822 Bacteria 1486
319 Ga0501044_0105418 3300049823 Bacteria 2832
320 Ga0501044_0362601 3300049823 Bacteria 1367
321 Ga0587073_0306408 3300059492 Bacteria 519
322 Ga0587111_0282839 3300060346 Bacteria 502
323 Ga0466962_0038259 3300061719 Bacteria 2297
324 Ga0466962_0242938 3300061719 Bacteria 884
325 Ga0466962_0505406 3300061719 Bacteria 612
326 Ga0466962_0510688 3300061719 Bacteria 608
327 2623499199 2622736605 Bacteria 4992138
328 8002777075 8002775197 Bacteria 10728764
329 Ga0466972_0073960
330 JGI24735J21928_10029574
331 rootH1_10341323
332 Ga0070658_11790522
333 Ga0070683_100443432
334 Ga0070683_101213858
335 Ga0070682_100295208
336 Ga0070682_100691680
337 Ga0070659_101752624
338 Ga0070714_100000007
339 Ga0070714_100468073
340 Ga0070713_100132970
341 Ga0070713_101103525
342 Ga0070710_11190008
343 Ga0070711_100905615
344 Ga0070700_100000015
345 Ga0070663_100201974
346 Ga0070663_100327988
347 Ga0070681_11266374
348 Ga0070679_100431484
349 Ga0070684_100470153
350 Ga0070684_101665743
351 Ga0068853_100292501
352 Ga0068855_100029229
353 Ga0068855_100063791
354 Ga0068855_100157346
355 Ga0068855_100318515
356 Ga0068856_100037633
357 Ga0068856_100053116
358 Ga0068856_100717405
359 Ga0068852_100578454
360 Ga0068852_101009941
361 Ga0068859_100005537
362 Ga0068864_100831619
363 Ga0081455_10005961
364 Ga0081455_10121978
365 Ga0081540_1070359
366 Ga0070717_11702132
367 Ga0070712_100525103
368 Ga0097620_100005537
369 Ga0105240_10198666
370 Ga0105240_10746254
371 Ga0105240_11397042
372 Ga0105247_10147486
373 Ga0105241_10263960
374 Ga0105237_10045084
375 Ga0105237_10067460
376 Ga0105238_10468072
377 Ga0105238_11648366
378 Ga0105239_10099499
379 Ga0105239_12180099
380 Ga0105239_12821995
381 Ga0105239_13489092
382 Ga0157370_10034574
383 Ga0157369_10041490
384 Ga0157369_11560006
385 Ga0157369_11943936
386 Ga0157374_10214998
387 Ga0157374_12345768
388 Ga0157374_12747135
389 Ga0157372_11748606
390 Ga0157372_12230952
391 Ga0157372_12426988
392 Ga0163163_10068327
393 Ga0182008_10547534
394 Ga0197907_10296837
395 Ga0197907_11412992
396 Ga0206352_10951310
397 Ga0206350_10389114
398 Ga0206354_11012011
399 Ga0206353_11014344
400 Ga0206353_11738750
401 Ga0206353_11914109
402 Ga0154015_1027858
403 Ga0213876_10383749
404 Ga0224712_10075847
405 Ga0207710_10424873
406 Ga0207647_10049071
407 Ga0207647_10112691
408 Ga0207647_10317146
409 Ga0207647_10531199
410 Ga0207647_10563928
411 Ga0207705_10629798
412 Ga0207684_10666216
413 Ga0207695_10133511
414 Ga0207695_10235447
415 Ga0207695_10653465
416 Ga0207671_10047155
417 Ga0207671_10116611
418 Ga0207657_10723598
419 Ga0207652_10181478
420 Ga0207652_11013369
421 Ga0207694_10340766
422 Ga0207694_11282310
423 Ga0207700_10055443
424 Ga0207700_10604691
425 Ga0207664_10000014
426 Ga0207664_10574089
427 Ga0207661_10730229
428 Ga0207667_10016164
429 Ga0207667_10044349
430 Ga0207667_10129001
431 Ga0207667_10340520
432 Ga0207667_10674572
433 Ga0207667_10855413
434 Ga0207639_10200328
435 Ga0207678_10214800
436 Ga0207678_10225980
437 Ga0207708_10000004
438 Ga0207702_10028331
439 Ga0207702_10042101
440 Ga0207702_10778796
441 Ga0207702_11297743
442 Ga0207676_10609026
443 Ga0207698_10566976
444 Ga0268266_11729360
445 Ga0307405_10104928
446 Ga0307413_10277415
447 Ga0307410_10043225
448 Ga0307410_10449930
449 Ga0307410_11180310
450 Ga0307410_11766448
451 Ga0307406_10197343
452 Ga0307406_10662603
453 Ga0307407_10059703
454 Ga0307407_10293221
455 Ga0307407_10540983
456 Ga0307407_10881470
457 Ga0307412_10975300
458 Ga0307409_100236915
459 Ga0307409_101070116
460 Ga0307409_101640096
461 Ga0307409_101895305
462 Ga0307416_100033709
463 Ga0307416_100234446
464 Ga0307416_100328422
465 Ga0307416_100569497
466 Ga0307416_101357355
467 Ga0307416_102057079
468 Ga0307416_103586644
469 Ga0307414_10744321
470 Ga0307414_12035476
471 Ga0307411_10099686
472 Ga0307411_10232772
473 Ga0307411_11007409
474 Ga0307415_100346046
475 Ga0307415_100447777
476 Ga0307415_100631543
477 Ga0307415_102406273
478 Ga0395898_0269449
479 Ga0395901_1825472
480 Ga0436365_0913223
481 Ga0436365_0983865
482 Ga0436365_0985866
483 Ga0466969_0442179
484 Ga0466972_0024996
485 Ga0466972_0111178
486 Ga0466972_0117418
487 Ga0466972_0142988
488 Ga0466972_0161459
489 Ga0466972_0218854
490 Ga0466972_0636104
491 Ga0466965_0476451
492 Ga0466965_0733526
493 Ga0466966_0008372
494 Ga0466966_0034150
495 Ga0466966_0264891
496 Ga0466966_0744434
497 Ga0466961_0011669
498 Ga0466961_0027726
499 Ga0466961_0047459
500 Ga0466961_0061041
501 Ga0466961_0109567
502 Ga0466961_0229845
503 Ga0466961_0289962
504 Ga0466961_0461361
505 Ga0466963_0003475
506 Ga0466963_0004261
507 Ga0466963_0048793
508 Ga0466963_0148944
509 Ga0466963_0192065
510 Ga0466963_0226027
511 Ga0466963_0320676
512 Ga0466963_0496972
513 Ga0466963_0907359
514 Ga0466964_0034004
515 Ga0466964_0036036
516 Ga0466964_0105427
517 Ga0466964_0251874
518 Ga0466964_0911623
519 Ga0466971_0020145
520 Ga0466971_0049331
521 Ga0466971_0643433
522 Ga0466968_0421193
523 Ga0466968_0531656
524 Ga0466970_0038750
525 Ga0466970_0153740
526 Ga0466970_0163272
527 Ga0466970_0212100
528 Ga0466970_0233229
529 Ga0466957_0054732
530 Ga0466957_0058123
531 Ga0466957_0066887
532 Ga0466957_0168939
533 Ga0466957_0491034
534 Ga0466957_0660226
535 Ga0466957_0761178
536 Ga0466957_1114349
537 Ga0466957_1345595
538 Ga0466960_0019465
539 Ga0466960_0054877
540 Ga0466960_0302920
541 Ga0466960_0346660
542 Ga0466960_0377394
543 Ga0466960_0485207
544 Ga0466959_0046784
545 Ga0466959_0052239
546 Ga0466959_0075139
547 Ga0466959_0188014
548 Ga0466959_0235482
549 Ga0466959_0456003
550 Ga0466959_0531108
551 Ga0466959_0677384
552 Ga0466958_0005612
553 Ga0466958_0028927
554 Ga0466958_0108109
555 Ga0466958_0175945
556 Ga0466958_0227945
557 Ga0466958_0366405
558 Ga0466958_0430896
559 Ga0466958_0495002
560 Ga0466958_0652171
561 Ga0466958_0692098
562 Ga0466958_1036164
563 Ga0466967_0003165
564 Ga0466967_0003498
565 Ga0466967_0014692
566 Ga0466967_0023393
567 Ga0466967_0043245
568 Ga0466967_0044495
569 Ga0466967_0077261
570 Ga0466967_0245118
571 Ga0466967_0386413
572 Ga0466967_0560869
573 Ga0466967_0673380
574 Ga0466967_0987812
575 Ga0466967_1048074
576 Ga0466967_1736891
577 Ga0466967_2554737
578 Ga0495641_0170982
579 Ga0495653_0533336
580 Ga0495596_0339006
581 Ga0495663_0362508
582 Ga0495666_0358596
583 Ga0495598_0031262
584 Ga0495656_0539577
585 Ga0495615_0263462
586 Ga0496100_0585639
587 Ga0496101_0040865
588 Ga0496102_0000013
589 Ga0496102_0006944
590 Ga0496102_0090068
591 Ga0496102_0118532
592 Ga0496103_0000105
593 Ga0496103_0006042
594 Ga0496104_0257211
595 Ga0496104_0819660
596 Ga0496105_1315637
597 Ga0496105_1346405
598 Ga0496105_1366101
599 Ga0496107_1265774
600 Ga0496108_0019270
601 Ga0496108_0157261
602 Ga0496109_0041487
603 Ga0496109_0110946
604 Ga0496109_1492719
605 Ga0496110_0279113
606 Ga0496110_0862547
607 Ga0496111_0018183
608 Ga0496112_0076219
609 Ga0496112_0242179
610 Ga0496112_1300926
611 Ga0496113_0132451
612 Ga0496114_0206029
613 Ga0496114_0439493
614 Ga0496114_0646667
615 Ga0496115_0564341
616 Ga0496116_0066010
617 Ga0496117_0448343
618 Ga0496118_0021828
619 Ga0496118_0063820
620 Ga0496119_0000022
621 Ga0496120_0004177
622 Ga0496120_0119467
623 Ga0496121_0027311
624 Ga0496121_0073126
625 Ga0501031_0002328
626 Ga0501031_0070197
627 Ga0501031_0106228
628 Ga0501032_0021101
629 Ga0501033_0066969
630 Ga0501034_0126565
631 Ga0501036_0065546
632 Ga0501037_0031261
633 Ga0501037_0476309
634 Ga0501038_0008223
635 Ga0501043_0010084
636 Ga0501046_0070040
637 Ga0501047_0124292
638 Ga0501047_0662929
639 Ga0501048_0000435
640 Ga0501067_0603590
641 Ga0501070_0702367
642 Ga0501070_0856688
643 Ga0501071_1247809
644 Ga0501035_0049441
645 Ga0501035_0064743
646 Ga0501035_0255810
647 Ga0501044_0105418
648 Ga0501044_0362601
649 Ga0587073_0306408
650 Ga0587111_0282839
651 Ga0466962_0038259
652 Ga0466962_0242938
653 Ga0466962_0505406
654 Ga0466962_0510688
655 2623499199
656 8002777075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map