F409356

General Info

Members Datasets Scaffolds Average Seq Length
328 175 319 185

Family's Representative Sequence

Representative Sequence 3300042438|Ga0439459_0011646|Ga0439459_0011646_224_781
Length 185
Sequence MSGALDLLRHGDTGQQGYRGQLDDPLSALGWQQLREAVQGHAWDAIVSSPLSRCAAFASELARARDLPLQLDARLMEYHFGAWQGVPMATLAATQGPALARFWVDPAAHPPSGAETLAAFQARLTAALDDITQAHGGRVLVVTHGGAIRLLRCLAEGRPFTQMTELSVPHASLQTLRWPAPMPVP

Samples

Sample ID Description Type Environment
1 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
2 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
3 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
4 2738543009 Luteibacter sp. OK325 Isolate Unclassified
5 2739367700 Dyella sp. YR388 Isolate Unclassified
6 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
7 2884411467 Dyella sp. AD56 Isolate Rhizosphere
8 2928963466 Dyella japonica 1073 Isolate Unclassified
9 2941471342 Luteibacter sp. 621 Isolate Unclassified
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
26 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
27 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
28 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
68 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
69 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
70 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
118 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
174 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.65
Metatranscriptomes 0.61
Isolates 2.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.48
Nodule 0
Rhizoplane 4.27
Rhizosphere 50.61
Stem 0
Stem Tuber 0
Unclassified 21.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000945 3300001904 Bacteria 5355
2 JGI24740J21852_10043095 3300001979 Bacteria 1348
3 JGI24737J22298_10007214 3300001990 Bacteria 3759
4 JGI24735J21928_10005341 3300002067 Bacteria 4262
5 JGI24735J21928_10043711 3300002067 Bacteria 1302
6 JGI24735J21928_10044892 3300002067 Bacteria 1284
7 JGI25156J39149_1016672 3300002705 Bacteria 1420
8 JGI25162J39368_1000666 3300002737 Bacteria 24265
9 JGI25162J39368_1001197 3300002737 Bacteria 15208
10 JGI25157J39369_1000579 3300002741 Bacteria 21667
11 JGI25157J39369_1001556 3300002741 Bacteria 8225
12 JGI25157J39369_1022196 3300002741 Bacteria 751
13 JGI25163J39215_1000216 3300002771 Bacteria 21729
14 JGI25164J39214_1000030 3300002772 Bacteria 145974
15 JGI25164J39214_1000093 3300002772 Bacteria 89262
16 JGI25152J39213_1019278 3300002773 Bacteria 1243
17 JGI25165J46597_1000057 3300003214 Bacteria 217135
18 JGI25165J46597_1000759 3300003214 Bacteria 24751
19 rootH1_10033986 3300003316 Bacteria 3365
20 rootH2_10032037 3300003320 Bacteria 25057
21 rootH2_10214272 3300003320 Bacteria 1948
22 rootL2_10053837 3300003322 Bacteria 1388
23 rootH1_10152318 3300003323 Bacteria 4511
24 Ga0006562J51391_1038928 3300003578 Bacteria 20190
25 Ga0006562J51391_1038931 3300003578 Bacteria 6740
26 Ga0055538_1000881 3300003751 Bacteria 7554
27 Ga0055539_1002887 3300003752 Bacteria 2509
28 Ga0055533_1002229 3300003756 Bacteria 4557
29 Ga0055525_1000093 3300003759 Bacteria 138423
30 Ga0055527_1000245 3300003760 Bacteria 33608
31 Ga0055527_1000491 3300003760 Bacteria 14191
32 Ga0055527_1004210 3300003760 Bacteria 2007
33 Ga0055535_1000152 3300003761 Bacteria 73843
34 Ga0055535_1000901 3300003761 Bacteria 20311
35 Ga0055535_1001247 3300003761 Bacteria 14183
36 Ga0055535_1002739 3300003761 Bacteria 5675
37 Ga0055542_1000544 3300003762 Bacteria 33466
38 Ga0055542_1000753 3300003762 Bacteria 24623
39 Ga0055542_1000769 3300003762 Bacteria 24265
40 Ga0055542_1001155 3300003762 Bacteria 15422
41 Ga0055542_1001236 3300003762 Bacteria 14182
42 Ga0055529_1000082 3300003763 Bacteria 146912
43 Ga0055529_1000588 3300003763 Bacteria 28906
44 Ga0055529_1000941 3300003763 Bacteria 15422
45 Ga0055529_1000982 3300003763 Bacteria 14182
46 Ga0065165_1006031 3300005262 Bacteria 6518
47 Ga0070689_100000610 3300005340 Bacteria 21657
48 Ga0070661_100204277 3300005344 Bacteria 1511
49 Ga0070663_100000263 3300005455 Bacteria 26391
50 Ga0070663_100038583 3300005455 Bacteria 3333
51 Ga0070663_100084923 3300005455 Bacteria 2335
52 Ga0070662_100418885 3300005457 Bacteria 1108
53 Ga0068853_100000138 3300005539 Bacteria 49814
54 Ga0068853_100000391 3300005539 Bacteria 29990
55 Ga0070665_100017248 3300005548 Bacteria 7246
56 Ga0068855_100005293 3300005563 Bacteria 15755
57 Ga0068855_100010686 3300005563 Bacteria 11078
58 Ga0068855_100069657 3300005563 Bacteria 4093
59 Ga0070664_100238422 3300005564 Bacteria 1632
60 Ga0068857_100002273 3300005577 Bacteria 15618
61 Ga0068857_100041080 3300005577 Bacteria 4101
62 Ga0068854_100002661 3300005578 Bacteria 11078
63 Ga0068854_100006581 3300005578 Bacteria 7401
64 Ga0068856_100007414 3300005614 Bacteria 10703
65 Ga0068856_100467310 3300005614 Bacteria 1282
66 Ga0068856_100733378 3300005614 Bacteria 1008
67 Ga0068852_100066732 3300005616 Bacteria 3143
68 Ga0068851_10000797 3300005834 Bacteria 13612
69 Ga0068863_100299164 3300005841 Bacteria 1561
70 Ga0068858_100097602 3300005842 Bacteria 2739
71 Ga0068860_100029071 3300005843 Bacteria 5316
72 Ga0105240_10001218 3300009093 Bacteria 44763
73 Ga0105240_10001540 3300009093 Bacteria 39145
74 Ga0105240_10004902 3300009093 Bacteria 20148
75 Ga0105240_10029602 3300009093 Bacteria 7130
76 Ga0105240_10062132 3300009093 Bacteria 4651
77 Ga0105240_10291786 3300009093 Bacteria 1869
78 Ga0105241_10567277 3300009174 Bacteria 1021
79 Ga0105248_10000693 3300009177 Bacteria 38048
80 Ga0105237_10000084 3300009545 Bacteria 125742
81 Ga0105237_10005674 3300009545 Bacteria 14044
82 Ga0105237_10116457 3300009545 Bacteria 2666
83 Ga0105237_10293874 3300009545 Bacteria 1627
84 Ga0105238_10179473 3300009551 Bacteria 2094
85 Ga0105249_10000158 3300009553 Bacteria 82194
86 Ga0105029_100382 3300009984 Bacteria 2320
87 Ga0105239_10000174 3300010375 Bacteria 92922
88 Ga0105239_10025526 3300010375 Bacteria 6505
89 Ga0105239_11014096 3300010375 Bacteria 954
90 Ga0157314_1000668 3300012500 Bacteria 3028
91 Ga0157373_10106471 3300013100 Bacteria 1972
92 Ga0157370_10060736 3300013104 Bacteria 3588
93 Ga0157369_10091186 3300013105 Bacteria 3253
94 Ga0163162_11246943 3300013306 Bacteria 844
95 Ga0163163_10316890 3300014325 Bacteria 1613
96 Ga0157376_10583071 3300014969 Bacteria 1111
97 Ga0182005_1016412 3300015265 Bacteria 2059
98 Ga0183369_1013 3300015685 Bacteria 222738
99 Ga0183368_1003 3300015687 Bacteria 1276390
100 Ga0209435_108470 3300025206 Bacteria 1130
101 Ga0209760_101067 3300025207 Bacteria 3180
102 Ga0209784_100011 3300025224 Bacteria 546770
103 Ga0209674_100012 3300025226 Bacteria 950162
104 Ga0209674_100107 3300025226 Bacteria 151298
105 Ga0209674_100375 3300025226 Bacteria 24206
106 Ga0209674_100892 3300025226 Bacteria 9684
107 Ga0209672_100005 3300025228 Bacteria 1069303
108 Ga0209672_100055 3300025228 Bacteria 221655
109 Ga0209672_100124 3300025228 Bacteria 80646
110 Ga0209672_100621 3300025228 Bacteria 18434
111 Ga0209672_103864 3300025228 Bacteria 2954
112 Ga0209563_100045 3300025230 Bacteria 377102
113 Ga0207427_100026 3300025231 Bacteria 412764
114 Ga0207427_100053 3300025231 Bacteria 217191
115 Ga0209437_100108 3300025233 Bacteria 217191
116 Ga0209437_100241 3300025233 Bacteria 89459
117 Ga0209437_100340 3300025233 Bacteria 56228
118 Ga0209437_101214 3300025233 Bacteria 7441
119 Ga0209258_100006 3300025242 Bacteria 1069303
120 Ga0209258_100012 3300025242 Bacteria 825544
121 Ga0209258_100027 3300025242 Bacteria 518449
122 Ga0209258_100055 3300025242 Bacteria 337291
123 Ga0209258_100892 3300025242 Bacteria 15492
124 Ga0209646_1000776 3300025246 Bacteria 10989
125 Ga0209646_1002993 3300025246 Bacteria 3486
126 Ga0209026_1000018 3300025250 Bacteria 381351
127 Ga0209026_1000172 3300025250 Bacteria 98917
128 Ga0209026_1002761 3300025250 Bacteria 6275
129 Ga0209026_1004676 3300025250 Bacteria 3966
130 Ga0209026_1018271 3300025250 Bacteria 1111
131 Ga0209677_100363 3300025253 Bacteria 27818
132 Ga0209677_101139 3300025253 Bacteria 12420
133 Ga0209148_1000001 3300025254 Bacteria 2545271
134 Ga0209148_1000002 3300025254 Bacteria 2399500
135 Ga0209148_1000012 3300025254 Bacteria 1069303
136 Ga0209148_1000014 3300025254 Bacteria 925277
137 Ga0209148_1000058 3300025254 Bacteria 357482
138 Ga0209148_1001134 3300025254 Bacteria 15620
139 Ga0209759_1000211 3300025256 Bacteria 90002
140 Ga0209759_1001436 3300025256 Bacteria 13447
141 Ga0209759_1001635 3300025256 Bacteria 11838
142 Ga0209759_1002469 3300025256 Bacteria 8098
143 Ga0209759_1003934 3300025256 Bacteria 5720
144 Ga0209129_1003050 3300025258 Bacteria 7582
145 Ga0209129_1004016 3300025258 Bacteria 6033
146 Ga0209233_1000002 3300025261 Bacteria 2501366
147 Ga0209233_1000125 3300025261 Bacteria 217190
148 Ga0209233_1009349 3300025261 Bacteria 2988
149 Ga0209455_1000008 3300025272 Bacteria 1069303
150 Ga0209455_1000014 3300025272 Bacteria 806601
151 Ga0209455_1000018 3300025272 Bacteria 718034
152 Ga0209455_1000019 3300025272 Bacteria 705658
153 Ga0209455_1005366 3300025272 Bacteria 3978
154 Ga0209025_1036469 3300025294 Bacteria 2201
155 Ga0209758_1000862 3300025297 Bacteria 41975
156 Ga0209758_1015223 3300025297 Bacteria 4005
157 Ga0209256_1007070 3300025299 Bacteria 5674
158 Ga0207426_1115466 3300025302 Bacteria 671
159 Ga0207656_10054960 3300025321 Bacteria 1732
160 Ga0207647_10000005 3300025904 Bacteria 223490
161 Ga0207654_10576513 3300025911 Bacteria 801
162 Ga0207695_10000683 3300025913 Bacteria 66533
163 Ga0207695_10000897 3300025913 Bacteria 53743
164 Ga0207695_10001448 3300025913 Bacteria 39707
165 Ga0207695_10017664 3300025913 Bacteria 8287
166 Ga0207695_10047363 3300025913 Bacteria 4551
167 Ga0207671_10000011 3300025914 Bacteria 530349
168 Ga0207671_10009734 3300025914 Bacteria 7999
169 Ga0207671_10293031 3300025914 Bacteria 1285
170 Ga0207649_10078779 3300025920 Bacteria 2127
171 Ga0207706_10096574 3300025933 Bacteria 2599
172 Ga0207670_10108105 3300025936 Bacteria 1999
173 Ga0207711_10000994 3300025941 Bacteria 27213
174 Ga0207667_10000578 3300025949 Bacteria 47763
175 Ga0207667_10001421 3300025949 Bacteria 29981
176 Ga0207667_10585267 3300025949 Bacteria 1126
177 Ga0207712_10000246 3300025961 Bacteria 52868
178 Ga0207712_10380063 3300025961 Bacteria 1182
179 Ga0207640_10000091 3300025981 Bacteria 71621
180 Ga0207640_10002486 3300025981 Bacteria 9873
181 Ga0207658_10000174 3300025986 Bacteria 69513
182 Ga0207703_10022892 3300026035 Bacteria 4908
183 Ga0207639_10037774 3300026041 Bacteria 3589
184 Ga0207678_10001727 3300026067 Bacteria 20011
185 Ga0207678_10314571 3300026067 Bacteria 1346
186 Ga0207702_10000154 3300026078 Bacteria 80923
187 Ga0207702_10632344 3300026078 Bacteria 1052
188 Ga0207641_10043689 3300026088 Bacteria 3765
189 Ga0207674_10000217 3300026116 Bacteria 71594
190 Ga0207674_10052467 3300026116 Bacteria 4159
191 Ga0207698_10446745 3300026142 Bacteria 1247
192 Ga0268266_10029897 3300028379 Bacteria 4629
193 Ga0395899_0000076 3300037312 Bacteria 177673
194 Ga0395899_0122857 3300037312 Bacteria 1858
195 Ga0395900_0000024 3300037418 Bacteria 323480
196 Ga0395898_0000044 3300037466 Bacteria 298164
197 Ga0395898_0000311 3300037466 Bacteria 112412
198 Ga0395901_0019164 3300038443 Bacteria 6995
199 Ga0395901_0038678 3300038443 Bacteria 4934
200 Ga0451847_0861860 3300041503 Bacteria 2513
201 Ga0439449_0024535 3300042007 Bacteria 2254
202 Ga0439459_0011646 3300042438 Bacteria 1552
203 Ga0466982_0000018 3300044672 Bacteria 113912
204 Ga0466965_0024505 3300044683 Bacteria 2919
205 Ga0466965_0084103 3300044683 Bacteria 1611
206 Ga0466966_0012070 3300044684 Bacteria 5724
207 Ga0466966_0683161 3300044684 Bacteria 618
208 Ga0466961_0000688 3300044693 Bacteria 21353
209 Ga0466961_0004138 3300044693 Bacteria 9059
210 Ga0466961_0017474 3300044693 Bacteria 4608
211 Ga0466964_0043181 3300044706 Bacteria 1828
212 Ga0466964_0064772 3300044706 Bacteria 1529
213 Ga0466971_0003730 3300044719 Bacteria 6519
214 Ga0466971_0013497 3300044719 Bacteria 3589
215 Ga0466971_0049263 3300044719 Bacteria 1895
216 Ga0466971_0268694 3300044719 Bacteria 815
217 Ga0466968_0115845 3300044735 Bacteria 1209
218 Ga0466970_0006501 3300044765 Bacteria 5840
219 Ga0466970_0062403 3300044765 Bacteria 1997
220 Ga0466970_0095564 3300044765 Bacteria 1616
221 Ga0466970_0214694 3300044765 Bacteria 1072
222 Ga0466957_0044591 3300044842 Bacteria 2687
223 Ga0466957_0096551 3300044842 Bacteria 1857
224 Ga0466957_0111387 3300044842 Bacteria 1736
225 Ga0466960_0016247 3300044901 Bacteria 3224
226 Ga0466959_0000082 3300045049 Bacteria 59664
227 Ga0466959_0078296 3300045049 Bacteria 2384
228 Ga0466959_0092840 3300045049 Bacteria 2166
229 Ga0466959_0226045 3300045049 Bacteria 1297
230 Ga0466958_0031411 3300045836 Bacteria 3156
231 Ga0495638_0000019 3300046460 Bacteria 384671
232 Ga0495638_0000082 3300046460 Bacteria 153986
233 Ga0495638_0000104 3300046460 Bacteria 135059
234 Ga0495650_0000443 3300046471 Bacteria 66631
235 Ga0495607_0000020 3300046501 Bacteria 164851
236 Ga0495606_0000113 3300046507 Bacteria 136805
237 Ga0495622_0009386 3300046557 Bacteria 4526
238 Ga0495633_0112446 3300046558 Bacteria 1262
239 Ga0495625_0277918 3300046660 Bacteria 1078
240 Ga0495649_0000812 3300046694 Bacteria 25187
241 Ga0495686_0000050 3300047472 Bacteria 269010
242 Ga0495686_0003286 3300047472 Bacteria 14136
243 Ga0496101_0012515 3300048904 Bacteria 5663
244 Ga0496103_0191044 3300048906 Bacteria 1316
245 Ga0496104_0007925 3300048907 Bacteria 9421
246 Ga0496104_0628208 3300048907 Bacteria 983
247 Ga0496105_0010444 3300048908 Bacteria 7299
248 Ga0496106_0044992 3300048909 Bacteria 3315
249 Ga0496112_0121705 3300048915 Bacteria 2580
250 Ga0496113_0001974 3300048916 Bacteria 11753
251 Ga0496114_0686713 3300048917 Bacteria 898
252 Ga0496115_0000247 3300048918 Bacteria 48853
253 Ga0496115_0000642 3300048918 Bacteria 26294
254 Ga0496115_0009183 3300048918 Bacteria 7340
255 Ga0496115_0022033 3300048918 Bacteria 4929
256 Ga0496115_0028959 3300048918 Bacteria 4345
257 Ga0496116_0044342 3300048919 Bacteria 3022
258 Ga0496116_0105097 3300048919 Bacteria 1676
259 Ga0496117_0007794 3300048920 Bacteria 10321
260 Ga0496117_0022078 3300048920 Bacteria 5114
261 Ga0496117_0061857 3300048920 Bacteria 2570
262 Ga0496117_0085933 3300048920 Bacteria 2045
263 Ga0496117_0095520 3300048920 Bacteria 1899
264 Ga0496118_0000576 3300048921 Bacteria 60656
265 Ga0496118_0001308 3300048921 Bacteria 37895
266 Ga0496118_0002040 3300048921 Bacteria 28541
267 Ga0496118_0002883 3300048921 Bacteria 22404
268 Ga0496118_0014166 3300048921 Bacteria 7478
269 Ga0496118_0041798 3300048921 Bacteria 3625
270 Ga0496118_0058634 3300048921 Bacteria 2875
271 Ga0496118_0275284 3300048921 Bacteria 940
272 Ga0496119_0000306 3300048922 Bacteria 68399
273 Ga0496119_0010142 3300048922 Bacteria 7958
274 Ga0496120_0000145 3300048923 Bacteria 119265
275 Ga0496120_0001207 3300048923 Bacteria 32733
276 Ga0496121_0000449 3300048924 Bacteria 81130
277 Ga0496121_0024343 3300048924 Bacteria 5793
278 Ga0496121_0142168 3300048924 Bacteria 1778
279 Ga0496121_0325198 3300048924 Bacteria 1034
280 Ga0496121_0371762 3300048924 Bacteria 945
281 Ga0496122_0000126 3300048925 Bacteria 178362
282 Ga0496122_0038207 3300048925 Bacteria 3851
283 Ga0496123_0000357 3300048926 Bacteria 85815
284 Ga0496123_0041844 3300048926 Bacteria 3170
285 Ga0496124_0102079 3300048927 Bacteria 2322
286 Ga0496125_0000239 3300048928 Bacteria 112926
287 Ga0496125_0011924 3300048928 Bacteria 8660
288 Ga0496125_0168696 3300048928 Bacteria 1475
289 Ga0496126_0003204 3300048929 Bacteria 20984
290 Ga0496126_0023689 3300048929 Bacteria 5946
291 Ga0496126_0043996 3300048929 Bacteria 4115
292 Ga0496126_0046020 3300048929 Bacteria 4006
293 Ga0496126_0197120 3300048929 Bacteria 1702
294 Ga0495678_022387 3300049459 Bacteria 2763
295 Ga0501031_0785683 3300049568 Bacteria 610
296 Ga0501032_0179067 3300049569 Bacteria 1388
297 Ga0501033_0016039 3300049570 Bacteria 5673
298 Ga0501034_0452690 3300049571 Bacteria 1201
299 Ga0501042_0158667 3300049578 Bacteria 1632
300 Ga0501043_0004971 3300049579 Bacteria 10756
301 Ga0501043_0096840 3300049579 Bacteria 2319
302 Ga0501043_0315482 3300049579 Bacteria 1192
303 Ga0501046_0030348 3300049580 Bacteria 4387
304 Ga0501047_0124665 3300049581 Bacteria 2456
305 Ga0501047_0661838 3300049581 Bacteria 863
306 Ga0501048_0090128 3300049582 Bacteria 2163
307 Ga0501070_0088438 3300049586 Bacteria 2564
308 Ga0501275_000098 3300049772 Bacteria 9101
309 Ga0501035_0002732 3300049822 Bacteria 17120
310 Ga0501035_0038459 3300049822 Bacteria 4331
311 Ga0501035_0150042 3300049822 Bacteria 2023
312 Ga0501044_0036617 3300049823 Bacteria 5133
313 Ga0501044_0042642 3300049823 Bacteria 4718
314 Ga0501044_0057135 3300049823 Bacteria 4004
315 Ga0501044_0239749 3300049823 Bacteria 1757
316 Ga0500597_000127 3300053120 Bacteria 15671
317 Ga0500634_0000887 3300053161 Bacteria 10674
318 Ga0466962_0009105 3300061719 Bacteria 4755
319 Ga0466962_0011224 3300061719 Bacteria 4314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2738543009 2739226372 174
2 iso_pu_bacteria 2593339238 2595449191 175
3 iso_pu_bacteria 2593339239 2595450477 175
4 iso_pu_bacteria 2884338543 2884342410 175
5 iso_pu_bacteria 2941471342 2941474968 175
6 3300049823 Ga0501044_0239749 Ga0501044_0239749_1034_1591 177
7 3300053161 Ga0500634_0000887 Ga0500634_0000887_326_862 177
8 iso_pu_bacteria 2643221685 2644477830 177
9 iso_pu_bacteria 2739367700 2739732432 177
10 iso_pu_bacteria 2884411467 2884411661 177
11 iso_pu_bacteria 2928963466 2928965110 177
12 3300002705 JGI25156J39149_1016672 JGI25156J39149_10166722 178
13 3300002737 JGI25162J39368_1001197 JGI25162J39368_100119718 178
14 3300002741 JGI25157J39369_1001556 JGI25157J39369_10015565 178
15 3300002772 JGI25164J39214_1000030 JGI25164J39214_100003051 178
16 3300003214 JGI25165J46597_1000057 JGI25165J46597_100005775 178
17 3300003752 Ga0055539_1002887 Ga0055539_10028872 178
18 3300003759 Ga0055525_1000093 Ga0055525_100009319 178
19 3300003760 Ga0055527_1000245 Ga0055527_100024518 178
20 3300003760 Ga0055527_1000491 Ga0055527_10004914 178
21 3300003760 Ga0055527_1004210 Ga0055527_10042102 178
22 3300003761 Ga0055535_1000901 Ga0055535_10009018 178
23 3300003761 Ga0055535_1001247 Ga0055535_100124710 178
24 3300003761 Ga0055535_1002739 Ga0055535_10027395 178
25 3300003762 Ga0055542_1000544 Ga0055542_100054417 178
26 3300003762 Ga0055542_1001155 Ga0055542_100115513 178
27 3300003762 Ga0055542_1001236 Ga0055542_10012364 178
28 3300003763 Ga0055529_1000588 Ga0055529_100058810 178
29 3300003763 Ga0055529_1000941 Ga0055529_10009414 178
30 3300003763 Ga0055529_1000982 Ga0055529_10009824 178
31 3300005614 Ga0068856_100007414 Ga0068856_1000074145 178
32 3300025226 Ga0209674_100107 Ga0209674_100107124 178
33 3300025226 Ga0209674_100892 Ga0209674_1008922 178
34 3300025228 Ga0209672_100005 Ga0209672_100005200 178
35 3300025228 Ga0209672_100055 Ga0209672_100055123 178
36 3300025228 Ga0209672_100124 Ga0209672_10012419 178
37 3300025230 Ga0209563_100045 Ga0209563_100045108 178
38 3300025231 Ga0207427_100053 Ga0207427_100053110 178
39 3300025233 Ga0209437_100108 Ga0209437_10010873 178
40 3300025242 Ga0209258_100006 Ga0209258_100006200 178
41 3300025242 Ga0209258_100012 Ga0209258_10001270 178
42 3300025242 Ga0209258_100055 Ga0209258_10005555 178
43 3300025246 Ga0209646_1002993 Ga0209646_10029934 178
44 3300025250 Ga0209026_1000172 Ga0209026_100017219 178
45 3300025250 Ga0209026_1004676 Ga0209026_10046764 178
46 3300025253 Ga0209677_100363 Ga0209677_10036310 178
47 3300025253 Ga0209677_101139 Ga0209677_10113910 178
48 3300025254 Ga0209148_1000012 Ga0209148_1000012200 178
49 3300025254 Ga0209148_1000014 Ga0209148_1000014585 178
50 3300025254 Ga0209148_1000058 Ga0209148_1000058216 178
51 3300025256 Ga0209759_1000211 Ga0209759_10002113 178
52 3300025256 Ga0209759_1001635 Ga0209759_10016352 178
53 3300025256 Ga0209759_1003934 Ga0209759_10039345 178
54 3300025261 Ga0209233_1000125 Ga0209233_1000125110 178
55 3300025272 Ga0209455_1000008 Ga0209455_1000008200 178
56 3300025272 Ga0209455_1000014 Ga0209455_1000014473 178
57 3300025272 Ga0209455_1000018 Ga0209455_1000018216 178
58 3300026078 Ga0207702_10000154 Ga0207702_100001544 178
59 3300037312 Ga0395899_0000076 Ga0395899_0000076_4003_4554 178
60 3300037312 Ga0395899_0122857 Ga0395899_0122857_1113_1664 178
61 3300037466 Ga0395898_0000044 Ga0395898_0000044_17409_17960 178
62 3300037466 Ga0395898_0000311 Ga0395898_0000311_37953_38504 178
63 3300038443 Ga0395901_0019164 Ga0395901_0019164_2889_3440 178
64 3300042438 Ga0439459_0011646 Ga0439459_0011646_224_781 178
65 3300044683 Ga0466965_0084103 Ga0466965_0084103_804_1352 178
66 3300044684 Ga0466966_0683161 Ga0466966_0683161_50_601 178
67 3300044693 Ga0466961_0000688 Ga0466961_0000688_7702_8250 178
68 3300044693 Ga0466961_0004138 Ga0466961_0004138_794_1345 178
69 3300044693 Ga0466961_0017474 Ga0466961_0017474_645_1196 178
70 3300044706 Ga0466964_0043181 Ga0466964_0043181_823_1374 178
71 3300044719 Ga0466971_0003730 Ga0466971_0003730_1672_2241 178
72 3300044719 Ga0466971_0049263 Ga0466971_0049263_1157_1708 178
73 3300044719 Ga0466971_0268694 Ga0466971_0268694_99_650 178
74 3300044735 Ga0466968_0115845 Ga0466968_0115845_216_767 178
75 3300044765 Ga0466970_0006501 Ga0466970_0006501_4585_5136 178
76 3300044765 Ga0466970_0062403 Ga0466970_0062403_156_707 178
77 3300044765 Ga0466970_0095564 Ga0466970_0095564_1010_1594 178
78 3300044842 Ga0466957_0044591 Ga0466957_0044591_839_1390 178
79 3300044842 Ga0466957_0096551 Ga0466957_0096551_426_1010 178
80 3300044842 Ga0466957_0111387 Ga0466957_0111387_217_768 178
81 3300045049 Ga0466959_0000082 Ga0466959_0000082_57913_58464 178
82 3300045049 Ga0466959_0078296 Ga0466959_0078296_1680_2228 178
83 3300045049 Ga0466959_0092840 Ga0466959_0092840_843_1394 178
84 3300045836 Ga0466958_0031411 Ga0466958_0031411_291_842 178
85 3300046460 Ga0495638_0000019 Ga0495638_0000019_253944_254495 178
86 3300061719 Ga0466962_0009105 Ga0466962_0009105_4173_4724 178
87 3300001904 JGI24736J21556_1000945 JGI24736J21556_10009455 179
88 3300001979 JGI24740J21852_10043095 JGI24740J21852_100430952 179
89 3300001990 JGI24737J22298_10007214 JGI24737J22298_100072142 179
90 3300002067 JGI24735J21928_10005341 JGI24735J21928_100053413 179
91 3300002067 JGI24735J21928_10043711 JGI24735J21928_100437112 179
92 3300002067 JGI24735J21928_10044892 JGI24735J21928_100448922 179
93 3300002737 JGI25162J39368_1000666 JGI25162J39368_100066616 179
94 3300002741 JGI25157J39369_1000579 JGI25157J39369_100057914 179
95 3300002741 JGI25157J39369_1022196 JGI25157J39369_10221962 179
96 3300002771 JGI25163J39215_1000216 JGI25163J39215_100021611 179
97 3300002772 JGI25164J39214_1000093 JGI25164J39214_100009311 179
98 3300002773 JGI25152J39213_1019278 JGI25152J39213_10192782 179
99 3300003214 JGI25165J46597_1000759 JGI25165J46597_100075917 179
100 3300003316 rootH1_10033986 rootH1_100339862 179
101 3300003320 rootH2_10032037 rootH2_1003203715 179
102 3300003320 rootH2_10214272 rootH2_102142722 179
103 3300003322 rootL2_10053837 rootL2_100538372 179
104 3300003323 rootH1_10152318 rootH1_101523185 179
105 3300003578 Ga0006562J51391_1038928 Ga0006562J51391_103892815 179
106 3300003578 Ga0006562J51391_1038931 Ga0006562J51391_10389312 179
107 3300003751 Ga0055538_1000881 Ga0055538_10008812 179
108 3300003756 Ga0055533_1002229 Ga0055533_10022294 179
109 3300003761 Ga0055535_1000152 Ga0055535_100015261 179
110 3300003762 Ga0055542_1000753 Ga0055542_100075310 179
111 3300003762 Ga0055542_1000769 Ga0055542_100076911 179
112 3300003763 Ga0055529_1000082 Ga0055529_1000082118 179
113 3300005262 Ga0065165_1006031 Ga0065165_10060316 179
114 3300005340 Ga0070689_100000610 Ga0070689_10000061026 179
115 3300005344 Ga0070661_100204277 Ga0070661_1002042772 179
116 3300005455 Ga0070663_100000263 Ga0070663_10000026315 179
117 3300005455 Ga0070663_100038583 Ga0070663_1000385834 179
118 3300005455 Ga0070663_100084923 Ga0070663_1000849231 179
119 3300005457 Ga0070662_100418885 Ga0070662_1004188852 179
120 3300005539 Ga0068853_100000138 Ga0068853_10000013833 179
121 3300005539 Ga0068853_100000391 Ga0068853_1000003916 179
122 3300005548 Ga0070665_100017248 Ga0070665_1000172485 179
123 3300005563 Ga0068855_100005293 Ga0068855_10000529310 179
124 3300005563 Ga0068855_100010686 Ga0068855_10001068610 179
125 3300005563 Ga0068855_100069657 Ga0068855_1000696573 179
126 3300005564 Ga0070664_100238422 Ga0070664_1002384222 179
127 3300005577 Ga0068857_100002273 Ga0068857_1000022736 179
128 3300005577 Ga0068857_100041080 Ga0068857_1000410804 179
129 3300005578 Ga0068854_100002661 Ga0068854_1000026613 179
130 3300005578 Ga0068854_100006581 Ga0068854_1000065812 179
131 3300005614 Ga0068856_100467310 Ga0068856_1004673102 179
132 3300005614 Ga0068856_100733378 Ga0068856_1007333782 179
133 3300005616 Ga0068852_100066732 Ga0068852_1000667323 179
134 3300005834 Ga0068851_10000797 Ga0068851_100007973 179
135 3300005841 Ga0068863_100299164 Ga0068863_1002991642 179
136 3300005842 Ga0068858_100097602 Ga0068858_1000976022 179
137 3300005843 Ga0068860_100029071 Ga0068860_1000290712 179
138 3300009093 Ga0105240_10001218 Ga0105240_1000121820 179
139 3300009093 Ga0105240_10001540 Ga0105240_1000154018 179
140 3300009093 Ga0105240_10004902 Ga0105240_100049023 179
141 3300009093 Ga0105240_10029602 Ga0105240_100296023 179
142 3300009093 Ga0105240_10062132 Ga0105240_100621323 179
143 3300009093 Ga0105240_10291786 Ga0105240_102917862 179
144 3300009174 Ga0105241_10567277 Ga0105241_105672772 179
145 3300009177 Ga0105248_10000693 Ga0105248_1000069326 179
146 3300009545 Ga0105237_10000084 Ga0105237_1000008439 179
147 3300009545 Ga0105237_10005674 Ga0105237_100056746 179
148 3300009545 Ga0105237_10116457 Ga0105237_101164572 179
149 3300009545 Ga0105237_10293874 Ga0105237_102938742 179
150 3300009551 Ga0105238_10179473 Ga0105238_101794732 179
151 3300009553 Ga0105249_10000158 Ga0105249_1000015863 179
152 3300009984 Ga0105029_100382 Ga0105029_1003822 179
153 3300010375 Ga0105239_10000174 Ga0105239_1000017436 179
154 3300010375 Ga0105239_10025526 Ga0105239_100255266 179
155 3300010375 Ga0105239_11014096 Ga0105239_110140962 179
156 3300012500 Ga0157314_1000668 Ga0157314_10006682 179
157 3300013100 Ga0157373_10106471 Ga0157373_101064713 179
158 3300013104 Ga0157370_10060736 Ga0157370_100607363 179
159 3300013105 Ga0157369_10091186 Ga0157369_100911862 179
160 3300013306 Ga0163162_11246943 Ga0163162_112469431 179
161 3300014325 Ga0163163_10316890 Ga0163163_103168902 179
162 3300014969 Ga0157376_10583071 Ga0157376_105830712 179
163 3300015265 Ga0182005_1016412 Ga0182005_10164122 179
164 3300015685 Ga0183369_1013 Ga0183369_101348 179
165 3300015687 Ga0183368_1003 Ga0183368_1003403 179
166 3300025206 Ga0209435_108470 Ga0209435_1084702 179
167 3300025207 Ga0209760_101067 Ga0209760_1010675 179
168 3300025224 Ga0209784_100011 Ga0209784_100011431 179
169 3300025226 Ga0209674_100012 Ga0209674_100012145 179
170 3300025226 Ga0209674_100375 Ga0209674_10037510 179
171 3300025228 Ga0209672_100621 Ga0209672_10062116 179
172 3300025228 Ga0209672_103864 Ga0209672_1038642 179
173 3300025231 Ga0207427_100026 Ga0207427_100026319 179
174 3300025233 Ga0209437_100241 Ga0209437_10024110 179
175 3300025233 Ga0209437_100340 Ga0209437_10034039 179
176 3300025233 Ga0209437_101214 Ga0209437_1012145 179
177 3300025242 Ga0209258_100027 Ga0209258_100027116 179
178 3300025242 Ga0209258_100892 Ga0209258_10089213 179
179 3300025246 Ga0209646_1000776 Ga0209646_100077610 179
180 3300025250 Ga0209026_1000018 Ga0209026_100001810 179
181 3300025250 Ga0209026_1002761 Ga0209026_10027617 179
182 3300025250 Ga0209026_1018271 Ga0209026_10182712 179
183 3300025254 Ga0209148_1000001 Ga0209148_1000001854 179
184 3300025254 Ga0209148_1000002 Ga0209148_1000002965 179
185 3300025254 Ga0209148_1001134 Ga0209148_100113414 179
186 3300025256 Ga0209759_1001436 Ga0209759_10014364 179
187 3300025256 Ga0209759_1002469 Ga0209759_10024697 179
188 3300025258 Ga0209129_1003050 Ga0209129_10030506 179
189 3300025258 Ga0209129_1004016 Ga0209129_10040162 179
190 3300025261 Ga0209233_1000002 Ga0209233_10000021376 179
191 3300025261 Ga0209233_1009349 Ga0209233_10093492 179
192 3300025272 Ga0209455_1000019 Ga0209455_1000019183 179
193 3300025272 Ga0209455_1005366 Ga0209455_10053665 179
194 3300025294 Ga0209025_1036469 Ga0209025_10364692 179
195 3300025297 Ga0209758_1000862 Ga0209758_100086211 179
196 3300025297 Ga0209758_1015223 Ga0209758_10152233 179
197 3300025299 Ga0209256_1007070 Ga0209256_10070705 179
198 3300025302 Ga0207426_1115466 Ga0207426_11154661 179
199 3300025321 Ga0207656_10054960 Ga0207656_100549602 179
200 3300025904 Ga0207647_10000005 Ga0207647_1000000551 179
201 3300025911 Ga0207654_10576513 Ga0207654_105765132 179
202 3300025913 Ga0207695_10000683 Ga0207695_1000068332 179
203 3300025913 Ga0207695_10000897 Ga0207695_1000089724 179
204 3300025913 Ga0207695_10001448 Ga0207695_1000144818 179
205 3300025913 Ga0207695_10017664 Ga0207695_100176646 179
206 3300025913 Ga0207695_10047363 Ga0207695_100473633 179
207 3300025914 Ga0207671_10000011 Ga0207671_10000011334 179
208 3300025914 Ga0207671_10009734 Ga0207671_100097346 179
209 3300025914 Ga0207671_10293031 Ga0207671_102930312 179
210 3300025920 Ga0207649_10078779 Ga0207649_100787792 179
211 3300025933 Ga0207706_10096574 Ga0207706_100965743 179
212 3300025936 Ga0207670_10108105 Ga0207670_101081052 179
213 3300025941 Ga0207711_10000994 Ga0207711_1000099417 179
214 3300025949 Ga0207667_10000578 Ga0207667_1000057828 179
215 3300025949 Ga0207667_10001421 Ga0207667_1000142120 179
216 3300025949 Ga0207667_10585267 Ga0207667_105852672 179
217 3300025961 Ga0207712_10000246 Ga0207712_1000024637 179
218 3300025961 Ga0207712_10380063 Ga0207712_103800632 179
219 3300025981 Ga0207640_10000091 Ga0207640_1000009130 179
220 3300025981 Ga0207640_10002486 Ga0207640_100024868 179
221 3300025986 Ga0207658_10000174 Ga0207658_1000017430 179
222 3300026035 Ga0207703_10022892 Ga0207703_100228922 179
223 3300026041 Ga0207639_10037774 Ga0207639_100377742 179
224 3300026067 Ga0207678_10001727 Ga0207678_100017273 179
225 3300026067 Ga0207678_10314571 Ga0207678_103145712 179
226 3300026078 Ga0207702_10632344 Ga0207702_106323442 179
227 3300026088 Ga0207641_10043689 Ga0207641_100436894 179
228 3300026116 Ga0207674_10000217 Ga0207674_1000021739 179
229 3300026116 Ga0207674_10052467 Ga0207674_100524673 179
230 3300026142 Ga0207698_10446745 Ga0207698_104467452 179
231 3300028379 Ga0268266_10029897 Ga0268266_100298974 179
232 3300037418 Ga0395900_0000024 Ga0395900_0000024_270666_271220 179
233 3300038443 Ga0395901_0038678 Ga0395901_0038678_3388_3942 179
234 3300041503 Ga0451847_0861860 Ga0451847_0861860_1087_1650 179
235 3300042007 Ga0439449_0024535 Ga0439449_0024535_13_570 179
236 3300044672 Ga0466982_0000018 Ga0466982_0000018_13701_14261 179
237 3300044683 Ga0466965_0024505 Ga0466965_0024505_1698_2258 179
238 3300044684 Ga0466966_0012070 Ga0466966_0012070_541_1101 179
239 3300044706 Ga0466964_0064772 Ga0466964_0064772_647_1207 179
240 3300044719 Ga0466971_0013497 Ga0466971_0013497_1209_1769 179
241 3300044765 Ga0466970_0214694 Ga0466970_0214694_190_750 179
242 3300044901 Ga0466960_0016247 Ga0466960_0016247_117_677 179
243 3300045049 Ga0466959_0226045 Ga0466959_0226045_380_940 179
244 3300046460 Ga0495638_0000082 Ga0495638_0000082_143705_144283 179
245 3300046460 Ga0495638_0000104 Ga0495638_0000104_124840_125418 179
246 3300046471 Ga0495650_0000443 Ga0495650_0000443_53886_54464 179
247 3300046501 Ga0495607_0000020 Ga0495607_0000020_38136_38675 179
248 3300046507 Ga0495606_0000113 Ga0495606_0000113_44745_45323 179
249 3300046557 Ga0495622_0009386 Ga0495622_0009386_2444_3022 179
250 3300046558 Ga0495633_0112446 Ga0495633_0112446_143_721 179
251 3300046660 Ga0495625_0277918 Ga0495625_0277918_40_618 179
252 3300046694 Ga0495649_0000812 Ga0495649_0000812_3561_4139 179
253 3300047472 Ga0495686_0000050 Ga0495686_0000050_191960_192499 179
254 3300047472 Ga0495686_0003286 Ga0495686_0003286_6433_6990 179
255 3300048904 Ga0496101_0012515 Ga0496101_0012515_2229_2777 179
256 3300048906 Ga0496103_0191044 Ga0496103_0191044_105_653 179
257 3300048907 Ga0496104_0007925 Ga0496104_0007925_6892_7440 179
258 3300048907 Ga0496104_0628208 Ga0496104_0628208_197_763 179
259 3300048908 Ga0496105_0010444 Ga0496105_0010444_1830_2378 179
260 3300048909 Ga0496106_0044992 Ga0496106_0044992_1043_1582 179
261 3300048915 Ga0496112_0121705 Ga0496112_0121705_372_938 179
262 3300048916 Ga0496113_0001974 Ga0496113_0001974_3454_4020 179
263 3300048917 Ga0496114_0686713 Ga0496114_0686713_91_669 179
264 3300048918 Ga0496115_0000247 Ga0496115_0000247_45682_46248 179
265 3300048918 Ga0496115_0000642 Ga0496115_0000642_11977_12555 179
266 3300048918 Ga0496115_0009183 Ga0496115_0009183_1813_2391 179
267 3300048918 Ga0496115_0022033 Ga0496115_0022033_3812_4360 179
268 3300048918 Ga0496115_0028959 Ga0496115_0028959_319_897 179
269 3300048919 Ga0496116_0044342 Ga0496116_0044342_224_772 179
270 3300048919 Ga0496116_0105097 Ga0496116_0105097_627_1166 179
271 3300048920 Ga0496117_0007794 Ga0496117_0007794_8869_9417 179
272 3300048920 Ga0496117_0022078 Ga0496117_0022078_3515_4054 179
273 3300048920 Ga0496117_0061857 Ga0496117_0061857_1241_1801 179
274 3300048920 Ga0496117_0085933 Ga0496117_0085933_878_1426 179
275 3300048920 Ga0496117_0095520 Ga0496117_0095520_267_806 179
276 3300048921 Ga0496118_0000576 Ga0496118_0000576_22997_23557 179
277 3300048921 Ga0496118_0001308 Ga0496118_0001308_14352_14900 179
278 3300048921 Ga0496118_0002040 Ga0496118_0002040_27027_27566 179
279 3300048921 Ga0496118_0002883 Ga0496118_0002883_21284_21832 179
280 3300048921 Ga0496118_0014166 Ga0496118_0014166_6542_7081 179
281 3300048921 Ga0496118_0041798 Ga0496118_0041798_2589_3128 179
282 3300048921 Ga0496118_0058634 Ga0496118_0058634_1597_2154 179
283 3300048921 Ga0496118_0275284 Ga0496118_0275284_264_824 179
284 3300048922 Ga0496119_0000306 Ga0496119_0000306_35204_35752 179
285 3300048922 Ga0496119_0010142 Ga0496119_0010142_4100_4648 179
286 3300048923 Ga0496120_0000145 Ga0496120_0000145_92957_93505 179
287 3300048923 Ga0496120_0001207 Ga0496120_0001207_18793_19341 179
288 3300048924 Ga0496121_0000449 Ga0496121_0000449_53544_54083 179
289 3300048924 Ga0496121_0024343 Ga0496121_0024343_4481_5038 179
290 3300048924 Ga0496121_0142168 Ga0496121_0142168_779_1357 179
291 3300048924 Ga0496121_0325198 Ga0496121_0325198_261_824 179
292 3300048924 Ga0496121_0371762 Ga0496121_0371762_127_687 179
293 3300048925 Ga0496122_0000126 Ga0496122_0000126_109210_109767 179
294 3300048925 Ga0496122_0038207 Ga0496122_0038207_703_1242 179
295 3300048926 Ga0496123_0000357 Ga0496123_0000357_42498_43055 179
296 3300048926 Ga0496123_0041844 Ga0496123_0041844_1615_2154 179
297 3300048927 Ga0496124_0102079 Ga0496124_0102079_614_1153 179
298 3300048928 Ga0496125_0000239 Ga0496125_0000239_78514_79071 179
299 3300048928 Ga0496125_0011924 Ga0496125_0011924_4979_5518 179
300 3300048928 Ga0496125_0168696 Ga0496125_0168696_426_1004 179
301 3300048929 Ga0496126_0003204 Ga0496126_0003204_12863_13411 179
302 3300048929 Ga0496126_0023689 Ga0496126_0023689_3789_4367 179
303 3300048929 Ga0496126_0043996 Ga0496126_0043996_1031_1570 179
304 3300048929 Ga0496126_0046020 Ga0496126_0046020_101_676 179
305 3300048929 Ga0496126_0197120 Ga0496126_0197120_448_1026 179
306 3300049459 Ga0495678_022387 Ga0495678_022387_2080_2658 179
307 3300049568 Ga0501031_0785683 Ga0501031_0785683_24_572 179
308 3300049569 Ga0501032_0179067 Ga0501032_0179067_172_720 179
309 3300049570 Ga0501033_0016039 Ga0501033_0016039_292_840 179
310 3300049571 Ga0501034_0452690 Ga0501034_0452690_19_588 179
311 3300049578 Ga0501042_0158667 Ga0501042_0158667_115_663 179
312 3300049579 Ga0501043_0004971 Ga0501043_0004971_1868_2419 179
313 3300049579 Ga0501043_0096840 Ga0501043_0096840_1547_2095 179
314 3300049579 Ga0501043_0315482 Ga0501043_0315482_45_593 179
315 3300049580 Ga0501046_0030348 Ga0501046_0030348_80_628 179
316 3300049581 Ga0501047_0124665 Ga0501047_0124665_1199_1747 179
317 3300049581 Ga0501047_0661838 Ga0501047_0661838_188_820 179
318 3300049582 Ga0501048_0090128 Ga0501048_0090128_1405_1953 179
319 3300049586 Ga0501070_0088438 Ga0501070_0088438_1275_1823 179
320 3300049772 Ga0501275_000098 Ga0501275_000098_7786_8358 179
321 3300049822 Ga0501035_0002732 Ga0501035_0002732_5475_6041 179
322 3300049822 Ga0501035_0038459 Ga0501035_0038459_3165_3743 179
323 3300049822 Ga0501035_0150042 Ga0501035_0150042_229_777 179
324 3300049823 Ga0501044_0036617 Ga0501044_0036617_4285_4851 179
325 3300049823 Ga0501044_0042642 Ga0501044_0042642_826_1404 179
326 3300049823 Ga0501044_0057135 Ga0501044_0057135_72_620 179
327 3300053120 Ga0500597_000127 Ga0500597_000127_10314_10871 179
328 3300061719 Ga0466962_0011224 Ga0466962_0011224_1813_2373 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

5

183

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.9256 2 174
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.9196 2 179
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.91 2 179
6s2q-assembly2.cif.gz_C mycobacterial hydrolase 1 0.8983 2 174
4qih-assembly1.cif.gz_A the structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 0.8976 2 176
ID Description Score Start End Superfamily
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9196 2 179 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.91 2 179 3.40.50.1240
af_P0A7A2_1_211_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8991 1 179 3.40.50.1240
af_P9WLH5_165_364_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8979 1 174 3.40.50.1240
af_P0A7A2_1_211_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8944 1 179 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A7W5J0Z6-F1-model_v4 Alpha-ribazole phosphatase (EC 3.1.3.73) 0.9992 3 177 GO:0005737
GO:0043755
AF-A0A561H5X2-F1-model_v4 deleted 0.9966 1 179
AF-A0A1J1E6D9-F1-model_v4 deleted 0.9966 2 179
AF-B0RPV0-F1-model_v4 Alpha-ribazole phosphatase (EC 3.1.3.73) 0.9952 2 178 GO:0005737
GO:0043755
AF-A0A1J1E6D9-F1-model_v4 deleted 0.9855 2 179

Feature Viewer

pLDDT pTM Quality
95.38 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map