F409262

General Info

Members Datasets Scaffolds Average Seq Length
328 216 656 200

Family's Representative Sequence

Representative Sequence 3300025272|Ga0209455_1009015|Ga0209455_10090154
Length 213
Sequence MGFFTNRGFQPKRPSNPKLPPGQYETTDFPVLTAGPTPRINLANWEFRLEGLVENPVKWSWEEFNKLPMQDFNPDIHCVTKWSKFDTHWRGVSVDTLLEHVQLKPEAQFVTEFSYGGYTTNLPLADLRGGKAFVGLLYDGQPLAPEHGGPARLVVPHLYFWKSAKWVQGLRFTAQDEPGFWERAGYSMYGDPWKEQRYDTDDEDLASSPGSRQ

Samples

Sample ID Description Type Environment
1 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
133 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
134 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
135 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
136 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
139 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
211 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
214 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 3.66
Rhizosphere 94.21
Stem 0
Stem Tuber 0
Unclassified 7.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209455_1009015 3300025272 Bacteria 2652
2 JGI25406J46586_10033858 3300003203 Bacteria 1881
3 JGI25407J50210_10013196 3300003373 Bacteria 2123
4 JGI25404J52841_10000710 3300003659 Bacteria 5157
5 Ga0058862_10027256 3300004803 Bacteria 2206
6 Ga0070658_10006188 3300005327 Bacteria 9702
7 Ga0070683_100010464 3300005329 Bacteria 7976
8 Ga0070683_100134405 3300005329 Bacteria 2342
9 Ga0070690_100021896 3300005330 Bacteria 3906
10 Ga0070680_100161954 3300005336 Bacteria 1880
11 Ga0068868_100184281 3300005338 Bacteria 1733
12 Ga0070660_100092889 3300005339 Bacteria 2382
13 Ga0070660_100124863 3300005339 Bacteria 2056
14 Ga0070661_100096868 3300005344 Bacteria 2190
15 Ga0070659_100052718 3300005366 Bacteria 3200
16 Ga0070709_10036265 3300005434 Bacteria 3003
17 Ga0070714_100028561 3300005435 Bacteria 4630
18 Ga0070714_101351407 3300005435 Bacteria 696
19 Ga0070713_100266069 3300005436 Bacteria 1568
20 Ga0070713_100503787 3300005436 Bacteria 1143
21 Ga0070713_100985650 3300005436 Bacteria 813
22 Ga0070710_10219230 3300005437 Bacteria 1210
23 Ga0070710_10233804 3300005437 Bacteria 1174
24 Ga0070710_10364453 3300005437 Bacteria 960
25 Ga0070711_100033471 3300005439 Bacteria 3422
26 Ga0070711_100801244 3300005439 Unclassified 799
27 Ga0070711_100921369 3300005439 Bacteria 747
28 Ga0070705_100556023 3300005440 Bacteria 881
29 Ga0070708_100033026 3300005445 Bacteria 4495
30 Ga0070708_100431746 3300005445 Bacteria 1242
31 Ga0070681_10035695 3300005458 Bacteria 4993
32 Ga0070681_10281711 3300005458 Bacteria 1573
33 Ga0070706_100033726 3300005467 Unclassified 4726
34 Ga0070706_100033755 3300005467 Unclassified 4724
35 Ga0070706_100087470 3300005467 Bacteria 2888
36 Ga0070706_100124889 3300005467 Bacteria 2399
37 Ga0070706_100283046 3300005467 Bacteria 1547
38 Ga0070707_100034940 3300005468 Bacteria 4793
39 Ga0070707_100364633 3300005468 Bacteria 1403
40 Ga0070698_100027592 3300005471 Bacteria 5902
41 Ga0070698_100028411 3300005471 Bacteria 5809
42 Ga0070698_100036747 3300005471 Bacteria 5055
43 Ga0070698_100311260 3300005471 Bacteria 1506
44 Ga0070698_100630867 3300005471 Bacteria 1013
45 Ga0070699_100005638 3300005518 Bacteria 10973
46 Ga0070699_100185642 3300005518 Bacteria 1846
47 Ga0070699_100413090 3300005518 Unclassified 1221
48 Ga0070679_100006502 3300005530 Bacteria 10897
49 Ga0070679_100048723 3300005530 Bacteria 4220
50 Ga0070679_100407096 3300005530 Bacteria 1306
51 Ga0070684_100239565 3300005535 Bacteria 1657
52 Ga0070697_100012537 3300005536 Bacteria 6642
53 Ga0070697_100021591 3300005536 Bacteria 5102
54 Ga0070697_100025953 3300005536 Unclassified 4674
55 Ga0070697_100118311 3300005536 Bacteria 2214
56 Ga0070697_100161924 3300005536 Unclassified 1890
57 Ga0068853_100022641 3300005539 Bacteria 5250
58 Ga0068853_100470395 3300005539 Bacteria 1184
59 Ga0070695_100389259 3300005545 Bacteria 1054
60 Ga0070696_100518200 3300005546 Unclassified 951
61 Ga0070704_100632055 3300005549 Unclassified 944
62 Ga0068855_100503418 3300005563 Bacteria 1316
63 Ga0070664_100024821 3300005564 Bacteria 4964
64 Ga0070664_100455820 3300005564 Bacteria 1174
65 Ga0070664_100718293 3300005564 Bacteria 932
66 Ga0068857_100000277 3300005577 Bacteria 35101
67 Ga0068857_100422237 3300005577 Bacteria 1243
68 Ga0068854_100189856 3300005578 Bacteria 1609
69 Ga0068856_100651158 3300005614 Bacteria 1074
70 Ga0068859_100221810 3300005617 Bacteria 1978
71 Ga0068864_100019820 3300005618 Bacteria 5623
72 Ga0068863_101030090 3300005841 Bacteria 826
73 Ga0068858_100060778 3300005842 Bacteria 3492
74 Ga0068860_100161008 3300005843 Bacteria 2164
75 Ga0081455_10002026 3300005937 Bacteria 24232
76 Ga0081455_10004221 3300005937 Bacteria 16199
77 Ga0081455_10052070 3300005937 Bacteria 3507
78 Ga0081538_10012908 3300005981 Bacteria 6660
79 Ga0081540_1000118 3300005983 Bacteria 84097
80 Ga0081540_1000162 3300005983 Bacteria 68999
81 Ga0081540_1000379 3300005983 Bacteria 44561
82 Ga0081540_1117007 3300005983 Bacteria 1114
83 Ga0081539_10011696 3300005985 Bacteria 6897
84 Ga0070717_10276866 3300006028 Bacteria 1487
85 Ga0070717_10743742 3300006028 Bacteria 891
86 Ga0075363_100179241 3300006048 Bacteria 1205
87 Ga0070715_10136154 3300006163 Bacteria 1187
88 Ga0070716_100322557 3300006173 Unclassified 1083
89 Ga0070712_100026366 3300006175 Bacteria 3870
90 Ga0070712_100032209 3300006175 Bacteria 3538
91 Ga0070712_100058558 3300006175 Bacteria 2710
92 Ga0070712_100107143 3300006175 Bacteria 2079
93 Ga0075428_100006286 3300006844 Bacteria 13203
94 Ga0075430_100011303 3300006846 Bacteria 7571
95 Ga0075431_100012310 3300006847 Bacteria 8631
96 Ga0075431_100117347 3300006847 Bacteria 2746
97 Ga0075433_10178646 3300006852 Bacteria 1889
98 Ga0075433_10365946 3300006852 Bacteria 1273
99 Ga0075434_100104612 3300006871 Bacteria 2840
100 Ga0075434_100261539 3300006871 Unclassified 1749
101 Ga0075434_100447814 3300006871 Unclassified 1312
102 Ga0075429_100009116 3300006880 Bacteria 8612
103 Ga0075429_100325824 3300006880 Bacteria 1344
104 Ga0075436_100080286 3300006914 Bacteria 2260
105 Ga0075436_100209888 3300006914 Bacteria 1380
106 Ga0075435_100141355 3300007076 Bacteria 2020
107 Ga0099794_10000043 3300007265 Bacteria 49721
108 Ga0099794_10024113 3300007265 Bacteria 2790
109 Ga0099794_10306142 3300007265 Unclassified 823
110 Ga0105240_10792220 3300009093 Bacteria 1027
111 Ga0111539_10535852 3300009094 Bacteria 1364
112 Ga0105245_10017068 3300009098 Bacteria 6336
113 Ga0114129_10000084 3300009147 Bacteria 87485
114 Ga0114129_10252548 3300009147 Bacteria 2366
115 Ga0114129_10847346 3300009147 Bacteria 1162
116 Ga0105241_10122753 3300009174 Bacteria 2094
117 Ga0105241_10266460 3300009174 Bacteria 1458
118 Ga0105248_10176257 3300009177 Bacteria 2409
119 Ga0105249_10015613 3300009553 Bacteria 6723
120 Ga0157369_10010325 3300013105 Bacteria 10648
121 Ga0157374_10309637 3300013296 Bacteria 1563
122 Ga0157378_10577351 3300013297 Bacteria 1133
123 Ga0163162_10973991 3300013306 Bacteria 958
124 Ga0163162_11807445 3300013306 Bacteria 699
125 Ga0163163_10401707 3300014325 Bacteria 1428
126 Ga0163163_12123948 3300014325 Bacteria 621
127 Ga0157377_10315976 3300014745 Bacteria 1036
128 Ga0157379_10000352 3300014968 Bacteria 36938
129 Ga0163161_10721427 3300017792 Bacteria 832
130 Ga0206356_10637827 3300020070 Bacteria 1743
131 Ga0213872_10002834 3300021361 Bacteria 9912
132 Ga0224572_1012081 3300024225 Bacteria 1638
133 Ga0207692_10113504 3300025898 Bacteria 1506
134 Ga0207692_10149678 3300025898 Bacteria 1335
135 Ga0207685_10102901 3300025905 Bacteria 1224
136 Ga0207684_10000620 3300025910 Bacteria 42221
137 Ga0207684_10042228 3300025910 Bacteria 3865
138 Ga0207684_10067402 3300025910 Bacteria 3042
139 Ga0207684_10285154 3300025910 Bacteria 1424
140 Ga0207654_10080121 3300025911 Bacteria 1963
141 Ga0207654_10081948 3300025911 Bacteria 1944
142 Ga0207654_10254501 3300025911 Bacteria 1178
143 Ga0207707_10026473 3300025912 Bacteria 5069
144 Ga0207707_10097287 3300025912 Bacteria 2572
145 Ga0207693_10006437 3300025915 Bacteria 9730
146 Ga0207693_10008753 3300025915 Bacteria 8273
147 Ga0207693_10023328 3300025915 Bacteria 4913
148 Ga0207693_10048621 3300025915 Bacteria 3330
149 Ga0207663_10050822 3300025916 Bacteria 2578
150 Ga0207663_10455462 3300025916 Bacteria 987
151 Ga0207663_10559609 3300025916 Bacteria 895
152 Ga0207660_10064685 3300025917 Bacteria 2640
153 Ga0207657_10100377 3300025919 Bacteria 2403
154 Ga0207657_10112560 3300025919 Bacteria 2246
155 Ga0207657_10120572 3300025919 Bacteria 2158
156 Ga0207657_10286267 3300025919 Bacteria 1307
157 Ga0207649_10026532 3300025920 Bacteria 3390
158 Ga0207652_10082090 3300025921 Bacteria 2820
159 Ga0207652_10168508 3300025921 Bacteria 1965
160 Ga0207646_10234856 3300025922 Bacteria 1657
161 Ga0207646_10290925 3300025922 Bacteria 1476
162 Ga0207681_10568171 3300025923 Bacteria 935
163 Ga0207694_10556649 3300025924 Bacteria 963
164 Ga0207700_10060133 3300025928 Bacteria 2876
165 Ga0207700_10431278 3300025928 Bacteria 1159
166 Ga0207700_11104165 3300025928 Bacteria 709
167 Ga0207664_10020465 3300025929 Bacteria 4905
168 Ga0207690_10284145 3300025932 Bacteria 1289
169 Ga0207706_10021793 3300025933 Bacteria 5751
170 Ga0207704_10144263 3300025938 Bacteria 1670
171 Ga0207665_10010849 3300025939 Bacteria 5983
172 Ga0207665_10169971 3300025939 Unclassified 1573
173 Ga0207665_10241613 3300025939 Bacteria 1331
174 Ga0207665_10678034 3300025939 Bacteria 809
175 Ga0207711_10107094 3300025941 Bacteria 2481
176 Ga0207661_10004774 3300025944 Bacteria 9488
177 Ga0207661_11124324 3300025944 Bacteria 723
178 Ga0207679_10125244 3300025945 Bacteria 2052
179 Ga0207679_10135723 3300025945 Bacteria 1981
180 Ga0207679_10195121 3300025945 Bacteria 1687
181 Ga0207640_10156630 3300025981 Bacteria 1680
182 Ga0207703_10525905 3300026035 Unclassified 1113
183 Ga0207639_10340387 3300026041 Bacteria 1337
184 Ga0207639_10450148 3300026041 Bacteria 1169
185 Ga0207639_10578791 3300026041 Unclassified 1033
186 Ga0207676_10473847 3300026095 Bacteria 1184
187 Ga0207674_10001205 3300026116 Bacteria 33690
188 Ga0207675_101296161 3300026118 Bacteria 749
189 Ga0207698_11436140 3300026142 Bacteria 705
190 Ga0265338_10188560 3300028800 Bacteria 1565
191 Ga0265770_1046903 3300030878 Bacteria 771
192 Ga0265760_10123527 3300031090 Bacteria 833
193 Ga0265340_10010377 3300031247 Bacteria 4984
194 Ga0307509_10025429 3300031507 Bacteria 6611
195 Ga0307413_10817788 3300031824 Bacteria 784
196 Ga0307412_10567333 3300031911 Bacteria 956
197 Ga0307416_100167028 3300032002 Bacteria 2042
198 Ga0307416_100183507 3300032002 Bacteria 1964
199 Ga0307414_10290020 3300032004 Bacteria 1379
200 Ga0307415_100094005 3300032126 Bacteria 2178
201 Ga0373951_0000122 3300035091 Bacteria 29207
202 Ga0373953_0094869 3300035117 Bacteria 1251
203 Ga0373937_0599024 3300036401 Bacteria 1046
204 Ga0316582_0128982 3300036647 Bacteria 1697
205 Ga0395899_0028054 3300037312 Bacteria 4240
206 Ga0395899_0463792 3300037312 Bacteria 827
207 Ga0395900_0069552 3300037418 Bacteria 3618
208 Ga0395900_0180938 3300037418 Bacteria 2142
209 Ga0395900_0239014 3300037418 Unclassified 1823
210 Ga0395900_0459879 3300037418 Bacteria 1228
211 Ga0395898_0056760 3300037466 Bacteria 3816
212 Ga0395898_0214895 3300037466 Bacteria 1834
213 Ga0395905_0090386 3300037471 Bacteria 2870
214 Ga0395901_0029655 3300038443 Bacteria 5633
215 Ga0395901_0647448 3300038443 Bacteria 1060
216 Ga0436365_0472220 3300039437 Bacteria 973
217 Ga0436360_1195117 3300039438 Bacteria 1461
218 Ga0436363_1544154 3300039450 Bacteria 874
219 Ga0436362_1143573 3300039453 Bacteria 1229
220 Ga0439450_014122 3300042008 Bacteria 1615
221 Ga0439455_0064562 3300042012 Bacteria 975
222 Ga0439456_038026 3300042013 Bacteria 1040
223 Ga0439463_002064 3300042016 Bacteria 5206
224 Ga0439463_010866 3300042016 Bacteria 2237
225 Ga0439463_027523 3300042016 Bacteria 1431
226 Ga0439444_0006279 3300042437 Bacteria 1792
227 Ga0439464_0016634 3300042439 Bacteria 1990
228 Ga0439464_0036056 3300042439 Bacteria 1398
229 Ga0439460_0011955 3300042461 Bacteria 2243
230 Ga0450916_002631 3300042530 Bacteria 1923
231 Ga0451577_0476931 3300042876 Bacteria 1132
232 Ga0439440_0001397 3300042993 Bacteria 4387
233 Ga0453683_0071915 3300044673 Bacteria 2164
234 Ga0466963_0006017 3300044694 Bacteria 7148
235 Ga0453684_0007315 3300044712 Bacteria 20420
236 Ga0451576_0092768 3300045051 Bacteria 3140
237 Ga0495629_0036385 3300046459 Bacteria 3475
238 Ga0495638_0022583 3300046460 Bacteria 4128
239 Ga0495651_0004983 3300046462 Bacteria 10147
240 Ga0495653_0007008 3300046463 Bacteria 9250
241 Ga0495580_0138189 3300046472 Unclassified 1689
242 Ga0495582_0345655 3300046473 Bacteria 856
243 Ga0495639_0006665 3300046475 Bacteria 4969
244 Ga0495662_0000542 3300046476 Bacteria 17302
245 Ga0495664_0000141 3300046477 Bacteria 36021
246 Ga0495664_0082704 3300046477 Bacteria 1926
247 Ga0495584_0417804 3300046491 Bacteria 682
248 Ga0495594_0005265 3300046499 Bacteria 6644
249 Ga0495594_0207386 3300046499 Bacteria 1117
250 Ga0495596_0070451 3300046500 Bacteria 1359
251 Ga0495583_0069763 3300046506 Unclassified 1547
252 Ga0495620_0041763 3300046515 Bacteria 2009
253 Ga0495628_0022428 3300046516 Bacteria 5185
254 Ga0495630_0571625 3300046517 Bacteria 867
255 Ga0495631_0136599 3300046518 Bacteria 1053
256 Ga0495652_0000390 3300046529 Bacteria 51932
257 Ga0495652_0038589 3300046529 Bacteria 4137
258 Ga0495665_0000631 3300046531 Bacteria 17954
259 Ga0495640_0001034 3300046533 Bacteria 21578
260 Ga0495586_0110562 3300046535 Unclassified 1529
261 Ga0495598_0201212 3300046537 Bacteria 719
262 Ga0495645_0001621 3300046543 Bacteria 15232
263 Ga0495645_0010891 3300046543 Bacteria 6388
264 Ga0495667_0012569 3300046559 Bacteria 5741
265 Ga0495634_0005528 3300046642 Bacteria 9702
266 Ga0495634_0041887 3300046642 Bacteria 3109
267 Ga0495635_0000996 3300046663 Bacteria 18696
268 Ga0495635_0002486 3300046663 Bacteria 12587
269 Ga0495659_0008363 3300046664 Bacteria 3293
270 Ga0495657_0308897 3300046675 Bacteria 942
271 Ga0495623_0027460 3300046679 Bacteria 3662
272 Ga0495646_0001397 3300046680 Bacteria 14343
273 Ga0495646_0123192 3300046680 Bacteria 1465
274 Ga0495613_0001795 3300046689 Bacteria 16310
275 Ga0495613_0025164 3300046689 Unclassified 4436
276 Ga0495624_0012555 3300046690 Bacteria 5785
277 Ga0495600_0015956 3300046809 Bacteria 4759
278 Ga0495604_0012407 3300047317 Bacteria 6774
279 Ga0495676_0169910 3300047321 Bacteria 1535
280 Ga0495680_0201303 3300047322 Unclassified 1428
281 Ga0495683_0306943 3300047323 Bacteria 680
282 Ga0495675_0018741 3300047444 Bacteria 4396
283 Ga0495614_0002045 3300048089 Bacteria 8870
284 Ga0496101_0933861 3300048904 Bacteria 683
285 Ga0496102_0000319 3300048905 Bacteria 60314
286 Ga0496102_0000450 3300048905 Bacteria 46831
287 Ga0496102_0436670 3300048905 Bacteria 1229
288 Ga0496103_0022632 3300048906 Bacteria 3784
289 Ga0496104_0166656 3300048907 Bacteria 2113
290 Ga0496109_0037118 3300048912 Bacteria 4402
291 Ga0496112_0022021 3300048915 Bacteria 6067
292 Ga0496112_0050311 3300048915 Bacteria 4086
293 Ga0496112_0382033 3300048915 Bacteria 1349
294 Ga0496112_0527944 3300048915 Bacteria 1115
295 Ga0496113_0238505 3300048916 Bacteria 1451
296 Ga0501034_0626918 3300049571 Bacteria 979
297 Ga0501040_0066899 3300049576 Bacteria 2475
298 Ga0501041_0017505 3300049577 Bacteria 4264
299 Ga0501046_0263435 3300049580 Unclassified 1266
300 Ga0501048_0157456 3300049582 Unclassified 1607
301 Ga0501071_0505937 3300049587 Bacteria 927
302 Ga0501081_0030736 3300049743 Bacteria 3637
303 Ga0501083_0009475 3300049744 Bacteria 6878
304 nmdc:mga05p37_631016_c1 3300050507 Bacteria 1204
305 nmdc:mga05p37_678_c1 3300050507 Bacteria 37695
306 nmdc:mga05p37_95535_c1 3300050507 Bacteria 3662
307 nmdc:mga09592_3_c1 3300050508 Bacteria 144376
308 nmdc:mga09592_455969_c1 3300050508 Bacteria 1103
309 nmdc:mga0qj67_17_c1 3300050509 Bacteria 121673
310 nmdc:mga06r32_202240_c1 3300050510 Unclassified 1974
311 nmdc:mga06r32_28152_c1 3300050510 Bacteria 5255
312 nmdc:mga06r32_327_c1 3300050510 Bacteria 39873
313 nmdc:mga08y16_648765_c1 3300050511 Bacteria 1060
314 nmdc:mga0n895_187509_c1 3300050512 Bacteria 2099
315 nmdc:mga0n895_616534_c1 3300050512 Bacteria 1086
316 nmdc:mga0rr50_905246_c1 3300050513 Bacteria 752
317 nmdc:mga08x19_15148_c1 3300050514 Bacteria 4686
318 nmdc:mga0a205_415776_c1 3300050515 Bacteria 1207
319 Ga0495601_0000284 3300053077 Bacteria 27115
320 Ga0495601_0016944 3300053077 Bacteria 4420
321 Ga0495612_0001199 3300053078 Bacteria 10676
322 Ga0495655_0046221 3300053083 Bacteria 1134
323 Ga0495619_0134202 3300053085 Bacteria 1702
324 Ga0500593_040658 3300053117 Bacteria 2079
325 Ga0500618_030059 3300053125 Bacteria 1279
326 Ga0501084_0007820 3300054114 Bacteria 8798
327 Ga0501084_0159500 3300054114 Bacteria 1903
328 Ga0530510_0321165 3300061734 Bacteria 1161
329 Ga0209455_1009015
330 JGI25406J46586_10033858
331 JGI25407J50210_10013196
332 JGI25404J52841_10000710
333 Ga0058862_10027256
334 Ga0070658_10006188
335 Ga0070683_100010464
336 Ga0070683_100134405
337 Ga0070690_100021896
338 Ga0070680_100161954
339 Ga0068868_100184281
340 Ga0070660_100092889
341 Ga0070660_100124863
342 Ga0070661_100096868
343 Ga0070659_100052718
344 Ga0070709_10036265
345 Ga0070714_100028561
346 Ga0070714_101351407
347 Ga0070713_100266069
348 Ga0070713_100503787
349 Ga0070713_100985650
350 Ga0070710_10219230
351 Ga0070710_10233804
352 Ga0070710_10364453
353 Ga0070711_100033471
354 Ga0070711_100801244
355 Ga0070711_100921369
356 Ga0070705_100556023
357 Ga0070708_100033026
358 Ga0070708_100431746
359 Ga0070681_10035695
360 Ga0070681_10281711
361 Ga0070706_100033726
362 Ga0070706_100033755
363 Ga0070706_100087470
364 Ga0070706_100124889
365 Ga0070706_100283046
366 Ga0070707_100034940
367 Ga0070707_100364633
368 Ga0070698_100027592
369 Ga0070698_100028411
370 Ga0070698_100036747
371 Ga0070698_100311260
372 Ga0070698_100630867
373 Ga0070699_100005638
374 Ga0070699_100185642
375 Ga0070699_100413090
376 Ga0070679_100006502
377 Ga0070679_100048723
378 Ga0070679_100407096
379 Ga0070684_100239565
380 Ga0070697_100012537
381 Ga0070697_100021591
382 Ga0070697_100025953
383 Ga0070697_100118311
384 Ga0070697_100161924
385 Ga0068853_100022641
386 Ga0068853_100470395
387 Ga0070695_100389259
388 Ga0070696_100518200
389 Ga0070704_100632055
390 Ga0068855_100503418
391 Ga0070664_100024821
392 Ga0070664_100455820
393 Ga0070664_100718293
394 Ga0068857_100000277
395 Ga0068857_100422237
396 Ga0068854_100189856
397 Ga0068856_100651158
398 Ga0068859_100221810
399 Ga0068864_100019820
400 Ga0068863_101030090
401 Ga0068858_100060778
402 Ga0068860_100161008
403 Ga0081455_10002026
404 Ga0081455_10004221
405 Ga0081455_10052070
406 Ga0081538_10012908
407 Ga0081540_1000118
408 Ga0081540_1000162
409 Ga0081540_1000379
410 Ga0081540_1117007
411 Ga0081539_10011696
412 Ga0070717_10276866
413 Ga0070717_10743742
414 Ga0075363_100179241
415 Ga0070715_10136154
416 Ga0070716_100322557
417 Ga0070712_100026366
418 Ga0070712_100032209
419 Ga0070712_100058558
420 Ga0070712_100107143
421 Ga0075428_100006286
422 Ga0075430_100011303
423 Ga0075431_100012310
424 Ga0075431_100117347
425 Ga0075433_10178646
426 Ga0075433_10365946
427 Ga0075434_100104612
428 Ga0075434_100261539
429 Ga0075434_100447814
430 Ga0075429_100009116
431 Ga0075429_100325824
432 Ga0075436_100080286
433 Ga0075436_100209888
434 Ga0075435_100141355
435 Ga0099794_10000043
436 Ga0099794_10024113
437 Ga0099794_10306142
438 Ga0105240_10792220
439 Ga0111539_10535852
440 Ga0105245_10017068
441 Ga0114129_10000084
442 Ga0114129_10252548
443 Ga0114129_10847346
444 Ga0105241_10122753
445 Ga0105241_10266460
446 Ga0105248_10176257
447 Ga0105249_10015613
448 Ga0157369_10010325
449 Ga0157374_10309637
450 Ga0157378_10577351
451 Ga0163162_10973991
452 Ga0163162_11807445
453 Ga0163163_10401707
454 Ga0163163_12123948
455 Ga0157377_10315976
456 Ga0157379_10000352
457 Ga0163161_10721427
458 Ga0206356_10637827
459 Ga0213872_10002834
460 Ga0224572_1012081
461 Ga0207692_10113504
462 Ga0207692_10149678
463 Ga0207685_10102901
464 Ga0207684_10000620
465 Ga0207684_10042228
466 Ga0207684_10067402
467 Ga0207684_10285154
468 Ga0207654_10080121
469 Ga0207654_10081948
470 Ga0207654_10254501
471 Ga0207707_10026473
472 Ga0207707_10097287
473 Ga0207693_10006437
474 Ga0207693_10008753
475 Ga0207693_10023328
476 Ga0207693_10048621
477 Ga0207663_10050822
478 Ga0207663_10455462
479 Ga0207663_10559609
480 Ga0207660_10064685
481 Ga0207657_10100377
482 Ga0207657_10112560
483 Ga0207657_10120572
484 Ga0207657_10286267
485 Ga0207649_10026532
486 Ga0207652_10082090
487 Ga0207652_10168508
488 Ga0207646_10234856
489 Ga0207646_10290925
490 Ga0207681_10568171
491 Ga0207694_10556649
492 Ga0207700_10060133
493 Ga0207700_10431278
494 Ga0207700_11104165
495 Ga0207664_10020465
496 Ga0207690_10284145
497 Ga0207706_10021793
498 Ga0207704_10144263
499 Ga0207665_10010849
500 Ga0207665_10169971
501 Ga0207665_10241613
502 Ga0207665_10678034
503 Ga0207711_10107094
504 Ga0207661_10004774
505 Ga0207661_11124324
506 Ga0207679_10125244
507 Ga0207679_10135723
508 Ga0207679_10195121
509 Ga0207640_10156630
510 Ga0207703_10525905
511 Ga0207639_10340387
512 Ga0207639_10450148
513 Ga0207639_10578791
514 Ga0207676_10473847
515 Ga0207674_10001205
516 Ga0207675_101296161
517 Ga0207698_11436140
518 Ga0265338_10188560
519 Ga0265770_1046903
520 Ga0265760_10123527
521 Ga0265340_10010377
522 Ga0307509_10025429
523 Ga0307413_10817788
524 Ga0307412_10567333
525 Ga0307416_100167028
526 Ga0307416_100183507
527 Ga0307414_10290020
528 Ga0307415_100094005
529 Ga0373951_0000122
530 Ga0373953_0094869
531 Ga0373937_0599024
532 Ga0316582_0128982
533 Ga0395899_0028054
534 Ga0395899_0463792
535 Ga0395900_0069552
536 Ga0395900_0180938
537 Ga0395900_0239014
538 Ga0395900_0459879
539 Ga0395898_0056760
540 Ga0395898_0214895
541 Ga0395905_0090386
542 Ga0395901_0029655
543 Ga0395901_0647448
544 Ga0436365_0472220
545 Ga0436360_1195117
546 Ga0436363_1544154
547 Ga0436362_1143573
548 Ga0439450_014122
549 Ga0439455_0064562
550 Ga0439456_038026
551 Ga0439463_002064
552 Ga0439463_010866
553 Ga0439463_027523
554 Ga0439444_0006279
555 Ga0439464_0016634
556 Ga0439464_0036056
557 Ga0439460_0011955
558 Ga0450916_002631
559 Ga0451577_0476931
560 Ga0439440_0001397
561 Ga0453683_0071915
562 Ga0466963_0006017
563 Ga0453684_0007315
564 Ga0451576_0092768
565 Ga0495629_0036385
566 Ga0495638_0022583
567 Ga0495651_0004983
568 Ga0495653_0007008
569 Ga0495580_0138189
570 Ga0495582_0345655
571 Ga0495639_0006665
572 Ga0495662_0000542
573 Ga0495664_0000141
574 Ga0495664_0082704
575 Ga0495584_0417804
576 Ga0495594_0005265
577 Ga0495594_0207386
578 Ga0495596_0070451
579 Ga0495583_0069763
580 Ga0495620_0041763
581 Ga0495628_0022428
582 Ga0495630_0571625
583 Ga0495631_0136599
584 Ga0495652_0000390
585 Ga0495652_0038589
586 Ga0495665_0000631
587 Ga0495640_0001034
588 Ga0495586_0110562
589 Ga0495598_0201212
590 Ga0495645_0001621
591 Ga0495645_0010891
592 Ga0495667_0012569
593 Ga0495634_0005528
594 Ga0495634_0041887
595 Ga0495635_0000996
596 Ga0495635_0002486
597 Ga0495659_0008363
598 Ga0495657_0308897
599 Ga0495623_0027460
600 Ga0495646_0001397
601 Ga0495646_0123192
602 Ga0495613_0001795
603 Ga0495613_0025164
604 Ga0495624_0012555
605 Ga0495600_0015956
606 Ga0495604_0012407
607 Ga0495676_0169910
608 Ga0495680_0201303
609 Ga0495683_0306943
610 Ga0495675_0018741
611 Ga0495614_0002045
612 Ga0496101_0933861
613 Ga0496102_0000319
614 Ga0496102_0000450
615 Ga0496102_0436670
616 Ga0496103_0022632
617 Ga0496104_0166656
618 Ga0496109_0037118
619 Ga0496112_0022021
620 Ga0496112_0050311
621 Ga0496112_0382033
622 Ga0496112_0527944
623 Ga0496113_0238505
624 Ga0501034_0626918
625 Ga0501040_0066899
626 Ga0501041_0017505
627 Ga0501046_0263435
628 Ga0501048_0157456
629 Ga0501071_0505937
630 Ga0501081_0030736
631 Ga0501083_0009475
632 nmdc:mga05p37_631016_c1
633 nmdc:mga05p37_678_c1
634 nmdc:mga05p37_95535_c1
635 nmdc:mga09592_3_c1
636 nmdc:mga09592_455969_c1
637 nmdc:mga0qj67_17_c1
638 nmdc:mga06r32_202240_c1
639 nmdc:mga06r32_28152_c1
640 nmdc:mga06r32_327_c1
641 nmdc:mga08y16_648765_c1
642 nmdc:mga0n895_187509_c1
643 nmdc:mga0n895_616534_c1
644 nmdc:mga0rr50_905246_c1
645 nmdc:mga08x19_15148_c1
646 nmdc:mga0a205_415776_c1
647 Ga0495601_0000284
648 Ga0495601_0016944
649 Ga0495612_0001199
650 Ga0495655_0046221
651 Ga0495619_0134202
652 Ga0500593_040658
653 Ga0500618_030059
654 Ga0501084_0007820
655 Ga0501084_0159500
656 Ga0530510_0321165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

34

181

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c9x-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella y236f mutant 0.9043 38 183
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.9025 37 183
2bih-assembly1.cif.gz_A-2 crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase 0.8973 30 179
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.8892 44 186
2xts-assembly1.cif.gz_C crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.888 36 172
ID Description Score Start End Superfamily
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8941 37 183 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8889 30 178 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.883 30 179 3.90.420.10
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8765 36 172 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8719 30 178 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A531M4M5-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9638 21 169
AF-T0YIM6-F1-model_v4 Oxidoreductase, molybdopterin binding protein 0.9618 18 177
AF-A0A7Y6A7Q0-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9571 18 186
AF-A0A2R6GZT7-F1-model_v4 Sulfite oxidase 0.9564 18 156
AF-A0A524CII0-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9538 18 170

Map