F409119

General Info

Members Datasets Scaffolds Average Seq Length
328 198 328 83

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_11348581|Ga0070709_113485811
Length 94
Sequence VKAYIDQMSKFVKLVYFAWLRERIGTAQEEISLPDGVDTVEALIDYLRTVGPRYADAFLPHKTIRCAINHEFAEAQSKINANDEVAFFPPVTGG

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
195 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
196 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 2.44
Rhizosphere 90.55
Stem 0
Stem Tuber 0
Unclassified 6.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10080720 3300005289 Bacteria 3891
2 Ga0070658_11609781 3300005327 Unclassified 563
3 Ga0070676_10404998 3300005328 Bacteria 950
4 Ga0070683_100244793 3300005329 Bacteria 1705
5 Ga0070690_101185525 3300005330 Unclassified 609
6 Ga0068869_101195315 3300005334 Bacteria 668
7 Ga0070680_100000023 3300005336 Bacteria 78765
8 Ga0070680_100454164 3300005336 Bacteria 1094
9 Ga0070682_101149357 3300005337 Bacteria 652
10 Ga0070682_101679019 3300005337 Bacteria 551
11 Ga0070660_100948946 3300005339 Bacteria 726
12 Ga0070687_101543501 3300005343 Bacteria 500
13 Ga0070661_100000441 3300005344 Bacteria 31826
14 Ga0070661_100074679 3300005344 Bacteria 2497
15 Ga0070661_100135134 3300005344 Bacteria 1855
16 Ga0070674_100985471 3300005356 Unclassified 739
17 Ga0070674_101534418 3300005356 Bacteria 599
18 Ga0070659_101397363 3300005366 Unclassified 622
19 Ga0070667_100070748 3300005367 Bacteria 2970
20 Ga0070703_10075908 3300005406 Bacteria 1133
21 Ga0070703_10583269 3300005406 Bacteria 514
22 Ga0070709_11302721 3300005434 Bacteria 586
23 Ga0070709_11348581 3300005434 Bacteria 576
24 Ga0070710_10724703 3300005437 Bacteria 704
25 Ga0070711_100427221 3300005439 Bacteria 1081
26 Ga0070705_100302358 3300005440 Bacteria 1147
27 Ga0070694_100174535 3300005444 Bacteria 1585
28 Ga0070694_101006050 3300005444 Bacteria 692
29 Ga0070694_101518661 3300005444 Bacteria 567
30 Ga0070708_101532257 3300005445 Bacteria 621
31 Ga0070708_102123206 3300005445 Bacteria 519
32 Ga0070662_100691332 3300005457 Bacteria 862
33 Ga0070681_10000002 3300005458 Bacteria 821814
34 Ga0070706_101148850 3300005467 Bacteria 714
35 Ga0070679_100000445 3300005530 Bacteria 35145
36 Ga0068853_100373311 3300005539 Bacteria 1331
37 Ga0068853_101781409 3300005539 Bacteria 597
38 Ga0070695_100010028 3300005545 Bacteria 5650
39 Ga0070695_101306853 3300005545 Bacteria 599
40 Ga0070696_100035919 3300005546 Bacteria 3414
41 Ga0070696_100101640 3300005546 Bacteria 2061
42 Ga0068855_100000024 3300005563 Bacteria 184241
43 Ga0068855_100134358 3300005563 Bacteria 2823
44 Ga0068855_100805925 3300005563 Bacteria 998
45 Ga0068855_101003133 3300005563 Unclassified 877
46 Ga0068857_101655933 3300005577 Unclassified 625
47 Ga0068856_100328823 3300005614 Bacteria 1546
48 Ga0068856_101418462 3300005614 Unclassified 709
49 Ga0068856_102069534 3300005614 Bacteria 579
50 Ga0068852_100008637 3300005616 Bacteria 7526
51 Ga0068852_100286983 3300005616 Bacteria 1588
52 Ga0068852_101344080 3300005616 Bacteria 736
53 Ga0068859_100892065 3300005617 Bacteria 974
54 Ga0068864_100690852 3300005618 Bacteria 996
55 Ga0068864_101103255 3300005618 Bacteria 790
56 Ga0068851_10136501 3300005834 Bacteria 1330
57 Ga0068862_101483806 3300005844 Bacteria 683
58 Ga0097621_100002441 3300006237 Bacteria 12724
59 Ga0097621_100148396 3300006237 Bacteria 2010
60 Ga0097621_100638715 3300006237 Bacteria 976
61 Ga0097621_101732805 3300006237 Unclassified 595
62 Ga0068871_100133302 3300006358 Bacteria 2108
63 Ga0068871_100205953 3300006358 Bacteria 1700
64 Ga0075428_100055712 3300006844 Bacteria 4332
65 Ga0075430_100238779 3300006846 Bacteria 1506
66 Ga0075430_100316662 3300006846 Bacteria 1290
67 Ga0075430_100788441 3300006846 Bacteria 783
68 Ga0075431_100253435 3300006847 Bacteria 1788
69 Ga0075431_100811944 3300006847 Bacteria 908
70 Ga0075433_10276859 3300006852 Bacteria 1487
71 Ga0075434_100091834 3300006871 Bacteria 3038
72 Ga0075436_100412222 3300006914 Bacteria 980
73 Ga0097620_100892196 3300006931 Bacteria 974
74 Ga0075435_101024419 3300007076 Bacteria 721
75 Ga0099795_10085331 3300007788 Bacteria 1215
76 Ga0105244_10026643 3300009036 Bacteria 3125
77 Ga0105250_10277163 3300009092 Bacteria 721
78 Ga0105240_10000564 3300009093 Bacteria 68685
79 Ga0105240_10009705 3300009093 Bacteria 13589
80 Ga0105240_10153685 3300009093 Bacteria 2739
81 Ga0105240_10516733 3300009093 Bacteria 1326
82 Ga0105240_11558413 3300009093 Bacteria 692
83 Ga0105240_12587932 3300009093 Bacteria 524
84 Ga0111539_10050686 3300009094 Bacteria 4945
85 Ga0111539_12979346 3300009094 Bacteria 547
86 Ga0105245_10545443 3300009098 Bacteria 1181
87 Ga0105245_10796417 3300009098 Bacteria 983
88 Ga0105247_10008181 3300009101 Bacteria 6387
89 Ga0105247_10325158 3300009101 Bacteria 1074
90 Ga0114129_10017466 3300009147 Bacteria 10215
91 Ga0114129_11048101 3300009147 Bacteria 1024
92 Ga0105243_10033233 3300009148 Bacteria 3989
93 Ga0105243_11715962 3300009148 Bacteria 657
94 Ga0105241_10219054 3300009174 Bacteria 1599
95 Ga0105241_10327857 3300009174 Bacteria 1322
96 Ga0105241_12301487 3300009174 Unclassified 536
97 Ga0105242_10078686 3300009176 Bacteria 2753
98 Ga0105242_10316677 3300009176 Bacteria 1429
99 Ga0105248_10000009 3300009177 Bacteria 403549
100 Ga0105248_10054723 3300009177 Bacteria 4476
101 Ga0105237_10159856 3300009545 Bacteria 2251
102 Ga0105237_10826615 3300009545 Bacteria 933
103 Ga0105237_11739064 3300009545 Unclassified 631
104 Ga0105238_10253735 3300009551 Bacteria 1738
105 Ga0105238_10253736 3300009551 Bacteria 1738
106 Ga0105239_10006486 3300010375 Bacteria 13566
107 Ga0105239_10017913 3300010375 Bacteria 7833
108 Ga0105239_10100036 3300010375 Bacteria 3207
109 Ga0105239_10144809 3300010375 Bacteria 2649
110 Ga0157370_10716036 3300013104 Bacteria 913
111 Ga0157369_10011935 3300013105 Bacteria 9869
112 Ga0157369_10054969 3300013105 Bacteria 4298
113 Ga0157369_10215292 3300013105 Bacteria 2012
114 Ga0157369_10842932 3300013105 Unclassified 941
115 Ga0157378_10051694 3300013297 Bacteria 3656
116 Ga0157378_10441974 3300013297 Bacteria 1289
117 Ga0157378_11212762 3300013297 Bacteria 794
118 Ga0157378_12708942 3300013297 Unclassified 548
119 Ga0157372_10897273 3300013307 Bacteria 1028
120 Ga0157372_12927419 3300013307 Bacteria 546
121 Ga0163163_11210271 3300014325 Bacteria 818
122 Ga0157376_10033697 3300014969 Bacteria 4127
123 Ga0157376_12676805 3300014969 Unclassified 539
124 Ga0213872_10088235 3300021361 Bacteria 1389
125 Ga0213876_10004771 3300021384 Bacteria 7532
126 Ga0213876_10305279 3300021384 Bacteria 846
127 Ga0207696_1000022 3300025711 Bacteria 427529
128 Ga0207655_1051982 3300025728 Bacteria 1652
129 Ga0207713_1079142 3300025735 Bacteria 1188
130 Ga0207653_10190213 3300025885 Unclassified 770
131 Ga0207653_10395555 3300025885 Bacteria 541
132 Ga0207710_10136241 3300025900 Bacteria 1182
133 Ga0207710_10204197 3300025900 Bacteria 977
134 Ga0207680_10000878 3300025903 Bacteria 14184
135 Ga0207645_10559829 3300025907 Bacteria 776
136 Ga0207705_11352103 3300025909 Unclassified 543
137 Ga0207684_10190296 3300025910 Bacteria 1770
138 Ga0207654_10062452 3300025911 Bacteria 2183
139 Ga0207707_10000002 3300025912 Bacteria 1142054
140 Ga0207707_10900736 3300025912 Bacteria 731
141 Ga0207695_10000003 3300025913 Bacteria 1368691
142 Ga0207695_10379979 3300025913 Bacteria 1298
143 Ga0207660_10007667 3300025917 Bacteria 6990
144 Ga0207660_10232486 3300025917 Bacteria 1450
145 Ga0207649_10000497 3300025920 Bacteria 27895
146 Ga0207649_10007709 3300025920 Bacteria 5853
147 Ga0207649_10615815 3300025920 Bacteria 836
148 Ga0207649_10736266 3300025920 Bacteria 766
149 Ga0207652_10000299 3300025921 Bacteria 51311
150 Ga0207694_10000016 3300025924 Bacteria 349087
151 Ga0207694_10173987 3300025924 Bacteria 1744
152 Ga0207706_10337294 3300025933 Bacteria 1311
153 Ga0207686_10034824 3300025934 Bacteria 3017
154 Ga0207686_10961814 3300025934 Bacteria 691
155 Ga0207669_10913494 3300025937 Unclassified 734
156 Ga0207665_10969774 3300025939 Bacteria 676
157 Ga0207711_10230090 3300025941 Bacteria 1698
158 Ga0207661_10111684 3300025944 Bacteria 2313
159 Ga0207667_10000021 3300025949 Bacteria 370524
160 Ga0207667_10111163 3300025949 Bacteria 2826
161 Ga0207667_11964941 3300025949 Unclassified 546
162 Ga0207668_11049174 3300025972 Bacteria 730
163 Ga0207658_10050608 3300025986 Bacteria 3058
164 Ga0207639_10301731 3300026041 Bacteria 1416
165 Ga0207708_11885768 3300026075 Bacteria 524
166 Ga0207702_10282802 3300026078 Bacteria 1569
167 Ga0207702_10848216 3300026078 Bacteria 904
168 Ga0207702_12454804 3300026078 Unclassified 508
169 Ga0207641_11269268 3300026088 Bacteria 737
170 Ga0207676_10572274 3300026095 Bacteria 1082
171 Ga0207674_10988116 3300026116 Bacteria 811
172 Ga0207698_10033544 3300026142 Bacteria 3731
173 Ga0207698_10037495 3300026142 Bacteria 3571
174 Ga0207698_10646416 3300026142 Bacteria 1047
175 Ga0207698_11779676 3300026142 Unclassified 631
176 Ga0268266_11203124 3300028379 Bacteria 733
177 Ga0268264_10342984 3300028381 Bacteria 1420
178 Ga0265318_10000046 3300028577 Bacteria 126568
179 Ga0265338_10088455 3300028800 Bacteria 2570
180 Ga0265338_10759604 3300028800 Bacteria 666
181 Ga0265330_10172379 3300031235 Bacteria 917
182 Ga0265330_10400241 3300031235 Unclassified 581
183 Ga0265330_10507805 3300031235 Unclassified 513
184 Ga0265332_10062713 3300031238 Bacteria 1588
185 Ga0265332_10188231 3300031238 Bacteria 859
186 Ga0265320_10000179 3300031240 Bacteria 53742
187 Ga0265325_10045126 3300031241 Bacteria 2291
188 Ga0265325_10280024 3300031241 Bacteria 748
189 Ga0265329_10089092 3300031242 Bacteria 979
190 Ga0265340_10335619 3300031247 Unclassified 668
191 Ga0265339_10104691 3300031249 Bacteria 1469
192 Ga0265339_10225416 3300031249 Bacteria 915
193 Ga0265331_10000080 3300031250 Bacteria 137743
194 Ga0265331_10396215 3300031250 Bacteria 619
195 Ga0265327_10263013 3300031251 Bacteria 766
196 Ga0265327_10343587 3300031251 Bacteria 652
197 Ga0265316_10259035 3300031344 Bacteria 1276
198 Ga0265316_10624048 3300031344 Bacteria 763
199 Ga0307408_101344685 3300031548 Bacteria 671
200 Ga0265313_10017352 3300031595 Bacteria 4094
201 Ga0265314_10040241 3300031711 Bacteria 3356
202 Ga0265314_10077190 3300031711 Bacteria 2210
203 Ga0265314_10108011 3300031711 Bacteria 1774
204 Ga0265314_10156281 3300031711 Bacteria 1392
205 Ga0265314_10184671 3300031711 Bacteria 1246
206 Ga0265314_10367834 3300031711 Bacteria 786
207 Ga0265314_10505432 3300031711 Bacteria 635
208 Ga0265342_10072965 3300031712 Bacteria 1997
209 Ga0265342_10086436 3300031712 Bacteria 1803
210 Ga0307516_10350333 3300031730 Bacteria 1142
211 Ga0307406_10760508 3300031901 Bacteria 814
212 Ga0307412_10692557 3300031911 Bacteria 874
213 Ga0307416_100224163 3300032002 Bacteria 1806
214 Ga0307416_101056129 3300032002 Bacteria 916
215 Ga0307416_102297992 3300032002 Bacteria 640
216 Ga0373926_0035259 3300035083 Bacteria 1774
217 Ga0373923_0565091 3300035111 Bacteria 558
218 Ga0373943_0160944 3300035170 Bacteria 1222
219 Ga0373931_0060388 3300035691 Bacteria 2041
220 Ga0373937_0707971 3300036401 Bacteria 954
221 Ga0373925_1389631 3300037068 Bacteria 575
222 Ga0400483_041479 3300039062 Bacteria 4427
223 Ga0400483_144965 3300039062 Bacteria 108715
224 Ga0400483_194190 3300039062 Bacteria 89056
225 Ga0400483_266886 3300039062 Bacteria 5234
226 Ga0436365_0098461 3300039437 Bacteria 517
227 Ga0436365_0345660 3300039437 Bacteria 629
228 Ga0436365_0510687 3300039437 Bacteria 783
229 Ga0436365_1004240 3300039437 Bacteria 80154
230 Ga0436361_0786446 3300039447 Bacteria 595
231 Ga0436363_0635144 3300039450 Bacteria 3140
232 Ga0436362_1055748 3300039453 Bacteria 584
233 Ga0451577_0248389 3300042876 Bacteria 1610
234 Ga0451576_0906629 3300045051 Bacteria 925
235 Ga0451576_1512287 3300045051 Unclassified 697
236 Ga0495592_0955384 3300046454 Unclassified 501
237 Ga0495664_0276092 3300046477 Bacteria 1015
238 Ga0495664_0318615 3300046477 Bacteria 938
239 Ga0495584_0178123 3300046491 Bacteria 1081
240 Ga0495628_0868051 3300046516 Bacteria 628
241 Ga0495652_0051856 3300046529 Bacteria 3501
242 Ga0495586_0269103 3300046535 Bacteria 974
243 Ga0495587_0065364 3300046536 Bacteria 2124
244 Ga0495645_0183826 3300046543 Bacteria 1430
245 Ga0495645_0388654 3300046543 Bacteria 891
246 Ga0495622_0062806 3300046557 Bacteria 1719
247 Ga0495667_0811192 3300046559 Bacteria 577
248 Ga0495599_0629647 3300046678 Bacteria 623
249 Ga0495623_0243682 3300046679 Bacteria 1014
250 Ga0495646_0146432 3300046680 Bacteria 1316
251 Ga0495604_0401208 3300047317 Bacteria 903
252 Ga0495674_0069270 3300047319 Bacteria 3051
253 Ga0495680_0584818 3300047322 Bacteria 749
254 Ga0495675_0613718 3300047444 Bacteria 616
255 Ga0495593_0693397 3300047673 Bacteria 511
256 Ga0496106_0233140 3300048909 Bacteria 1470
257 Ga0496107_0065922 3300048910 Bacteria 2625
258 Ga0496108_0422038 3300048911 Bacteria 1165
259 Ga0496109_0273832 3300048912 Bacteria 1591
260 Ga0496109_2058909 3300048912 Bacteria 503
261 Ga0496110_0195744 3300048913 Bacteria 1836
262 Ga0496110_0289421 3300048913 Bacteria 1492
263 Ga0496111_0609010 3300048914 Bacteria 799
264 Ga0496117_0034398 3300048920 Bacteria 3817
265 Ga0496118_0088435 3300048921 Bacteria 2143
266 Ga0496121_0289595 3300048924 Bacteria 1116
267 Ga0496124_0207401 3300048927 Bacteria 1485
268 Ga0496124_0316105 3300048927 Bacteria 1120
269 Ga0496125_0002564 3300048928 Bacteria 23406
270 Ga0496126_0348569 3300048929 Bacteria 1211
271 Ga0496126_0516505 3300048929 Bacteria 952
272 Ga0495682_0018691 3300049460 Bacteria 2610
273 Ga0501032_0192926 3300049569 Bacteria 1331
274 Ga0501032_0555082 3300049569 Bacteria 732
275 Ga0501033_0883216 3300049570 Bacteria 601
276 Ga0501034_0026834 3300049571 Bacteria 5860
277 Ga0501036_0092344 3300049572 Bacteria 2557
278 Ga0501038_0385619 3300049574 Bacteria 1086
279 Ga0501043_0368389 3300049579 Bacteria 1089
280 Ga0501043_1069320 3300049579 Bacteria 571
281 Ga0501046_0051870 3300049580 Bacteria 3235
282 Ga0501047_0017144 3300049581 Bacteria 6929
283 Ga0501047_0344591 3300049581 Bacteria 1327
284 Ga0501048_0036685 3300049582 Bacteria 3523
285 Ga0501067_0003181 3300049583 Bacteria 9064
286 Ga0501067_0015252 3300049583 Bacteria 4254
287 Ga0501067_0146871 3300049583 Bacteria 1314
288 Ga0501067_0350368 3300049583 Bacteria 823
289 Ga0501069_0128789 3300049585 Bacteria 1448
290 Ga0501069_0936199 3300049585 Unclassified 528
291 Ga0501070_0009040 3300049586 Bacteria 8427
292 Ga0501072_0008173 3300049588 Bacteria 7943
293 Ga0501073_0008977 3300049589 Bacteria 7383
294 Ga0501073_0289334 3300049589 Bacteria 1130
295 Ga0501073_0756069 3300049589 Bacteria 670
296 Ga0501074_0009358 3300049590 Bacteria 7117
297 Ga0501074_0049281 3300049590 Bacteria 3041
298 Ga0501074_0575558 3300049590 Bacteria 797
299 Ga0501076_0522830 3300049592 Unclassified 978
300 Ga0501076_1555572 3300049592 Bacteria 543
301 Ga0501079_0054001 3300049741 Bacteria 3099
302 Ga0501079_0229758 3300049741 Bacteria 1449
303 Ga0501079_1070498 3300049741 Unclassified 635
304 Ga0501080_0075523 3300049742 Bacteria 3134
305 Ga0501080_0488992 3300049742 Bacteria 1100
306 Ga0501080_0768974 3300049742 Unclassified 846
307 Ga0501080_0860977 3300049742 Bacteria 792
308 Ga0501035_0006374 3300049822 Bacteria 11095
309 Ga0501035_0775704 3300049822 Bacteria 767
310 Ga0501044_0193134 3300049823 Bacteria 1997
311 Ga0501044_0198271 3300049823 Bacteria 1966
312 nmdc:mga05p37_328843_c1 3300050507 Bacteria 1806
313 nmdc:mga0qj67_1235012_c1 3300050509 Bacteria 580
314 nmdc:mga0qj67_405192_c1 3300050509 Bacteria 1100
315 nmdc:mga0qj67_583460_c1 3300050509 Bacteria 895
316 nmdc:mga0qj67_681179_c1 3300050509 Bacteria 819
317 nmdc:mga0qj67_73572_c1 3300050509 Bacteria 2729
318 nmdc:mga06r32_242053_c1 3300050510 Bacteria 1791
319 nmdc:mga06r32_925057_c1 3300050510 Bacteria 827
320 nmdc:mga08y16_548897_c1 3300050511 Bacteria 1170
321 nmdc:mga0rr50_799262_c1 3300050513 Bacteria 805
322 nmdc:mga0a205_368328_c1 3300050515 Bacteria 1303
323 Ga0500595_071541 3300053119 Unclassified 1028
324 Ga0500655_034975 3300053133 Unclassified 975
325 Ga0500619_012642 3300053154 Bacteria 2213
326 Ga0501084_0060062 3300054114 Bacteria 3183
327 Ga0501082_0215902 3300060353 Bacteria 1669
328 Ga0501082_1795440 3300060353 Bacteria 535

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026075 Ga0207708_11885768 Ga0207708_118857682 64
2 3300048913 Ga0496110_0289421 Ga0496110_0289421_644_847 67
3 3300005327 Ga0070658_11609781 Ga0070658_116097812 77
4 3300005563 Ga0068855_101003133 Ga0068855_1010031332 77
5 3300009093 Ga0105240_10153685 Ga0105240_101536853 77
6 3300009545 Ga0105237_10826615 Ga0105237_108266152 77
7 3300010375 Ga0105239_10144809 Ga0105239_101448093 77
8 3300025909 Ga0207705_11352103 Ga0207705_113521032 77
9 3300025949 Ga0207667_11964941 Ga0207667_119649412 77
10 3300031235 Ga0265330_10400241 Ga0265330_104002411 77
11 3300031247 Ga0265340_10335619 Ga0265340_103356192 77
12 3300031250 Ga0265331_10396215 Ga0265331_103962152 77
13 3300039062 Ga0400483_041479 Ga0400483_041479_2466_2729 77
14 3300039062 Ga0400483_266886 Ga0400483_266886_2150_2413 77
15 3300039453 Ga0436362_1055748 Ga0436362_1055748_215_460 77
16 3300046477 Ga0495664_0318615 Ga0495664_0318615_123_368 77
17 3300046536 Ga0495587_0065364 Ga0495587_0065364_420_665 77
18 3300046678 Ga0495599_0629647 Ga0495599_0629647_92_337 77
19 3300046679 Ga0495623_0243682 Ga0495623_0243682_191_436 77
20 3300046680 Ga0495646_0146432 Ga0495646_0146432_496_741 77
21 3300047317 Ga0495604_0401208 Ga0495604_0401208_166_411 77
22 3300047319 Ga0495674_0069270 Ga0495674_0069270_2200_2445 77
23 3300047322 Ga0495680_0584818 Ga0495680_0584818_75_320 77
24 3300047444 Ga0495675_0613718 Ga0495675_0613718_234_479 77
25 3300047673 Ga0495593_0693397 Ga0495593_0693397_154_399 77
26 3300049569 Ga0501032_0555082 Ga0501032_0555082_163_408 77
27 3300049570 Ga0501033_0883216 Ga0501033_0883216_227_472 77
28 3300049574 Ga0501038_0385619 Ga0501038_0385619_651_896 77
29 3300049579 Ga0501043_1069320 Ga0501043_1069320_112_357 77
30 3300049581 Ga0501047_0344591 Ga0501047_0344591_70_315 77
31 3300049589 Ga0501073_0756069 Ga0501073_0756069_198_443 77
32 3300049742 Ga0501080_0860977 Ga0501080_0860977_80_325 77
33 3300049822 Ga0501035_0775704 Ga0501035_0775704_38_283 77
34 3300049823 Ga0501044_0193134 Ga0501044_0193134_1149_1394 77
35 3300053119 Ga0500595_071541 Ga0500595_071541_329_574 77
36 3300021384 Ga0213876_10305279 Ga0213876_103052792 78
37 3300039062 Ga0400483_144965 Ga0400483_144965_1764_2015 78
38 3300039062 Ga0400483_194190 Ga0400483_194190_74517_74768 78
39 3300039437 Ga0436365_0510687 Ga0436365_0510687_59_304 78
40 3300005328 Ga0070676_10404998 Ga0070676_104049982 79
41 3300005329 Ga0070683_100244793 Ga0070683_1002447931 79
42 3300005330 Ga0070690_101185525 Ga0070690_1011855251 79
43 3300005334 Ga0068869_101195315 Ga0068869_1011953152 79
44 3300005336 Ga0070680_100000023 Ga0070680_10000002357 79
45 3300005336 Ga0070680_100454164 Ga0070680_1004541641 79
46 3300005337 Ga0070682_101149357 Ga0070682_1011493572 79
47 3300005337 Ga0070682_101679019 Ga0070682_1016790191 79
48 3300005339 Ga0070660_100948946 Ga0070660_1009489462 79
49 3300005343 Ga0070687_101543501 Ga0070687_1015435012 79
50 3300005344 Ga0070661_100000441 Ga0070661_10000044127 79
51 3300005344 Ga0070661_100074679 Ga0070661_1000746793 79
52 3300005344 Ga0070661_100135134 Ga0070661_1001351343 79
53 3300005356 Ga0070674_100985471 Ga0070674_1009854712 79
54 3300005356 Ga0070674_101534418 Ga0070674_1015344182 79
55 3300005366 Ga0070659_101397363 Ga0070659_1013973631 79
56 3300005367 Ga0070667_100070748 Ga0070667_1000707482 79
57 3300005406 Ga0070703_10075908 Ga0070703_100759082 79
58 3300005406 Ga0070703_10583269 Ga0070703_105832692 79
59 3300005434 Ga0070709_11302721 Ga0070709_113027211 79
60 3300005437 Ga0070710_10724703 Ga0070710_107247032 79
61 3300005439 Ga0070711_100427221 Ga0070711_1004272212 79
62 3300005440 Ga0070705_100302358 Ga0070705_1003023582 79
63 3300005444 Ga0070694_100174535 Ga0070694_1001745353 79
64 3300005444 Ga0070694_101006050 Ga0070694_1010060502 79
65 3300005444 Ga0070694_101518661 Ga0070694_1015186612 79
66 3300005445 Ga0070708_101532257 Ga0070708_1015322572 79
67 3300005445 Ga0070708_102123206 Ga0070708_1021232062 79
68 3300005457 Ga0070662_100691332 Ga0070662_1006913322 79
69 3300005458 Ga0070681_10000002 Ga0070681_1000000235 79
70 3300005467 Ga0070706_101148850 Ga0070706_1011488502 79
71 3300005530 Ga0070679_100000445 Ga0070679_10000044526 79
72 3300005539 Ga0068853_100373311 Ga0068853_1003733112 79
73 3300005539 Ga0068853_101781409 Ga0068853_1017814092 79
74 3300005545 Ga0070695_100010028 Ga0070695_1000100285 79
75 3300005545 Ga0070695_101306853 Ga0070695_1013068532 79
76 3300005546 Ga0070696_100035919 Ga0070696_1000359193 79
77 3300005546 Ga0070696_100101640 Ga0070696_1001016402 79
78 3300005563 Ga0068855_100000024 Ga0068855_10000002423 79
79 3300005563 Ga0068855_100134358 Ga0068855_1001343582 79
80 3300005563 Ga0068855_100805925 Ga0068855_1008059252 79
81 3300005577 Ga0068857_101655933 Ga0068857_1016559332 79
82 3300005614 Ga0068856_100328823 Ga0068856_1003288233 79
83 3300005614 Ga0068856_101418462 Ga0068856_1014184622 79
84 3300005614 Ga0068856_102069534 Ga0068856_1020695342 79
85 3300005616 Ga0068852_100008637 Ga0068852_1000086375 79
86 3300005616 Ga0068852_100286983 Ga0068852_1002869833 79
87 3300005616 Ga0068852_101344080 Ga0068852_1013440802 79
88 3300005617 Ga0068859_100892065 Ga0068859_1008920653 79
89 3300005618 Ga0068864_100690852 Ga0068864_1006908523 79
90 3300005618 Ga0068864_101103255 Ga0068864_1011032552 79
91 3300005834 Ga0068851_10136501 Ga0068851_101365012 79
92 3300005844 Ga0068862_101483806 Ga0068862_1014838062 79
93 3300006237 Ga0097621_100002441 Ga0097621_1000024413 79
94 3300006237 Ga0097621_100148396 Ga0097621_1001483963 79
95 3300006237 Ga0097621_100638715 Ga0097621_1006387152 79
96 3300006237 Ga0097621_101732805 Ga0097621_1017328052 79
97 3300006358 Ga0068871_100133302 Ga0068871_1001333023 79
98 3300006358 Ga0068871_100205953 Ga0068871_1002059532 79
99 3300006844 Ga0075428_100055712 Ga0075428_1000557123 79
100 3300006846 Ga0075430_100238779 Ga0075430_1002387793 79
101 3300006846 Ga0075430_100316662 Ga0075430_1003166622 79
102 3300006846 Ga0075430_100788441 Ga0075430_1007884412 79
103 3300006847 Ga0075431_100253435 Ga0075431_1002534352 79
104 3300006847 Ga0075431_100811944 Ga0075431_1008119442 79
105 3300006852 Ga0075433_10276859 Ga0075433_102768592 79
106 3300006871 Ga0075434_100091834 Ga0075434_1000918343 79
107 3300006914 Ga0075436_100412222 Ga0075436_1004122222 79
108 3300006931 Ga0097620_100892196 Ga0097620_1008921963 79
109 3300007076 Ga0075435_101024419 Ga0075435_1010244192 79
110 3300007788 Ga0099795_10085331 Ga0099795_100853313 79
111 3300009093 Ga0105240_10000564 Ga0105240_1000056411 79
112 3300009093 Ga0105240_10009705 Ga0105240_1000970513 79
113 3300009093 Ga0105240_10516733 Ga0105240_105167333 79
114 3300009093 Ga0105240_11558413 Ga0105240_115584132 79
115 3300009093 Ga0105240_12587932 Ga0105240_125879322 79
116 3300009094 Ga0111539_10050686 Ga0111539_100506865 79
117 3300009094 Ga0111539_12979346 Ga0111539_129793462 79
118 3300009098 Ga0105245_10545443 Ga0105245_105454432 79
119 3300009098 Ga0105245_10796417 Ga0105245_107964172 79
120 3300009101 Ga0105247_10008181 Ga0105247_100081813 79
121 3300009101 Ga0105247_10325158 Ga0105247_103251582 79
122 3300009147 Ga0114129_10017466 Ga0114129_100174662 79
123 3300009147 Ga0114129_11048101 Ga0114129_110481011 79
124 3300009174 Ga0105241_10219054 Ga0105241_102190542 79
125 3300009174 Ga0105241_10327857 Ga0105241_103278573 79
126 3300009174 Ga0105241_12301487 Ga0105241_123014871 79
127 3300009176 Ga0105242_10078686 Ga0105242_100786865 79
128 3300009176 Ga0105242_10316677 Ga0105242_103166773 79
129 3300009177 Ga0105248_10000009 Ga0105248_10000009359 79
130 3300009177 Ga0105248_10054723 Ga0105248_100547233 79
131 3300009545 Ga0105237_10159856 Ga0105237_101598564 79
132 3300009545 Ga0105237_11739064 Ga0105237_117390641 79
133 3300009551 Ga0105238_10253735 Ga0105238_102537352 79
134 3300009551 Ga0105238_10253736 Ga0105238_102537362 79
135 3300010375 Ga0105239_10006486 Ga0105239_100064863 79
136 3300010375 Ga0105239_10017913 Ga0105239_100179133 79
137 3300010375 Ga0105239_10100036 Ga0105239_101000363 79
138 3300013104 Ga0157370_10716036 Ga0157370_107160362 79
139 3300013105 Ga0157369_10011935 Ga0157369_100119353 79
140 3300013105 Ga0157369_10054969 Ga0157369_100549693 79
141 3300013105 Ga0157369_10215292 Ga0157369_102152923 79
142 3300013105 Ga0157369_10842932 Ga0157369_108429323 79
143 3300013297 Ga0157378_10051694 Ga0157378_100516943 79
144 3300013297 Ga0157378_10441974 Ga0157378_104419742 79
145 3300013297 Ga0157378_11212762 Ga0157378_112127622 79
146 3300013297 Ga0157378_12708942 Ga0157378_127089422 79
147 3300013307 Ga0157372_10897273 Ga0157372_108972732 79
148 3300013307 Ga0157372_12927419 Ga0157372_129274191 79
149 3300014325 Ga0163163_11210271 Ga0163163_112102712 79
150 3300014969 Ga0157376_10033697 Ga0157376_100336972 79
151 3300014969 Ga0157376_12676805 Ga0157376_126768052 79
152 3300021361 Ga0213872_10088235 Ga0213872_100882353 79
153 3300021384 Ga0213876_10004771 Ga0213876_100047719 79
154 3300025885 Ga0207653_10190213 Ga0207653_101902132 79
155 3300025885 Ga0207653_10395555 Ga0207653_103955552 79
156 3300025900 Ga0207710_10136241 Ga0207710_101362412 79
157 3300025900 Ga0207710_10204197 Ga0207710_102041972 79
158 3300025903 Ga0207680_10000878 Ga0207680_100008787 79
159 3300025907 Ga0207645_10559829 Ga0207645_105598292 79
160 3300025910 Ga0207684_10190296 Ga0207684_101902963 79
161 3300025911 Ga0207654_10062452 Ga0207654_100624523 79
162 3300025912 Ga0207707_10000002 Ga0207707_10000002916 79
163 3300025912 Ga0207707_10900736 Ga0207707_109007362 79
164 3300025913 Ga0207695_10000003 Ga0207695_10000003145 79
165 3300025913 Ga0207695_10379979 Ga0207695_103799792 79
166 3300025917 Ga0207660_10007667 Ga0207660_100076673 79
167 3300025917 Ga0207660_10232486 Ga0207660_102324862 79
168 3300025920 Ga0207649_10000497 Ga0207649_1000049712 79
169 3300025920 Ga0207649_10007709 Ga0207649_100077093 79
170 3300025920 Ga0207649_10615815 Ga0207649_106158153 79
171 3300025920 Ga0207649_10736266 Ga0207649_107362662 79
172 3300025921 Ga0207652_10000299 Ga0207652_1000029910 79
173 3300025924 Ga0207694_10000016 Ga0207694_10000016124 79
174 3300025924 Ga0207694_10173987 Ga0207694_101739872 79
175 3300025933 Ga0207706_10337294 Ga0207706_103372942 79
176 3300025934 Ga0207686_10034824 Ga0207686_100348244 79
177 3300025934 Ga0207686_10961814 Ga0207686_109618142 79
178 3300025937 Ga0207669_10913494 Ga0207669_109134942 79
179 3300025939 Ga0207665_10969774 Ga0207665_109697742 79
180 3300025941 Ga0207711_10230090 Ga0207711_102300903 79
181 3300025944 Ga0207661_10111684 Ga0207661_101116842 79
182 3300025949 Ga0207667_10000021 Ga0207667_10000021230 79
183 3300025949 Ga0207667_10111163 Ga0207667_101111633 79
184 3300025972 Ga0207668_11049174 Ga0207668_110491741 79
185 3300025986 Ga0207658_10050608 Ga0207658_100506082 79
186 3300026041 Ga0207639_10301731 Ga0207639_103017313 79
187 3300026078 Ga0207702_10282802 Ga0207702_102828022 79
188 3300026078 Ga0207702_10848216 Ga0207702_108482161 79
189 3300026078 Ga0207702_12454804 Ga0207702_124548042 79
190 3300026088 Ga0207641_11269268 Ga0207641_112692682 79
191 3300026095 Ga0207676_10572274 Ga0207676_105722742 79
192 3300026116 Ga0207674_10988116 Ga0207674_109881162 79
193 3300026142 Ga0207698_10033544 Ga0207698_100335443 79
194 3300026142 Ga0207698_10037495 Ga0207698_100374955 79
195 3300026142 Ga0207698_10646416 Ga0207698_106464161 79
196 3300026142 Ga0207698_11779676 Ga0207698_117796761 79
197 3300028379 Ga0268266_11203124 Ga0268266_112031242 79
198 3300028381 Ga0268264_10342984 Ga0268264_103429842 79
199 3300028577 Ga0265318_10000046 Ga0265318_1000004656 79
200 3300028800 Ga0265338_10088455 Ga0265338_100884553 79
201 3300028800 Ga0265338_10759604 Ga0265338_107596042 79
202 3300031235 Ga0265330_10172379 Ga0265330_101723792 79
203 3300031235 Ga0265330_10507805 Ga0265330_105078052 79
204 3300031238 Ga0265332_10062713 Ga0265332_100627132 79
205 3300031238 Ga0265332_10188231 Ga0265332_101882312 79
206 3300031240 Ga0265320_10000179 Ga0265320_1000017925 79
207 3300031241 Ga0265325_10045126 Ga0265325_100451262 79
208 3300031241 Ga0265325_10280024 Ga0265325_102800242 79
209 3300031242 Ga0265329_10089092 Ga0265329_100890922 79
210 3300031249 Ga0265339_10104691 Ga0265339_101046912 79
211 3300031249 Ga0265339_10225416 Ga0265339_102254162 79
212 3300031250 Ga0265331_10000080 Ga0265331_1000008095 79
213 3300031251 Ga0265327_10263013 Ga0265327_102630132 79
214 3300031251 Ga0265327_10343587 Ga0265327_103435872 79
215 3300031344 Ga0265316_10259035 Ga0265316_102590352 79
216 3300031344 Ga0265316_10624048 Ga0265316_106240482 79
217 3300031548 Ga0307408_101344685 Ga0307408_1013446851 79
218 3300031595 Ga0265313_10017352 Ga0265313_100173526 79
219 3300031711 Ga0265314_10040241 Ga0265314_100402412 79
220 3300031711 Ga0265314_10077190 Ga0265314_100771903 79
221 3300031711 Ga0265314_10108011 Ga0265314_101080113 79
222 3300031711 Ga0265314_10156281 Ga0265314_101562812 79
223 3300031711 Ga0265314_10184671 Ga0265314_101846713 79
224 3300031711 Ga0265314_10367834 Ga0265314_103678342 79
225 3300031711 Ga0265314_10505432 Ga0265314_105054322 79
226 3300031712 Ga0265342_10072965 Ga0265342_100729652 79
227 3300031712 Ga0265342_10086436 Ga0265342_100864363 79
228 3300031730 Ga0307516_10350333 Ga0307516_103503332 79
229 3300031901 Ga0307406_10760508 Ga0307406_107605082 79
230 3300031911 Ga0307412_10692557 Ga0307412_106925572 79
231 3300032002 Ga0307416_100224163 Ga0307416_1002241633 79
232 3300032002 Ga0307416_101056129 Ga0307416_1010561292 79
233 3300032002 Ga0307416_102297992 Ga0307416_1022979922 79
234 3300035083 Ga0373926_0035259 Ga0373926_0035259_75_326 79
235 3300035111 Ga0373923_0565091 Ga0373923_0565091_32_283 79
236 3300035170 Ga0373943_0160944 Ga0373943_0160944_341_592 79
237 3300035691 Ga0373931_0060388 Ga0373931_0060388_1400_1651 79
238 3300036401 Ga0373937_0707971 Ga0373937_0707971_149_400 79
239 3300037068 Ga0373925_1389631 Ga0373925_1389631_69_320 79
240 3300039437 Ga0436365_0098461 Ga0436365_0098461_146_397 79
241 3300039437 Ga0436365_0345660 Ga0436365_0345660_356_607 79
242 3300039437 Ga0436365_1004240 Ga0436365_1004240_18195_18452 79
243 3300039447 Ga0436361_0786446 Ga0436361_0786446_36_287 79
244 3300039450 Ga0436363_0635144 Ga0436363_0635144_1645_1896 79
245 3300042876 Ga0451577_0248389 Ga0451577_0248389_843_1094 79
246 3300045051 Ga0451576_0906629 Ga0451576_0906629_594_845 79
247 3300045051 Ga0451576_1512287 Ga0451576_1512287_141_392 79
248 3300046454 Ga0495592_0955384 Ga0495592_0955384_123_374 79
249 3300046477 Ga0495664_0276092 Ga0495664_0276092_416_667 79
250 3300046491 Ga0495584_0178123 Ga0495584_0178123_643_894 79
251 3300046516 Ga0495628_0868051 Ga0495628_0868051_204_455 79
252 3300046529 Ga0495652_0051856 Ga0495652_0051856_366_617 79
253 3300046535 Ga0495586_0269103 Ga0495586_0269103_35_286 79
254 3300046543 Ga0495645_0183826 Ga0495645_0183826_495_746 79
255 3300046543 Ga0495645_0388654 Ga0495645_0388654_260_511 79
256 3300046557 Ga0495622_0062806 Ga0495622_0062806_427_678 79
257 3300046559 Ga0495667_0811192 Ga0495667_0811192_67_318 79
258 3300048909 Ga0496106_0233140 Ga0496106_0233140_1108_1359 79
259 3300048910 Ga0496107_0065922 Ga0496107_0065922_534_785 79
260 3300048911 Ga0496108_0422038 Ga0496108_0422038_491_742 79
261 3300048912 Ga0496109_0273832 Ga0496109_0273832_922_1173 79
262 3300048912 Ga0496109_2058909 Ga0496109_2058909_44_295 79
263 3300048913 Ga0496110_0195744 Ga0496110_0195744_613_864 79
264 3300049460 Ga0495682_0018691 Ga0495682_0018691_540_791 79
265 3300049569 Ga0501032_0192926 Ga0501032_0192926_908_1159 79
266 3300049571 Ga0501034_0026834 Ga0501034_0026834_4916_5167 79
267 3300049572 Ga0501036_0092344 Ga0501036_0092344_1139_1390 79
268 3300049579 Ga0501043_0368389 Ga0501043_0368389_26_277 79
269 3300049580 Ga0501046_0051870 Ga0501046_0051870_2210_2461 79
270 3300049581 Ga0501047_0017144 Ga0501047_0017144_1351_1602 79
271 3300049582 Ga0501048_0036685 Ga0501048_0036685_2122_2373 79
272 3300049583 Ga0501067_0003181 Ga0501067_0003181_1930_2181 79
273 3300049583 Ga0501067_0015252 Ga0501067_0015252_1638_1889 79
274 3300049583 Ga0501067_0146871 Ga0501067_0146871_875_1126 79
275 3300049583 Ga0501067_0350368 Ga0501067_0350368_137_388 79
276 3300049585 Ga0501069_0128789 Ga0501069_0128789_709_960 79
277 3300049585 Ga0501069_0936199 Ga0501069_0936199_90_341 79
278 3300049586 Ga0501070_0009040 Ga0501070_0009040_428_679 79
279 3300049588 Ga0501072_0008173 Ga0501072_0008173_3742_3993 79
280 3300049589 Ga0501073_0008977 Ga0501073_0008977_4894_5145 79
281 3300049589 Ga0501073_0289334 Ga0501073_0289334_745_996 79
282 3300049590 Ga0501074_0009358 Ga0501074_0009358_2077_2328 79
283 3300049590 Ga0501074_0049281 Ga0501074_0049281_243_494 79
284 3300049590 Ga0501074_0575558 Ga0501074_0575558_250_501 79
285 3300049592 Ga0501076_1555572 Ga0501076_1555572_75_326 79
286 3300049741 Ga0501079_0054001 Ga0501079_0054001_1501_1752 79
287 3300049741 Ga0501079_0229758 Ga0501079_0229758_1035_1286 79
288 3300049742 Ga0501080_0075523 Ga0501080_0075523_1501_1752 79
289 3300049742 Ga0501080_0488992 Ga0501080_0488992_232_483 79
290 3300049742 Ga0501080_0768974 Ga0501080_0768974_502_753 79
291 3300049822 Ga0501035_0006374 Ga0501035_0006374_1853_2104 79
292 3300049823 Ga0501044_0198271 Ga0501044_0198271_1324_1575 79
293 3300050507 nmdc:mga05p37_328843_c1 nmdc:mga05p37_328843_c1_921_1172 79
294 3300050509 nmdc:mga0qj67_1235012_c1 nmdc:mga0qj67_1235012_c1_121_372 79
295 3300050509 nmdc:mga0qj67_405192_c1 nmdc:mga0qj67_405192_c1_740_991 79
296 3300050509 nmdc:mga0qj67_583460_c1 nmdc:mga0qj67_583460_c1_182_433 79
297 3300050509 nmdc:mga0qj67_681179_c1 nmdc:mga0qj67_681179_c1_47_298 79
298 3300050509 nmdc:mga0qj67_73572_c1 nmdc:mga0qj67_73572_c1_42_293 79
299 3300050510 nmdc:mga06r32_242053_c1 nmdc:mga06r32_242053_c1_476_727 79
300 3300050510 nmdc:mga06r32_925057_c1 nmdc:mga06r32_925057_c1_262_513 79
301 3300050511 nmdc:mga08y16_548897_c1 nmdc:mga08y16_548897_c1_15_266 79
302 3300050513 nmdc:mga0rr50_799262_c1 nmdc:mga0rr50_799262_c1_439_690 79
303 3300050515 nmdc:mga0a205_368328_c1 nmdc:mga0a205_368328_c1_534_785 79
304 3300053133 Ga0500655_034975 Ga0500655_034975_324_575 79
305 3300053154 Ga0500619_012642 Ga0500619_012642_96_347 79
306 3300054114 Ga0501084_0060062 Ga0501084_0060062_1757_2008 79
307 3300060353 Ga0501082_0215902 Ga0501082_0215902_402_653 79
308 3300060353 Ga0501082_1795440 Ga0501082_1795440_43_294 79
309 3300005289 Ga0065704_10080720 Ga0065704_100807203 81
310 3300005434 Ga0070709_11348581 Ga0070709_113485811 81
311 3300009036 Ga0105244_10026643 Ga0105244_100266434 81
312 3300009092 Ga0105250_10277163 Ga0105250_102771632 81
313 3300009148 Ga0105243_10033233 Ga0105243_100332334 81
314 3300009148 Ga0105243_11715962 Ga0105243_117159622 81
315 3300025711 Ga0207696_1000022 Ga0207696_1000022274 81
316 3300025728 Ga0207655_1051982 Ga0207655_10519823 81
317 3300025735 Ga0207713_1079142 Ga0207713_10791422 81
318 3300048914 Ga0496111_0609010 Ga0496111_0609010_503_748 81
319 3300048920 Ga0496117_0034398 Ga0496117_0034398_2939_3184 81
320 3300048921 Ga0496118_0088435 Ga0496118_0088435_626_871 81
321 3300048924 Ga0496121_0289595 Ga0496121_0289595_380_625 81
322 3300048927 Ga0496124_0207401 Ga0496124_0207401_129_374 81
323 3300048927 Ga0496124_0316105 Ga0496124_0316105_129_374 81
324 3300048928 Ga0496125_0002564 Ga0496125_0002564_1147_1392 81
325 3300048929 Ga0496126_0348569 Ga0496126_0348569_423_668 81
326 3300048929 Ga0496126_0516505 Ga0496126_0516505_649_894 81
327 3300049592 Ga0501076_0522830 Ga0501076_0522830_549_815 81
328 3300049741 Ga0501079_1070498 Ga0501079_1070498_327_593 81

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

14

94

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8758 4 81
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8467 4 81
1vjk-assembly1.cif.gz_A putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001 0.81 1 78
2qie-assembly1.cif.gz_D staphylococcus aureus molybdopterin synthase in complex with precursor z 0.8088 4 81
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8068 2 81
ID Description Score Start End Superfamily
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9137 3 81 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8374 1 81 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8326 4 78 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8133 4 78 3.10.20.30
2qieD00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8088 4 81 3.10.20.30
ID Description Score Start End GO Terms
AF-Q88NB9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9747 1 81 GO:0000166
GO:0006777
GO:0016740
GO:1990133
AF-Q88NB9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.963 1 81 GO:0000166
GO:0006777
GO:0016740
GO:1990133
AF-A0A7V7GTJ3-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9371 3 81 GO:0000166
GO:0006777
GO:1990133
AF-A0A1Y0CWC5-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9301 1 81 GO:0000166
GO:0006777
GO:1990133
AF-A0A078MAB5-F1-model_v4 Molybdopterin converting factor, small subunit 0.929 3 81

Feature Viewer

pLDDT pTM Quality
91.94 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map