F409119
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 328 | 198 | 328 | 83 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_11348581|Ga0070709_113485811 |
| Length | 94 |
| Sequence | VKAYIDQMSKFVKLVYFAWLRERIGTAQEEISLPDGVDTVEALIDYLRTVGPRYADAFLPHKTIRCAINHEFAEAQSKINANDEVAFFPPVTGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 48 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 107 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 110 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 112 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 120 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 125 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 127 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 133 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 134 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 135 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 136 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 137 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 156 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 157 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 160 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 161 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 162 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 163 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 164 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 165 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 166 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 167 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 195 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 196 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 197 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.91 |
| Nodule | 0 |
| Rhizoplane | 2.44 |
| Rhizosphere | 90.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10080720 | 3300005289 | Bacteria | 3891 |
| 2 | Ga0070658_11609781 | 3300005327 | Unclassified | 563 |
| 3 | Ga0070676_10404998 | 3300005328 | Bacteria | 950 |
| 4 | Ga0070683_100244793 | 3300005329 | Bacteria | 1705 |
| 5 | Ga0070690_101185525 | 3300005330 | Unclassified | 609 |
| 6 | Ga0068869_101195315 | 3300005334 | Bacteria | 668 |
| 7 | Ga0070680_100000023 | 3300005336 | Bacteria | 78765 |
| 8 | Ga0070680_100454164 | 3300005336 | Bacteria | 1094 |
| 9 | Ga0070682_101149357 | 3300005337 | Bacteria | 652 |
| 10 | Ga0070682_101679019 | 3300005337 | Bacteria | 551 |
| 11 | Ga0070660_100948946 | 3300005339 | Bacteria | 726 |
| 12 | Ga0070687_101543501 | 3300005343 | Bacteria | 500 |
| 13 | Ga0070661_100000441 | 3300005344 | Bacteria | 31826 |
| 14 | Ga0070661_100074679 | 3300005344 | Bacteria | 2497 |
| 15 | Ga0070661_100135134 | 3300005344 | Bacteria | 1855 |
| 16 | Ga0070674_100985471 | 3300005356 | Unclassified | 739 |
| 17 | Ga0070674_101534418 | 3300005356 | Bacteria | 599 |
| 18 | Ga0070659_101397363 | 3300005366 | Unclassified | 622 |
| 19 | Ga0070667_100070748 | 3300005367 | Bacteria | 2970 |
| 20 | Ga0070703_10075908 | 3300005406 | Bacteria | 1133 |
| 21 | Ga0070703_10583269 | 3300005406 | Bacteria | 514 |
| 22 | Ga0070709_11302721 | 3300005434 | Bacteria | 586 |
| 23 | Ga0070709_11348581 | 3300005434 | Bacteria | 576 |
| 24 | Ga0070710_10724703 | 3300005437 | Bacteria | 704 |
| 25 | Ga0070711_100427221 | 3300005439 | Bacteria | 1081 |
| 26 | Ga0070705_100302358 | 3300005440 | Bacteria | 1147 |
| 27 | Ga0070694_100174535 | 3300005444 | Bacteria | 1585 |
| 28 | Ga0070694_101006050 | 3300005444 | Bacteria | 692 |
| 29 | Ga0070694_101518661 | 3300005444 | Bacteria | 567 |
| 30 | Ga0070708_101532257 | 3300005445 | Bacteria | 621 |
| 31 | Ga0070708_102123206 | 3300005445 | Bacteria | 519 |
| 32 | Ga0070662_100691332 | 3300005457 | Bacteria | 862 |
| 33 | Ga0070681_10000002 | 3300005458 | Bacteria | 821814 |
| 34 | Ga0070706_101148850 | 3300005467 | Bacteria | 714 |
| 35 | Ga0070679_100000445 | 3300005530 | Bacteria | 35145 |
| 36 | Ga0068853_100373311 | 3300005539 | Bacteria | 1331 |
| 37 | Ga0068853_101781409 | 3300005539 | Bacteria | 597 |
| 38 | Ga0070695_100010028 | 3300005545 | Bacteria | 5650 |
| 39 | Ga0070695_101306853 | 3300005545 | Bacteria | 599 |
| 40 | Ga0070696_100035919 | 3300005546 | Bacteria | 3414 |
| 41 | Ga0070696_100101640 | 3300005546 | Bacteria | 2061 |
| 42 | Ga0068855_100000024 | 3300005563 | Bacteria | 184241 |
| 43 | Ga0068855_100134358 | 3300005563 | Bacteria | 2823 |
| 44 | Ga0068855_100805925 | 3300005563 | Bacteria | 998 |
| 45 | Ga0068855_101003133 | 3300005563 | Unclassified | 877 |
| 46 | Ga0068857_101655933 | 3300005577 | Unclassified | 625 |
| 47 | Ga0068856_100328823 | 3300005614 | Bacteria | 1546 |
| 48 | Ga0068856_101418462 | 3300005614 | Unclassified | 709 |
| 49 | Ga0068856_102069534 | 3300005614 | Bacteria | 579 |
| 50 | Ga0068852_100008637 | 3300005616 | Bacteria | 7526 |
| 51 | Ga0068852_100286983 | 3300005616 | Bacteria | 1588 |
| 52 | Ga0068852_101344080 | 3300005616 | Bacteria | 736 |
| 53 | Ga0068859_100892065 | 3300005617 | Bacteria | 974 |
| 54 | Ga0068864_100690852 | 3300005618 | Bacteria | 996 |
| 55 | Ga0068864_101103255 | 3300005618 | Bacteria | 790 |
| 56 | Ga0068851_10136501 | 3300005834 | Bacteria | 1330 |
| 57 | Ga0068862_101483806 | 3300005844 | Bacteria | 683 |
| 58 | Ga0097621_100002441 | 3300006237 | Bacteria | 12724 |
| 59 | Ga0097621_100148396 | 3300006237 | Bacteria | 2010 |
| 60 | Ga0097621_100638715 | 3300006237 | Bacteria | 976 |
| 61 | Ga0097621_101732805 | 3300006237 | Unclassified | 595 |
| 62 | Ga0068871_100133302 | 3300006358 | Bacteria | 2108 |
| 63 | Ga0068871_100205953 | 3300006358 | Bacteria | 1700 |
| 64 | Ga0075428_100055712 | 3300006844 | Bacteria | 4332 |
| 65 | Ga0075430_100238779 | 3300006846 | Bacteria | 1506 |
| 66 | Ga0075430_100316662 | 3300006846 | Bacteria | 1290 |
| 67 | Ga0075430_100788441 | 3300006846 | Bacteria | 783 |
| 68 | Ga0075431_100253435 | 3300006847 | Bacteria | 1788 |
| 69 | Ga0075431_100811944 | 3300006847 | Bacteria | 908 |
| 70 | Ga0075433_10276859 | 3300006852 | Bacteria | 1487 |
| 71 | Ga0075434_100091834 | 3300006871 | Bacteria | 3038 |
| 72 | Ga0075436_100412222 | 3300006914 | Bacteria | 980 |
| 73 | Ga0097620_100892196 | 3300006931 | Bacteria | 974 |
| 74 | Ga0075435_101024419 | 3300007076 | Bacteria | 721 |
| 75 | Ga0099795_10085331 | 3300007788 | Bacteria | 1215 |
| 76 | Ga0105244_10026643 | 3300009036 | Bacteria | 3125 |
| 77 | Ga0105250_10277163 | 3300009092 | Bacteria | 721 |
| 78 | Ga0105240_10000564 | 3300009093 | Bacteria | 68685 |
| 79 | Ga0105240_10009705 | 3300009093 | Bacteria | 13589 |
| 80 | Ga0105240_10153685 | 3300009093 | Bacteria | 2739 |
| 81 | Ga0105240_10516733 | 3300009093 | Bacteria | 1326 |
| 82 | Ga0105240_11558413 | 3300009093 | Bacteria | 692 |
| 83 | Ga0105240_12587932 | 3300009093 | Bacteria | 524 |
| 84 | Ga0111539_10050686 | 3300009094 | Bacteria | 4945 |
| 85 | Ga0111539_12979346 | 3300009094 | Bacteria | 547 |
| 86 | Ga0105245_10545443 | 3300009098 | Bacteria | 1181 |
| 87 | Ga0105245_10796417 | 3300009098 | Bacteria | 983 |
| 88 | Ga0105247_10008181 | 3300009101 | Bacteria | 6387 |
| 89 | Ga0105247_10325158 | 3300009101 | Bacteria | 1074 |
| 90 | Ga0114129_10017466 | 3300009147 | Bacteria | 10215 |
| 91 | Ga0114129_11048101 | 3300009147 | Bacteria | 1024 |
| 92 | Ga0105243_10033233 | 3300009148 | Bacteria | 3989 |
| 93 | Ga0105243_11715962 | 3300009148 | Bacteria | 657 |
| 94 | Ga0105241_10219054 | 3300009174 | Bacteria | 1599 |
| 95 | Ga0105241_10327857 | 3300009174 | Bacteria | 1322 |
| 96 | Ga0105241_12301487 | 3300009174 | Unclassified | 536 |
| 97 | Ga0105242_10078686 | 3300009176 | Bacteria | 2753 |
| 98 | Ga0105242_10316677 | 3300009176 | Bacteria | 1429 |
| 99 | Ga0105248_10000009 | 3300009177 | Bacteria | 403549 |
| 100 | Ga0105248_10054723 | 3300009177 | Bacteria | 4476 |
| 101 | Ga0105237_10159856 | 3300009545 | Bacteria | 2251 |
| 102 | Ga0105237_10826615 | 3300009545 | Bacteria | 933 |
| 103 | Ga0105237_11739064 | 3300009545 | Unclassified | 631 |
| 104 | Ga0105238_10253735 | 3300009551 | Bacteria | 1738 |
| 105 | Ga0105238_10253736 | 3300009551 | Bacteria | 1738 |
| 106 | Ga0105239_10006486 | 3300010375 | Bacteria | 13566 |
| 107 | Ga0105239_10017913 | 3300010375 | Bacteria | 7833 |
| 108 | Ga0105239_10100036 | 3300010375 | Bacteria | 3207 |
| 109 | Ga0105239_10144809 | 3300010375 | Bacteria | 2649 |
| 110 | Ga0157370_10716036 | 3300013104 | Bacteria | 913 |
| 111 | Ga0157369_10011935 | 3300013105 | Bacteria | 9869 |
| 112 | Ga0157369_10054969 | 3300013105 | Bacteria | 4298 |
| 113 | Ga0157369_10215292 | 3300013105 | Bacteria | 2012 |
| 114 | Ga0157369_10842932 | 3300013105 | Unclassified | 941 |
| 115 | Ga0157378_10051694 | 3300013297 | Bacteria | 3656 |
| 116 | Ga0157378_10441974 | 3300013297 | Bacteria | 1289 |
| 117 | Ga0157378_11212762 | 3300013297 | Bacteria | 794 |
| 118 | Ga0157378_12708942 | 3300013297 | Unclassified | 548 |
| 119 | Ga0157372_10897273 | 3300013307 | Bacteria | 1028 |
| 120 | Ga0157372_12927419 | 3300013307 | Bacteria | 546 |
| 121 | Ga0163163_11210271 | 3300014325 | Bacteria | 818 |
| 122 | Ga0157376_10033697 | 3300014969 | Bacteria | 4127 |
| 123 | Ga0157376_12676805 | 3300014969 | Unclassified | 539 |
| 124 | Ga0213872_10088235 | 3300021361 | Bacteria | 1389 |
| 125 | Ga0213876_10004771 | 3300021384 | Bacteria | 7532 |
| 126 | Ga0213876_10305279 | 3300021384 | Bacteria | 846 |
| 127 | Ga0207696_1000022 | 3300025711 | Bacteria | 427529 |
| 128 | Ga0207655_1051982 | 3300025728 | Bacteria | 1652 |
| 129 | Ga0207713_1079142 | 3300025735 | Bacteria | 1188 |
| 130 | Ga0207653_10190213 | 3300025885 | Unclassified | 770 |
| 131 | Ga0207653_10395555 | 3300025885 | Bacteria | 541 |
| 132 | Ga0207710_10136241 | 3300025900 | Bacteria | 1182 |
| 133 | Ga0207710_10204197 | 3300025900 | Bacteria | 977 |
| 134 | Ga0207680_10000878 | 3300025903 | Bacteria | 14184 |
| 135 | Ga0207645_10559829 | 3300025907 | Bacteria | 776 |
| 136 | Ga0207705_11352103 | 3300025909 | Unclassified | 543 |
| 137 | Ga0207684_10190296 | 3300025910 | Bacteria | 1770 |
| 138 | Ga0207654_10062452 | 3300025911 | Bacteria | 2183 |
| 139 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 140 | Ga0207707_10900736 | 3300025912 | Bacteria | 731 |
| 141 | Ga0207695_10000003 | 3300025913 | Bacteria | 1368691 |
| 142 | Ga0207695_10379979 | 3300025913 | Bacteria | 1298 |
| 143 | Ga0207660_10007667 | 3300025917 | Bacteria | 6990 |
| 144 | Ga0207660_10232486 | 3300025917 | Bacteria | 1450 |
| 145 | Ga0207649_10000497 | 3300025920 | Bacteria | 27895 |
| 146 | Ga0207649_10007709 | 3300025920 | Bacteria | 5853 |
| 147 | Ga0207649_10615815 | 3300025920 | Bacteria | 836 |
| 148 | Ga0207649_10736266 | 3300025920 | Bacteria | 766 |
| 149 | Ga0207652_10000299 | 3300025921 | Bacteria | 51311 |
| 150 | Ga0207694_10000016 | 3300025924 | Bacteria | 349087 |
| 151 | Ga0207694_10173987 | 3300025924 | Bacteria | 1744 |
| 152 | Ga0207706_10337294 | 3300025933 | Bacteria | 1311 |
| 153 | Ga0207686_10034824 | 3300025934 | Bacteria | 3017 |
| 154 | Ga0207686_10961814 | 3300025934 | Bacteria | 691 |
| 155 | Ga0207669_10913494 | 3300025937 | Unclassified | 734 |
| 156 | Ga0207665_10969774 | 3300025939 | Bacteria | 676 |
| 157 | Ga0207711_10230090 | 3300025941 | Bacteria | 1698 |
| 158 | Ga0207661_10111684 | 3300025944 | Bacteria | 2313 |
| 159 | Ga0207667_10000021 | 3300025949 | Bacteria | 370524 |
| 160 | Ga0207667_10111163 | 3300025949 | Bacteria | 2826 |
| 161 | Ga0207667_11964941 | 3300025949 | Unclassified | 546 |
| 162 | Ga0207668_11049174 | 3300025972 | Bacteria | 730 |
| 163 | Ga0207658_10050608 | 3300025986 | Bacteria | 3058 |
| 164 | Ga0207639_10301731 | 3300026041 | Bacteria | 1416 |
| 165 | Ga0207708_11885768 | 3300026075 | Bacteria | 524 |
| 166 | Ga0207702_10282802 | 3300026078 | Bacteria | 1569 |
| 167 | Ga0207702_10848216 | 3300026078 | Bacteria | 904 |
| 168 | Ga0207702_12454804 | 3300026078 | Unclassified | 508 |
| 169 | Ga0207641_11269268 | 3300026088 | Bacteria | 737 |
| 170 | Ga0207676_10572274 | 3300026095 | Bacteria | 1082 |
| 171 | Ga0207674_10988116 | 3300026116 | Bacteria | 811 |
| 172 | Ga0207698_10033544 | 3300026142 | Bacteria | 3731 |
| 173 | Ga0207698_10037495 | 3300026142 | Bacteria | 3571 |
| 174 | Ga0207698_10646416 | 3300026142 | Bacteria | 1047 |
| 175 | Ga0207698_11779676 | 3300026142 | Unclassified | 631 |
| 176 | Ga0268266_11203124 | 3300028379 | Bacteria | 733 |
| 177 | Ga0268264_10342984 | 3300028381 | Bacteria | 1420 |
| 178 | Ga0265318_10000046 | 3300028577 | Bacteria | 126568 |
| 179 | Ga0265338_10088455 | 3300028800 | Bacteria | 2570 |
| 180 | Ga0265338_10759604 | 3300028800 | Bacteria | 666 |
| 181 | Ga0265330_10172379 | 3300031235 | Bacteria | 917 |
| 182 | Ga0265330_10400241 | 3300031235 | Unclassified | 581 |
| 183 | Ga0265330_10507805 | 3300031235 | Unclassified | 513 |
| 184 | Ga0265332_10062713 | 3300031238 | Bacteria | 1588 |
| 185 | Ga0265332_10188231 | 3300031238 | Bacteria | 859 |
| 186 | Ga0265320_10000179 | 3300031240 | Bacteria | 53742 |
| 187 | Ga0265325_10045126 | 3300031241 | Bacteria | 2291 |
| 188 | Ga0265325_10280024 | 3300031241 | Bacteria | 748 |
| 189 | Ga0265329_10089092 | 3300031242 | Bacteria | 979 |
| 190 | Ga0265340_10335619 | 3300031247 | Unclassified | 668 |
| 191 | Ga0265339_10104691 | 3300031249 | Bacteria | 1469 |
| 192 | Ga0265339_10225416 | 3300031249 | Bacteria | 915 |
| 193 | Ga0265331_10000080 | 3300031250 | Bacteria | 137743 |
| 194 | Ga0265331_10396215 | 3300031250 | Bacteria | 619 |
| 195 | Ga0265327_10263013 | 3300031251 | Bacteria | 766 |
| 196 | Ga0265327_10343587 | 3300031251 | Bacteria | 652 |
| 197 | Ga0265316_10259035 | 3300031344 | Bacteria | 1276 |
| 198 | Ga0265316_10624048 | 3300031344 | Bacteria | 763 |
| 199 | Ga0307408_101344685 | 3300031548 | Bacteria | 671 |
| 200 | Ga0265313_10017352 | 3300031595 | Bacteria | 4094 |
| 201 | Ga0265314_10040241 | 3300031711 | Bacteria | 3356 |
| 202 | Ga0265314_10077190 | 3300031711 | Bacteria | 2210 |
| 203 | Ga0265314_10108011 | 3300031711 | Bacteria | 1774 |
| 204 | Ga0265314_10156281 | 3300031711 | Bacteria | 1392 |
| 205 | Ga0265314_10184671 | 3300031711 | Bacteria | 1246 |
| 206 | Ga0265314_10367834 | 3300031711 | Bacteria | 786 |
| 207 | Ga0265314_10505432 | 3300031711 | Bacteria | 635 |
| 208 | Ga0265342_10072965 | 3300031712 | Bacteria | 1997 |
| 209 | Ga0265342_10086436 | 3300031712 | Bacteria | 1803 |
| 210 | Ga0307516_10350333 | 3300031730 | Bacteria | 1142 |
| 211 | Ga0307406_10760508 | 3300031901 | Bacteria | 814 |
| 212 | Ga0307412_10692557 | 3300031911 | Bacteria | 874 |
| 213 | Ga0307416_100224163 | 3300032002 | Bacteria | 1806 |
| 214 | Ga0307416_101056129 | 3300032002 | Bacteria | 916 |
| 215 | Ga0307416_102297992 | 3300032002 | Bacteria | 640 |
| 216 | Ga0373926_0035259 | 3300035083 | Bacteria | 1774 |
| 217 | Ga0373923_0565091 | 3300035111 | Bacteria | 558 |
| 218 | Ga0373943_0160944 | 3300035170 | Bacteria | 1222 |
| 219 | Ga0373931_0060388 | 3300035691 | Bacteria | 2041 |
| 220 | Ga0373937_0707971 | 3300036401 | Bacteria | 954 |
| 221 | Ga0373925_1389631 | 3300037068 | Bacteria | 575 |
| 222 | Ga0400483_041479 | 3300039062 | Bacteria | 4427 |
| 223 | Ga0400483_144965 | 3300039062 | Bacteria | 108715 |
| 224 | Ga0400483_194190 | 3300039062 | Bacteria | 89056 |
| 225 | Ga0400483_266886 | 3300039062 | Bacteria | 5234 |
| 226 | Ga0436365_0098461 | 3300039437 | Bacteria | 517 |
| 227 | Ga0436365_0345660 | 3300039437 | Bacteria | 629 |
| 228 | Ga0436365_0510687 | 3300039437 | Bacteria | 783 |
| 229 | Ga0436365_1004240 | 3300039437 | Bacteria | 80154 |
| 230 | Ga0436361_0786446 | 3300039447 | Bacteria | 595 |
| 231 | Ga0436363_0635144 | 3300039450 | Bacteria | 3140 |
| 232 | Ga0436362_1055748 | 3300039453 | Bacteria | 584 |
| 233 | Ga0451577_0248389 | 3300042876 | Bacteria | 1610 |
| 234 | Ga0451576_0906629 | 3300045051 | Bacteria | 925 |
| 235 | Ga0451576_1512287 | 3300045051 | Unclassified | 697 |
| 236 | Ga0495592_0955384 | 3300046454 | Unclassified | 501 |
| 237 | Ga0495664_0276092 | 3300046477 | Bacteria | 1015 |
| 238 | Ga0495664_0318615 | 3300046477 | Bacteria | 938 |
| 239 | Ga0495584_0178123 | 3300046491 | Bacteria | 1081 |
| 240 | Ga0495628_0868051 | 3300046516 | Bacteria | 628 |
| 241 | Ga0495652_0051856 | 3300046529 | Bacteria | 3501 |
| 242 | Ga0495586_0269103 | 3300046535 | Bacteria | 974 |
| 243 | Ga0495587_0065364 | 3300046536 | Bacteria | 2124 |
| 244 | Ga0495645_0183826 | 3300046543 | Bacteria | 1430 |
| 245 | Ga0495645_0388654 | 3300046543 | Bacteria | 891 |
| 246 | Ga0495622_0062806 | 3300046557 | Bacteria | 1719 |
| 247 | Ga0495667_0811192 | 3300046559 | Bacteria | 577 |
| 248 | Ga0495599_0629647 | 3300046678 | Bacteria | 623 |
| 249 | Ga0495623_0243682 | 3300046679 | Bacteria | 1014 |
| 250 | Ga0495646_0146432 | 3300046680 | Bacteria | 1316 |
| 251 | Ga0495604_0401208 | 3300047317 | Bacteria | 903 |
| 252 | Ga0495674_0069270 | 3300047319 | Bacteria | 3051 |
| 253 | Ga0495680_0584818 | 3300047322 | Bacteria | 749 |
| 254 | Ga0495675_0613718 | 3300047444 | Bacteria | 616 |
| 255 | Ga0495593_0693397 | 3300047673 | Bacteria | 511 |
| 256 | Ga0496106_0233140 | 3300048909 | Bacteria | 1470 |
| 257 | Ga0496107_0065922 | 3300048910 | Bacteria | 2625 |
| 258 | Ga0496108_0422038 | 3300048911 | Bacteria | 1165 |
| 259 | Ga0496109_0273832 | 3300048912 | Bacteria | 1591 |
| 260 | Ga0496109_2058909 | 3300048912 | Bacteria | 503 |
| 261 | Ga0496110_0195744 | 3300048913 | Bacteria | 1836 |
| 262 | Ga0496110_0289421 | 3300048913 | Bacteria | 1492 |
| 263 | Ga0496111_0609010 | 3300048914 | Bacteria | 799 |
| 264 | Ga0496117_0034398 | 3300048920 | Bacteria | 3817 |
| 265 | Ga0496118_0088435 | 3300048921 | Bacteria | 2143 |
| 266 | Ga0496121_0289595 | 3300048924 | Bacteria | 1116 |
| 267 | Ga0496124_0207401 | 3300048927 | Bacteria | 1485 |
| 268 | Ga0496124_0316105 | 3300048927 | Bacteria | 1120 |
| 269 | Ga0496125_0002564 | 3300048928 | Bacteria | 23406 |
| 270 | Ga0496126_0348569 | 3300048929 | Bacteria | 1211 |
| 271 | Ga0496126_0516505 | 3300048929 | Bacteria | 952 |
| 272 | Ga0495682_0018691 | 3300049460 | Bacteria | 2610 |
| 273 | Ga0501032_0192926 | 3300049569 | Bacteria | 1331 |
| 274 | Ga0501032_0555082 | 3300049569 | Bacteria | 732 |
| 275 | Ga0501033_0883216 | 3300049570 | Bacteria | 601 |
| 276 | Ga0501034_0026834 | 3300049571 | Bacteria | 5860 |
| 277 | Ga0501036_0092344 | 3300049572 | Bacteria | 2557 |
| 278 | Ga0501038_0385619 | 3300049574 | Bacteria | 1086 |
| 279 | Ga0501043_0368389 | 3300049579 | Bacteria | 1089 |
| 280 | Ga0501043_1069320 | 3300049579 | Bacteria | 571 |
| 281 | Ga0501046_0051870 | 3300049580 | Bacteria | 3235 |
| 282 | Ga0501047_0017144 | 3300049581 | Bacteria | 6929 |
| 283 | Ga0501047_0344591 | 3300049581 | Bacteria | 1327 |
| 284 | Ga0501048_0036685 | 3300049582 | Bacteria | 3523 |
| 285 | Ga0501067_0003181 | 3300049583 | Bacteria | 9064 |
| 286 | Ga0501067_0015252 | 3300049583 | Bacteria | 4254 |
| 287 | Ga0501067_0146871 | 3300049583 | Bacteria | 1314 |
| 288 | Ga0501067_0350368 | 3300049583 | Bacteria | 823 |
| 289 | Ga0501069_0128789 | 3300049585 | Bacteria | 1448 |
| 290 | Ga0501069_0936199 | 3300049585 | Unclassified | 528 |
| 291 | Ga0501070_0009040 | 3300049586 | Bacteria | 8427 |
| 292 | Ga0501072_0008173 | 3300049588 | Bacteria | 7943 |
| 293 | Ga0501073_0008977 | 3300049589 | Bacteria | 7383 |
| 294 | Ga0501073_0289334 | 3300049589 | Bacteria | 1130 |
| 295 | Ga0501073_0756069 | 3300049589 | Bacteria | 670 |
| 296 | Ga0501074_0009358 | 3300049590 | Bacteria | 7117 |
| 297 | Ga0501074_0049281 | 3300049590 | Bacteria | 3041 |
| 298 | Ga0501074_0575558 | 3300049590 | Bacteria | 797 |
| 299 | Ga0501076_0522830 | 3300049592 | Unclassified | 978 |
| 300 | Ga0501076_1555572 | 3300049592 | Bacteria | 543 |
| 301 | Ga0501079_0054001 | 3300049741 | Bacteria | 3099 |
| 302 | Ga0501079_0229758 | 3300049741 | Bacteria | 1449 |
| 303 | Ga0501079_1070498 | 3300049741 | Unclassified | 635 |
| 304 | Ga0501080_0075523 | 3300049742 | Bacteria | 3134 |
| 305 | Ga0501080_0488992 | 3300049742 | Bacteria | 1100 |
| 306 | Ga0501080_0768974 | 3300049742 | Unclassified | 846 |
| 307 | Ga0501080_0860977 | 3300049742 | Bacteria | 792 |
| 308 | Ga0501035_0006374 | 3300049822 | Bacteria | 11095 |
| 309 | Ga0501035_0775704 | 3300049822 | Bacteria | 767 |
| 310 | Ga0501044_0193134 | 3300049823 | Bacteria | 1997 |
| 311 | Ga0501044_0198271 | 3300049823 | Bacteria | 1966 |
| 312 | nmdc:mga05p37_328843_c1 | 3300050507 | Bacteria | 1806 |
| 313 | nmdc:mga0qj67_1235012_c1 | 3300050509 | Bacteria | 580 |
| 314 | nmdc:mga0qj67_405192_c1 | 3300050509 | Bacteria | 1100 |
| 315 | nmdc:mga0qj67_583460_c1 | 3300050509 | Bacteria | 895 |
| 316 | nmdc:mga0qj67_681179_c1 | 3300050509 | Bacteria | 819 |
| 317 | nmdc:mga0qj67_73572_c1 | 3300050509 | Bacteria | 2729 |
| 318 | nmdc:mga06r32_242053_c1 | 3300050510 | Bacteria | 1791 |
| 319 | nmdc:mga06r32_925057_c1 | 3300050510 | Bacteria | 827 |
| 320 | nmdc:mga08y16_548897_c1 | 3300050511 | Bacteria | 1170 |
| 321 | nmdc:mga0rr50_799262_c1 | 3300050513 | Bacteria | 805 |
| 322 | nmdc:mga0a205_368328_c1 | 3300050515 | Bacteria | 1303 |
| 323 | Ga0500595_071541 | 3300053119 | Unclassified | 1028 |
| 324 | Ga0500655_034975 | 3300053133 | Unclassified | 975 |
| 325 | Ga0500619_012642 | 3300053154 | Bacteria | 2213 |
| 326 | Ga0501084_0060062 | 3300054114 | Bacteria | 3183 |
| 327 | Ga0501082_0215902 | 3300060353 | Bacteria | 1669 |
| 328 | Ga0501082_1795440 | 3300060353 | Bacteria | 535 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026075 | Ga0207708_11885768 | Ga0207708_118857682 | 64 |
| 2 | 3300048913 | Ga0496110_0289421 | Ga0496110_0289421_644_847 | 67 |
| 3 | 3300005327 | Ga0070658_11609781 | Ga0070658_116097812 | 77 |
| 4 | 3300005563 | Ga0068855_101003133 | Ga0068855_1010031332 | 77 |
| 5 | 3300009093 | Ga0105240_10153685 | Ga0105240_101536853 | 77 |
| 6 | 3300009545 | Ga0105237_10826615 | Ga0105237_108266152 | 77 |
| 7 | 3300010375 | Ga0105239_10144809 | Ga0105239_101448093 | 77 |
| 8 | 3300025909 | Ga0207705_11352103 | Ga0207705_113521032 | 77 |
| 9 | 3300025949 | Ga0207667_11964941 | Ga0207667_119649412 | 77 |
| 10 | 3300031235 | Ga0265330_10400241 | Ga0265330_104002411 | 77 |
| 11 | 3300031247 | Ga0265340_10335619 | Ga0265340_103356192 | 77 |
| 12 | 3300031250 | Ga0265331_10396215 | Ga0265331_103962152 | 77 |
| 13 | 3300039062 | Ga0400483_041479 | Ga0400483_041479_2466_2729 | 77 |
| 14 | 3300039062 | Ga0400483_266886 | Ga0400483_266886_2150_2413 | 77 |
| 15 | 3300039453 | Ga0436362_1055748 | Ga0436362_1055748_215_460 | 77 |
| 16 | 3300046477 | Ga0495664_0318615 | Ga0495664_0318615_123_368 | 77 |
| 17 | 3300046536 | Ga0495587_0065364 | Ga0495587_0065364_420_665 | 77 |
| 18 | 3300046678 | Ga0495599_0629647 | Ga0495599_0629647_92_337 | 77 |
| 19 | 3300046679 | Ga0495623_0243682 | Ga0495623_0243682_191_436 | 77 |
| 20 | 3300046680 | Ga0495646_0146432 | Ga0495646_0146432_496_741 | 77 |
| 21 | 3300047317 | Ga0495604_0401208 | Ga0495604_0401208_166_411 | 77 |
| 22 | 3300047319 | Ga0495674_0069270 | Ga0495674_0069270_2200_2445 | 77 |
| 23 | 3300047322 | Ga0495680_0584818 | Ga0495680_0584818_75_320 | 77 |
| 24 | 3300047444 | Ga0495675_0613718 | Ga0495675_0613718_234_479 | 77 |
| 25 | 3300047673 | Ga0495593_0693397 | Ga0495593_0693397_154_399 | 77 |
| 26 | 3300049569 | Ga0501032_0555082 | Ga0501032_0555082_163_408 | 77 |
| 27 | 3300049570 | Ga0501033_0883216 | Ga0501033_0883216_227_472 | 77 |
| 28 | 3300049574 | Ga0501038_0385619 | Ga0501038_0385619_651_896 | 77 |
| 29 | 3300049579 | Ga0501043_1069320 | Ga0501043_1069320_112_357 | 77 |
| 30 | 3300049581 | Ga0501047_0344591 | Ga0501047_0344591_70_315 | 77 |
| 31 | 3300049589 | Ga0501073_0756069 | Ga0501073_0756069_198_443 | 77 |
| 32 | 3300049742 | Ga0501080_0860977 | Ga0501080_0860977_80_325 | 77 |
| 33 | 3300049822 | Ga0501035_0775704 | Ga0501035_0775704_38_283 | 77 |
| 34 | 3300049823 | Ga0501044_0193134 | Ga0501044_0193134_1149_1394 | 77 |
| 35 | 3300053119 | Ga0500595_071541 | Ga0500595_071541_329_574 | 77 |
| 36 | 3300021384 | Ga0213876_10305279 | Ga0213876_103052792 | 78 |
| 37 | 3300039062 | Ga0400483_144965 | Ga0400483_144965_1764_2015 | 78 |
| 38 | 3300039062 | Ga0400483_194190 | Ga0400483_194190_74517_74768 | 78 |
| 39 | 3300039437 | Ga0436365_0510687 | Ga0436365_0510687_59_304 | 78 |
| 40 | 3300005328 | Ga0070676_10404998 | Ga0070676_104049982 | 79 |
| 41 | 3300005329 | Ga0070683_100244793 | Ga0070683_1002447931 | 79 |
| 42 | 3300005330 | Ga0070690_101185525 | Ga0070690_1011855251 | 79 |
| 43 | 3300005334 | Ga0068869_101195315 | Ga0068869_1011953152 | 79 |
| 44 | 3300005336 | Ga0070680_100000023 | Ga0070680_10000002357 | 79 |
| 45 | 3300005336 | Ga0070680_100454164 | Ga0070680_1004541641 | 79 |
| 46 | 3300005337 | Ga0070682_101149357 | Ga0070682_1011493572 | 79 |
| 47 | 3300005337 | Ga0070682_101679019 | Ga0070682_1016790191 | 79 |
| 48 | 3300005339 | Ga0070660_100948946 | Ga0070660_1009489462 | 79 |
| 49 | 3300005343 | Ga0070687_101543501 | Ga0070687_1015435012 | 79 |
| 50 | 3300005344 | Ga0070661_100000441 | Ga0070661_10000044127 | 79 |
| 51 | 3300005344 | Ga0070661_100074679 | Ga0070661_1000746793 | 79 |
| 52 | 3300005344 | Ga0070661_100135134 | Ga0070661_1001351343 | 79 |
| 53 | 3300005356 | Ga0070674_100985471 | Ga0070674_1009854712 | 79 |
| 54 | 3300005356 | Ga0070674_101534418 | Ga0070674_1015344182 | 79 |
| 55 | 3300005366 | Ga0070659_101397363 | Ga0070659_1013973631 | 79 |
| 56 | 3300005367 | Ga0070667_100070748 | Ga0070667_1000707482 | 79 |
| 57 | 3300005406 | Ga0070703_10075908 | Ga0070703_100759082 | 79 |
| 58 | 3300005406 | Ga0070703_10583269 | Ga0070703_105832692 | 79 |
| 59 | 3300005434 | Ga0070709_11302721 | Ga0070709_113027211 | 79 |
| 60 | 3300005437 | Ga0070710_10724703 | Ga0070710_107247032 | 79 |
| 61 | 3300005439 | Ga0070711_100427221 | Ga0070711_1004272212 | 79 |
| 62 | 3300005440 | Ga0070705_100302358 | Ga0070705_1003023582 | 79 |
| 63 | 3300005444 | Ga0070694_100174535 | Ga0070694_1001745353 | 79 |
| 64 | 3300005444 | Ga0070694_101006050 | Ga0070694_1010060502 | 79 |
| 65 | 3300005444 | Ga0070694_101518661 | Ga0070694_1015186612 | 79 |
| 66 | 3300005445 | Ga0070708_101532257 | Ga0070708_1015322572 | 79 |
| 67 | 3300005445 | Ga0070708_102123206 | Ga0070708_1021232062 | 79 |
| 68 | 3300005457 | Ga0070662_100691332 | Ga0070662_1006913322 | 79 |
| 69 | 3300005458 | Ga0070681_10000002 | Ga0070681_1000000235 | 79 |
| 70 | 3300005467 | Ga0070706_101148850 | Ga0070706_1011488502 | 79 |
| 71 | 3300005530 | Ga0070679_100000445 | Ga0070679_10000044526 | 79 |
| 72 | 3300005539 | Ga0068853_100373311 | Ga0068853_1003733112 | 79 |
| 73 | 3300005539 | Ga0068853_101781409 | Ga0068853_1017814092 | 79 |
| 74 | 3300005545 | Ga0070695_100010028 | Ga0070695_1000100285 | 79 |
| 75 | 3300005545 | Ga0070695_101306853 | Ga0070695_1013068532 | 79 |
| 76 | 3300005546 | Ga0070696_100035919 | Ga0070696_1000359193 | 79 |
| 77 | 3300005546 | Ga0070696_100101640 | Ga0070696_1001016402 | 79 |
| 78 | 3300005563 | Ga0068855_100000024 | Ga0068855_10000002423 | 79 |
| 79 | 3300005563 | Ga0068855_100134358 | Ga0068855_1001343582 | 79 |
| 80 | 3300005563 | Ga0068855_100805925 | Ga0068855_1008059252 | 79 |
| 81 | 3300005577 | Ga0068857_101655933 | Ga0068857_1016559332 | 79 |
| 82 | 3300005614 | Ga0068856_100328823 | Ga0068856_1003288233 | 79 |
| 83 | 3300005614 | Ga0068856_101418462 | Ga0068856_1014184622 | 79 |
| 84 | 3300005614 | Ga0068856_102069534 | Ga0068856_1020695342 | 79 |
| 85 | 3300005616 | Ga0068852_100008637 | Ga0068852_1000086375 | 79 |
| 86 | 3300005616 | Ga0068852_100286983 | Ga0068852_1002869833 | 79 |
| 87 | 3300005616 | Ga0068852_101344080 | Ga0068852_1013440802 | 79 |
| 88 | 3300005617 | Ga0068859_100892065 | Ga0068859_1008920653 | 79 |
| 89 | 3300005618 | Ga0068864_100690852 | Ga0068864_1006908523 | 79 |
| 90 | 3300005618 | Ga0068864_101103255 | Ga0068864_1011032552 | 79 |
| 91 | 3300005834 | Ga0068851_10136501 | Ga0068851_101365012 | 79 |
| 92 | 3300005844 | Ga0068862_101483806 | Ga0068862_1014838062 | 79 |
| 93 | 3300006237 | Ga0097621_100002441 | Ga0097621_1000024413 | 79 |
| 94 | 3300006237 | Ga0097621_100148396 | Ga0097621_1001483963 | 79 |
| 95 | 3300006237 | Ga0097621_100638715 | Ga0097621_1006387152 | 79 |
| 96 | 3300006237 | Ga0097621_101732805 | Ga0097621_1017328052 | 79 |
| 97 | 3300006358 | Ga0068871_100133302 | Ga0068871_1001333023 | 79 |
| 98 | 3300006358 | Ga0068871_100205953 | Ga0068871_1002059532 | 79 |
| 99 | 3300006844 | Ga0075428_100055712 | Ga0075428_1000557123 | 79 |
| 100 | 3300006846 | Ga0075430_100238779 | Ga0075430_1002387793 | 79 |
| 101 | 3300006846 | Ga0075430_100316662 | Ga0075430_1003166622 | 79 |
| 102 | 3300006846 | Ga0075430_100788441 | Ga0075430_1007884412 | 79 |
| 103 | 3300006847 | Ga0075431_100253435 | Ga0075431_1002534352 | 79 |
| 104 | 3300006847 | Ga0075431_100811944 | Ga0075431_1008119442 | 79 |
| 105 | 3300006852 | Ga0075433_10276859 | Ga0075433_102768592 | 79 |
| 106 | 3300006871 | Ga0075434_100091834 | Ga0075434_1000918343 | 79 |
| 107 | 3300006914 | Ga0075436_100412222 | Ga0075436_1004122222 | 79 |
| 108 | 3300006931 | Ga0097620_100892196 | Ga0097620_1008921963 | 79 |
| 109 | 3300007076 | Ga0075435_101024419 | Ga0075435_1010244192 | 79 |
| 110 | 3300007788 | Ga0099795_10085331 | Ga0099795_100853313 | 79 |
| 111 | 3300009093 | Ga0105240_10000564 | Ga0105240_1000056411 | 79 |
| 112 | 3300009093 | Ga0105240_10009705 | Ga0105240_1000970513 | 79 |
| 113 | 3300009093 | Ga0105240_10516733 | Ga0105240_105167333 | 79 |
| 114 | 3300009093 | Ga0105240_11558413 | Ga0105240_115584132 | 79 |
| 115 | 3300009093 | Ga0105240_12587932 | Ga0105240_125879322 | 79 |
| 116 | 3300009094 | Ga0111539_10050686 | Ga0111539_100506865 | 79 |
| 117 | 3300009094 | Ga0111539_12979346 | Ga0111539_129793462 | 79 |
| 118 | 3300009098 | Ga0105245_10545443 | Ga0105245_105454432 | 79 |
| 119 | 3300009098 | Ga0105245_10796417 | Ga0105245_107964172 | 79 |
| 120 | 3300009101 | Ga0105247_10008181 | Ga0105247_100081813 | 79 |
| 121 | 3300009101 | Ga0105247_10325158 | Ga0105247_103251582 | 79 |
| 122 | 3300009147 | Ga0114129_10017466 | Ga0114129_100174662 | 79 |
| 123 | 3300009147 | Ga0114129_11048101 | Ga0114129_110481011 | 79 |
| 124 | 3300009174 | Ga0105241_10219054 | Ga0105241_102190542 | 79 |
| 125 | 3300009174 | Ga0105241_10327857 | Ga0105241_103278573 | 79 |
| 126 | 3300009174 | Ga0105241_12301487 | Ga0105241_123014871 | 79 |
| 127 | 3300009176 | Ga0105242_10078686 | Ga0105242_100786865 | 79 |
| 128 | 3300009176 | Ga0105242_10316677 | Ga0105242_103166773 | 79 |
| 129 | 3300009177 | Ga0105248_10000009 | Ga0105248_10000009359 | 79 |
| 130 | 3300009177 | Ga0105248_10054723 | Ga0105248_100547233 | 79 |
| 131 | 3300009545 | Ga0105237_10159856 | Ga0105237_101598564 | 79 |
| 132 | 3300009545 | Ga0105237_11739064 | Ga0105237_117390641 | 79 |
| 133 | 3300009551 | Ga0105238_10253735 | Ga0105238_102537352 | 79 |
| 134 | 3300009551 | Ga0105238_10253736 | Ga0105238_102537362 | 79 |
| 135 | 3300010375 | Ga0105239_10006486 | Ga0105239_100064863 | 79 |
| 136 | 3300010375 | Ga0105239_10017913 | Ga0105239_100179133 | 79 |
| 137 | 3300010375 | Ga0105239_10100036 | Ga0105239_101000363 | 79 |
| 138 | 3300013104 | Ga0157370_10716036 | Ga0157370_107160362 | 79 |
| 139 | 3300013105 | Ga0157369_10011935 | Ga0157369_100119353 | 79 |
| 140 | 3300013105 | Ga0157369_10054969 | Ga0157369_100549693 | 79 |
| 141 | 3300013105 | Ga0157369_10215292 | Ga0157369_102152923 | 79 |
| 142 | 3300013105 | Ga0157369_10842932 | Ga0157369_108429323 | 79 |
| 143 | 3300013297 | Ga0157378_10051694 | Ga0157378_100516943 | 79 |
| 144 | 3300013297 | Ga0157378_10441974 | Ga0157378_104419742 | 79 |
| 145 | 3300013297 | Ga0157378_11212762 | Ga0157378_112127622 | 79 |
| 146 | 3300013297 | Ga0157378_12708942 | Ga0157378_127089422 | 79 |
| 147 | 3300013307 | Ga0157372_10897273 | Ga0157372_108972732 | 79 |
| 148 | 3300013307 | Ga0157372_12927419 | Ga0157372_129274191 | 79 |
| 149 | 3300014325 | Ga0163163_11210271 | Ga0163163_112102712 | 79 |
| 150 | 3300014969 | Ga0157376_10033697 | Ga0157376_100336972 | 79 |
| 151 | 3300014969 | Ga0157376_12676805 | Ga0157376_126768052 | 79 |
| 152 | 3300021361 | Ga0213872_10088235 | Ga0213872_100882353 | 79 |
| 153 | 3300021384 | Ga0213876_10004771 | Ga0213876_100047719 | 79 |
| 154 | 3300025885 | Ga0207653_10190213 | Ga0207653_101902132 | 79 |
| 155 | 3300025885 | Ga0207653_10395555 | Ga0207653_103955552 | 79 |
| 156 | 3300025900 | Ga0207710_10136241 | Ga0207710_101362412 | 79 |
| 157 | 3300025900 | Ga0207710_10204197 | Ga0207710_102041972 | 79 |
| 158 | 3300025903 | Ga0207680_10000878 | Ga0207680_100008787 | 79 |
| 159 | 3300025907 | Ga0207645_10559829 | Ga0207645_105598292 | 79 |
| 160 | 3300025910 | Ga0207684_10190296 | Ga0207684_101902963 | 79 |
| 161 | 3300025911 | Ga0207654_10062452 | Ga0207654_100624523 | 79 |
| 162 | 3300025912 | Ga0207707_10000002 | Ga0207707_10000002916 | 79 |
| 163 | 3300025912 | Ga0207707_10900736 | Ga0207707_109007362 | 79 |
| 164 | 3300025913 | Ga0207695_10000003 | Ga0207695_10000003145 | 79 |
| 165 | 3300025913 | Ga0207695_10379979 | Ga0207695_103799792 | 79 |
| 166 | 3300025917 | Ga0207660_10007667 | Ga0207660_100076673 | 79 |
| 167 | 3300025917 | Ga0207660_10232486 | Ga0207660_102324862 | 79 |
| 168 | 3300025920 | Ga0207649_10000497 | Ga0207649_1000049712 | 79 |
| 169 | 3300025920 | Ga0207649_10007709 | Ga0207649_100077093 | 79 |
| 170 | 3300025920 | Ga0207649_10615815 | Ga0207649_106158153 | 79 |
| 171 | 3300025920 | Ga0207649_10736266 | Ga0207649_107362662 | 79 |
| 172 | 3300025921 | Ga0207652_10000299 | Ga0207652_1000029910 | 79 |
| 173 | 3300025924 | Ga0207694_10000016 | Ga0207694_10000016124 | 79 |
| 174 | 3300025924 | Ga0207694_10173987 | Ga0207694_101739872 | 79 |
| 175 | 3300025933 | Ga0207706_10337294 | Ga0207706_103372942 | 79 |
| 176 | 3300025934 | Ga0207686_10034824 | Ga0207686_100348244 | 79 |
| 177 | 3300025934 | Ga0207686_10961814 | Ga0207686_109618142 | 79 |
| 178 | 3300025937 | Ga0207669_10913494 | Ga0207669_109134942 | 79 |
| 179 | 3300025939 | Ga0207665_10969774 | Ga0207665_109697742 | 79 |
| 180 | 3300025941 | Ga0207711_10230090 | Ga0207711_102300903 | 79 |
| 181 | 3300025944 | Ga0207661_10111684 | Ga0207661_101116842 | 79 |
| 182 | 3300025949 | Ga0207667_10000021 | Ga0207667_10000021230 | 79 |
| 183 | 3300025949 | Ga0207667_10111163 | Ga0207667_101111633 | 79 |
| 184 | 3300025972 | Ga0207668_11049174 | Ga0207668_110491741 | 79 |
| 185 | 3300025986 | Ga0207658_10050608 | Ga0207658_100506082 | 79 |
| 186 | 3300026041 | Ga0207639_10301731 | Ga0207639_103017313 | 79 |
| 187 | 3300026078 | Ga0207702_10282802 | Ga0207702_102828022 | 79 |
| 188 | 3300026078 | Ga0207702_10848216 | Ga0207702_108482161 | 79 |
| 189 | 3300026078 | Ga0207702_12454804 | Ga0207702_124548042 | 79 |
| 190 | 3300026088 | Ga0207641_11269268 | Ga0207641_112692682 | 79 |
| 191 | 3300026095 | Ga0207676_10572274 | Ga0207676_105722742 | 79 |
| 192 | 3300026116 | Ga0207674_10988116 | Ga0207674_109881162 | 79 |
| 193 | 3300026142 | Ga0207698_10033544 | Ga0207698_100335443 | 79 |
| 194 | 3300026142 | Ga0207698_10037495 | Ga0207698_100374955 | 79 |
| 195 | 3300026142 | Ga0207698_10646416 | Ga0207698_106464161 | 79 |
| 196 | 3300026142 | Ga0207698_11779676 | Ga0207698_117796761 | 79 |
| 197 | 3300028379 | Ga0268266_11203124 | Ga0268266_112031242 | 79 |
| 198 | 3300028381 | Ga0268264_10342984 | Ga0268264_103429842 | 79 |
| 199 | 3300028577 | Ga0265318_10000046 | Ga0265318_1000004656 | 79 |
| 200 | 3300028800 | Ga0265338_10088455 | Ga0265338_100884553 | 79 |
| 201 | 3300028800 | Ga0265338_10759604 | Ga0265338_107596042 | 79 |
| 202 | 3300031235 | Ga0265330_10172379 | Ga0265330_101723792 | 79 |
| 203 | 3300031235 | Ga0265330_10507805 | Ga0265330_105078052 | 79 |
| 204 | 3300031238 | Ga0265332_10062713 | Ga0265332_100627132 | 79 |
| 205 | 3300031238 | Ga0265332_10188231 | Ga0265332_101882312 | 79 |
| 206 | 3300031240 | Ga0265320_10000179 | Ga0265320_1000017925 | 79 |
| 207 | 3300031241 | Ga0265325_10045126 | Ga0265325_100451262 | 79 |
| 208 | 3300031241 | Ga0265325_10280024 | Ga0265325_102800242 | 79 |
| 209 | 3300031242 | Ga0265329_10089092 | Ga0265329_100890922 | 79 |
| 210 | 3300031249 | Ga0265339_10104691 | Ga0265339_101046912 | 79 |
| 211 | 3300031249 | Ga0265339_10225416 | Ga0265339_102254162 | 79 |
| 212 | 3300031250 | Ga0265331_10000080 | Ga0265331_1000008095 | 79 |
| 213 | 3300031251 | Ga0265327_10263013 | Ga0265327_102630132 | 79 |
| 214 | 3300031251 | Ga0265327_10343587 | Ga0265327_103435872 | 79 |
| 215 | 3300031344 | Ga0265316_10259035 | Ga0265316_102590352 | 79 |
| 216 | 3300031344 | Ga0265316_10624048 | Ga0265316_106240482 | 79 |
| 217 | 3300031548 | Ga0307408_101344685 | Ga0307408_1013446851 | 79 |
| 218 | 3300031595 | Ga0265313_10017352 | Ga0265313_100173526 | 79 |
| 219 | 3300031711 | Ga0265314_10040241 | Ga0265314_100402412 | 79 |
| 220 | 3300031711 | Ga0265314_10077190 | Ga0265314_100771903 | 79 |
| 221 | 3300031711 | Ga0265314_10108011 | Ga0265314_101080113 | 79 |
| 222 | 3300031711 | Ga0265314_10156281 | Ga0265314_101562812 | 79 |
| 223 | 3300031711 | Ga0265314_10184671 | Ga0265314_101846713 | 79 |
| 224 | 3300031711 | Ga0265314_10367834 | Ga0265314_103678342 | 79 |
| 225 | 3300031711 | Ga0265314_10505432 | Ga0265314_105054322 | 79 |
| 226 | 3300031712 | Ga0265342_10072965 | Ga0265342_100729652 | 79 |
| 227 | 3300031712 | Ga0265342_10086436 | Ga0265342_100864363 | 79 |
| 228 | 3300031730 | Ga0307516_10350333 | Ga0307516_103503332 | 79 |
| 229 | 3300031901 | Ga0307406_10760508 | Ga0307406_107605082 | 79 |
| 230 | 3300031911 | Ga0307412_10692557 | Ga0307412_106925572 | 79 |
| 231 | 3300032002 | Ga0307416_100224163 | Ga0307416_1002241633 | 79 |
| 232 | 3300032002 | Ga0307416_101056129 | Ga0307416_1010561292 | 79 |
| 233 | 3300032002 | Ga0307416_102297992 | Ga0307416_1022979922 | 79 |
| 234 | 3300035083 | Ga0373926_0035259 | Ga0373926_0035259_75_326 | 79 |
| 235 | 3300035111 | Ga0373923_0565091 | Ga0373923_0565091_32_283 | 79 |
| 236 | 3300035170 | Ga0373943_0160944 | Ga0373943_0160944_341_592 | 79 |
| 237 | 3300035691 | Ga0373931_0060388 | Ga0373931_0060388_1400_1651 | 79 |
| 238 | 3300036401 | Ga0373937_0707971 | Ga0373937_0707971_149_400 | 79 |
| 239 | 3300037068 | Ga0373925_1389631 | Ga0373925_1389631_69_320 | 79 |
| 240 | 3300039437 | Ga0436365_0098461 | Ga0436365_0098461_146_397 | 79 |
| 241 | 3300039437 | Ga0436365_0345660 | Ga0436365_0345660_356_607 | 79 |
| 242 | 3300039437 | Ga0436365_1004240 | Ga0436365_1004240_18195_18452 | 79 |
| 243 | 3300039447 | Ga0436361_0786446 | Ga0436361_0786446_36_287 | 79 |
| 244 | 3300039450 | Ga0436363_0635144 | Ga0436363_0635144_1645_1896 | 79 |
| 245 | 3300042876 | Ga0451577_0248389 | Ga0451577_0248389_843_1094 | 79 |
| 246 | 3300045051 | Ga0451576_0906629 | Ga0451576_0906629_594_845 | 79 |
| 247 | 3300045051 | Ga0451576_1512287 | Ga0451576_1512287_141_392 | 79 |
| 248 | 3300046454 | Ga0495592_0955384 | Ga0495592_0955384_123_374 | 79 |
| 249 | 3300046477 | Ga0495664_0276092 | Ga0495664_0276092_416_667 | 79 |
| 250 | 3300046491 | Ga0495584_0178123 | Ga0495584_0178123_643_894 | 79 |
| 251 | 3300046516 | Ga0495628_0868051 | Ga0495628_0868051_204_455 | 79 |
| 252 | 3300046529 | Ga0495652_0051856 | Ga0495652_0051856_366_617 | 79 |
| 253 | 3300046535 | Ga0495586_0269103 | Ga0495586_0269103_35_286 | 79 |
| 254 | 3300046543 | Ga0495645_0183826 | Ga0495645_0183826_495_746 | 79 |
| 255 | 3300046543 | Ga0495645_0388654 | Ga0495645_0388654_260_511 | 79 |
| 256 | 3300046557 | Ga0495622_0062806 | Ga0495622_0062806_427_678 | 79 |
| 257 | 3300046559 | Ga0495667_0811192 | Ga0495667_0811192_67_318 | 79 |
| 258 | 3300048909 | Ga0496106_0233140 | Ga0496106_0233140_1108_1359 | 79 |
| 259 | 3300048910 | Ga0496107_0065922 | Ga0496107_0065922_534_785 | 79 |
| 260 | 3300048911 | Ga0496108_0422038 | Ga0496108_0422038_491_742 | 79 |
| 261 | 3300048912 | Ga0496109_0273832 | Ga0496109_0273832_922_1173 | 79 |
| 262 | 3300048912 | Ga0496109_2058909 | Ga0496109_2058909_44_295 | 79 |
| 263 | 3300048913 | Ga0496110_0195744 | Ga0496110_0195744_613_864 | 79 |
| 264 | 3300049460 | Ga0495682_0018691 | Ga0495682_0018691_540_791 | 79 |
| 265 | 3300049569 | Ga0501032_0192926 | Ga0501032_0192926_908_1159 | 79 |
| 266 | 3300049571 | Ga0501034_0026834 | Ga0501034_0026834_4916_5167 | 79 |
| 267 | 3300049572 | Ga0501036_0092344 | Ga0501036_0092344_1139_1390 | 79 |
| 268 | 3300049579 | Ga0501043_0368389 | Ga0501043_0368389_26_277 | 79 |
| 269 | 3300049580 | Ga0501046_0051870 | Ga0501046_0051870_2210_2461 | 79 |
| 270 | 3300049581 | Ga0501047_0017144 | Ga0501047_0017144_1351_1602 | 79 |
| 271 | 3300049582 | Ga0501048_0036685 | Ga0501048_0036685_2122_2373 | 79 |
| 272 | 3300049583 | Ga0501067_0003181 | Ga0501067_0003181_1930_2181 | 79 |
| 273 | 3300049583 | Ga0501067_0015252 | Ga0501067_0015252_1638_1889 | 79 |
| 274 | 3300049583 | Ga0501067_0146871 | Ga0501067_0146871_875_1126 | 79 |
| 275 | 3300049583 | Ga0501067_0350368 | Ga0501067_0350368_137_388 | 79 |
| 276 | 3300049585 | Ga0501069_0128789 | Ga0501069_0128789_709_960 | 79 |
| 277 | 3300049585 | Ga0501069_0936199 | Ga0501069_0936199_90_341 | 79 |
| 278 | 3300049586 | Ga0501070_0009040 | Ga0501070_0009040_428_679 | 79 |
| 279 | 3300049588 | Ga0501072_0008173 | Ga0501072_0008173_3742_3993 | 79 |
| 280 | 3300049589 | Ga0501073_0008977 | Ga0501073_0008977_4894_5145 | 79 |
| 281 | 3300049589 | Ga0501073_0289334 | Ga0501073_0289334_745_996 | 79 |
| 282 | 3300049590 | Ga0501074_0009358 | Ga0501074_0009358_2077_2328 | 79 |
| 283 | 3300049590 | Ga0501074_0049281 | Ga0501074_0049281_243_494 | 79 |
| 284 | 3300049590 | Ga0501074_0575558 | Ga0501074_0575558_250_501 | 79 |
| 285 | 3300049592 | Ga0501076_1555572 | Ga0501076_1555572_75_326 | 79 |
| 286 | 3300049741 | Ga0501079_0054001 | Ga0501079_0054001_1501_1752 | 79 |
| 287 | 3300049741 | Ga0501079_0229758 | Ga0501079_0229758_1035_1286 | 79 |
| 288 | 3300049742 | Ga0501080_0075523 | Ga0501080_0075523_1501_1752 | 79 |
| 289 | 3300049742 | Ga0501080_0488992 | Ga0501080_0488992_232_483 | 79 |
| 290 | 3300049742 | Ga0501080_0768974 | Ga0501080_0768974_502_753 | 79 |
| 291 | 3300049822 | Ga0501035_0006374 | Ga0501035_0006374_1853_2104 | 79 |
| 292 | 3300049823 | Ga0501044_0198271 | Ga0501044_0198271_1324_1575 | 79 |
| 293 | 3300050507 | nmdc:mga05p37_328843_c1 | nmdc:mga05p37_328843_c1_921_1172 | 79 |
| 294 | 3300050509 | nmdc:mga0qj67_1235012_c1 | nmdc:mga0qj67_1235012_c1_121_372 | 79 |
| 295 | 3300050509 | nmdc:mga0qj67_405192_c1 | nmdc:mga0qj67_405192_c1_740_991 | 79 |
| 296 | 3300050509 | nmdc:mga0qj67_583460_c1 | nmdc:mga0qj67_583460_c1_182_433 | 79 |
| 297 | 3300050509 | nmdc:mga0qj67_681179_c1 | nmdc:mga0qj67_681179_c1_47_298 | 79 |
| 298 | 3300050509 | nmdc:mga0qj67_73572_c1 | nmdc:mga0qj67_73572_c1_42_293 | 79 |
| 299 | 3300050510 | nmdc:mga06r32_242053_c1 | nmdc:mga06r32_242053_c1_476_727 | 79 |
| 300 | 3300050510 | nmdc:mga06r32_925057_c1 | nmdc:mga06r32_925057_c1_262_513 | 79 |
| 301 | 3300050511 | nmdc:mga08y16_548897_c1 | nmdc:mga08y16_548897_c1_15_266 | 79 |
| 302 | 3300050513 | nmdc:mga0rr50_799262_c1 | nmdc:mga0rr50_799262_c1_439_690 | 79 |
| 303 | 3300050515 | nmdc:mga0a205_368328_c1 | nmdc:mga0a205_368328_c1_534_785 | 79 |
| 304 | 3300053133 | Ga0500655_034975 | Ga0500655_034975_324_575 | 79 |
| 305 | 3300053154 | Ga0500619_012642 | Ga0500619_012642_96_347 | 79 |
| 306 | 3300054114 | Ga0501084_0060062 | Ga0501084_0060062_1757_2008 | 79 |
| 307 | 3300060353 | Ga0501082_0215902 | Ga0501082_0215902_402_653 | 79 |
| 308 | 3300060353 | Ga0501082_1795440 | Ga0501082_1795440_43_294 | 79 |
| 309 | 3300005289 | Ga0065704_10080720 | Ga0065704_100807203 | 81 |
| 310 | 3300005434 | Ga0070709_11348581 | Ga0070709_113485811 | 81 |
| 311 | 3300009036 | Ga0105244_10026643 | Ga0105244_100266434 | 81 |
| 312 | 3300009092 | Ga0105250_10277163 | Ga0105250_102771632 | 81 |
| 313 | 3300009148 | Ga0105243_10033233 | Ga0105243_100332334 | 81 |
| 314 | 3300009148 | Ga0105243_11715962 | Ga0105243_117159622 | 81 |
| 315 | 3300025711 | Ga0207696_1000022 | Ga0207696_1000022274 | 81 |
| 316 | 3300025728 | Ga0207655_1051982 | Ga0207655_10519823 | 81 |
| 317 | 3300025735 | Ga0207713_1079142 | Ga0207713_10791422 | 81 |
| 318 | 3300048914 | Ga0496111_0609010 | Ga0496111_0609010_503_748 | 81 |
| 319 | 3300048920 | Ga0496117_0034398 | Ga0496117_0034398_2939_3184 | 81 |
| 320 | 3300048921 | Ga0496118_0088435 | Ga0496118_0088435_626_871 | 81 |
| 321 | 3300048924 | Ga0496121_0289595 | Ga0496121_0289595_380_625 | 81 |
| 322 | 3300048927 | Ga0496124_0207401 | Ga0496124_0207401_129_374 | 81 |
| 323 | 3300048927 | Ga0496124_0316105 | Ga0496124_0316105_129_374 | 81 |
| 324 | 3300048928 | Ga0496125_0002564 | Ga0496125_0002564_1147_1392 | 81 |
| 325 | 3300048929 | Ga0496126_0348569 | Ga0496126_0348569_423_668 | 81 |
| 326 | 3300048929 | Ga0496126_0516505 | Ga0496126_0516505_649_894 | 81 |
| 327 | 3300049592 | Ga0501076_0522830 | Ga0501076_0522830_549_815 | 81 |
| 328 | 3300049741 | Ga0501079_1070498 | Ga0501079_1070498_327_593 | 81 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jwb-assembly1.cif.gz_D-2 | structure of the covalent acyl-adenylate form of the moeb-moad protein complex | 0.8758 | 4 | 81 |
| 1jwb-assembly1.cif.gz_D-2 | structure of the covalent acyl-adenylate form of the moeb-moad protein complex | 0.8467 | 4 | 81 |
| 1vjk-assembly1.cif.gz_A | putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001 | 0.81 | 1 | 78 |
| 2qie-assembly1.cif.gz_D | staphylococcus aureus molybdopterin synthase in complex with precursor z | 0.8088 | 4 | 81 |
| 6jc0-assembly1.cif.gz_A | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.8068 | 2 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P30748_1_81_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9137 | 3 | 81 | 3.10.20.30 |
| af_A0A0B4J391_26_106_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8374 | 1 | 81 | 3.10.20.30 |
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8326 | 4 | 78 | 3.10.20.30 |
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8133 | 4 | 78 | 3.10.20.30 |
| 2qieD00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8088 | 4 | 81 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q88NB9-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9747 | 1 | 81 |
GO:0000166
GO:0006777 GO:0016740 GO:1990133 |
| AF-Q88NB9-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.963 | 1 | 81 |
GO:0000166
GO:0006777 GO:0016740 GO:1990133 |
| AF-A0A7V7GTJ3-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9371 | 3 | 81 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A1Y0CWC5-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9301 | 1 | 81 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A078MAB5-F1-model_v4 | Molybdopterin converting factor, small subunit | 0.929 | 3 | 81 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar