F409070

General Info

Members Datasets Scaffolds Average Seq Length
328 229 327 120

Family's Representative Sequence

Representative Sequence 3300004800|Ga0058861_11915385|Ga0058861_119153852
Length 126
Sequence VTPVEPMQDANCLFCRIVRGEIPSRKVHEDDAVLAFHDIHPLAPVHFLIIPKTHLASMMDAGDEHQQVFGRMMVLAPKLAREQGAKDGFRLILNTGRVGRQEVGHVHLHVIGGGEPLGPMLPRPGR

Samples

Sample ID Description Type Environment
1 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
206 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
221 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
224 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
225 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
228 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
229 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0.91
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.28
Nodule 0
Rhizoplane 0.91
Rhizosphere 85.37
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058861_11915385 3300004800 Bacteria 824
2 Ga0070690_100074519 3300005330 Bacteria 2211
3 Ga0068869_100114488 3300005334 Bacteria 2056
4 Ga0070680_100092214 3300005336 Bacteria 2508
5 Ga0070660_100515655 3300005339 Bacteria 995
6 Ga0070689_100062603 3300005340 Bacteria 2895
7 Ga0070687_100085938 3300005343 Bacteria 1728
8 Ga0070692_10475285 3300005345 Bacteria 805
9 Ga0070692_10983252 3300005345 Bacteria 589
10 Ga0070674_100767543 3300005356 Bacteria 830
11 Ga0070673_100404805 3300005364 Bacteria 1221
12 Ga0070673_101684019 3300005364 Bacteria 600
13 Ga0070711_100202398 3300005439 Bacteria 1533
14 Ga0070700_100240735 3300005441 Bacteria 1293
15 Ga0070694_100256416 3300005444 Bacteria 1325
16 Ga0070708_100549386 3300005445 Bacteria 1089
17 Ga0070678_100286002 3300005456 Bacteria 1396
18 Ga0070678_100534776 3300005456 Bacteria 1039
19 Ga0070678_101055867 3300005456 Bacteria 749
20 Ga0070662_101299194 3300005457 Bacteria 626
21 Ga0070681_10029669 3300005458 Bacteria 5492
22 Ga0070706_100024166 3300005467 Bacteria 5594
23 Ga0070707_100392652 3300005468 Bacteria 1347
24 Ga0070698_100007893 3300005471 Bacteria 11520
25 Ga0070698_101592953 3300005471 Bacteria 605
26 Ga0070699_100125354 3300005518 Bacteria 2260
27 Ga0070679_100079001 3300005530 Bacteria 3279
28 Ga0070684_100597188 3300005535 Bacteria 1026
29 Ga0070697_100106288 3300005536 Bacteria 2335
30 Ga0070697_100435394 3300005536 Bacteria 1141
31 Ga0070697_100445737 3300005536 Bacteria 1127
32 Ga0068853_100008821 3300005539 Bacteria 8111
33 Ga0070695_100592486 3300005545 Bacteria 869
34 Ga0070693_100001685 3300005547 Bacteria 10022
35 Ga0068855_100072053 3300005563 Bacteria 4016
36 Ga0068855_101951887 3300005563 Bacteria 594
37 Ga0070664_100823932 3300005564 Bacteria 868
38 Ga0068857_100068889 3300005577 Bacteria 3149
39 Ga0068854_101186754 3300005578 Bacteria 683
40 Ga0070702_100408288 3300005615 Bacteria 973
41 Ga0068852_101445680 3300005616 Bacteria 710
42 Ga0068859_101719867 3300005617 Bacteria 693
43 Ga0068864_100778838 3300005618 Bacteria 939
44 Ga0068866_10513929 3300005718 Bacteria 795
45 Ga0068858_100070921 3300005842 Bacteria 3230
46 Ga0068858_100191231 3300005842 Bacteria 1934
47 Ga0068858_100608579 3300005842 Bacteria 1060
48 Ga0081455_10015320 3300005937 Bacteria 7455
49 Ga0081455_10103214 3300005937 Bacteria 2284
50 Ga0081539_10013309 3300005985 Bacteria 6209
51 Ga0070717_10744324 3300006028 Bacteria 891
52 Ga0075365_10165398 3300006038 Bacteria 1543
53 Ga0075368_10009961 3300006042 Bacteria 3428
54 Ga0075364_10041198 3300006051 Bacteria 2998
55 Ga0075364_10425865 3300006051 Bacteria 906
56 Ga0070715_10739201 3300006163 Bacteria 591
57 Ga0070716_100010885 3300006173 Bacteria 4574
58 Ga0075362_10021504 3300006177 Bacteria 2708
59 Ga0075362_10067543 3300006177 Bacteria 1627
60 Ga0075367_10324961 3300006178 Bacteria 970
61 Ga0075369_10052734 3300006186 Bacteria 1763
62 Ga0075366_10368741 3300006195 Bacteria 882
63 Ga0075366_10415174 3300006195 Bacteria 829
64 Ga0075366_10820259 3300006195 Bacteria 579
65 Ga0097621_100022522 3300006237 Bacteria 4891
66 Ga0097621_101675720 3300006237 Bacteria 605
67 Ga0097621_102154728 3300006237 Bacteria 533
68 Ga0075370_10058869 3300006353 Bacteria 2185
69 Ga0075370_10932968 3300006353 Bacteria 531
70 Ga0068871_100009518 3300006358 Bacteria 7048
71 Ga0075436_100014027 3300006914 Bacteria 5484
72 Ga0075436_100038169 3300006914 Bacteria 3315
73 Ga0097620_101719916 3300006931 Bacteria 693
74 Ga0075435_100499994 3300007076 Bacteria 1051
75 Ga0099794_10035243 3300007265 Bacteria 2361
76 Ga0099794_10087996 3300007265 Bacteria 1539
77 Ga0099794_10300126 3300007265 Bacteria 832
78 Ga0099795_10109336 3300007788 Bacteria 1094
79 Ga0099795_10305656 3300007788 Bacteria 701
80 Ga0105240_10647479 3300009093 Bacteria 1159
81 Ga0105245_10264097 3300009098 Bacteria 1676
82 Ga0105245_11176288 3300009098 Bacteria 814
83 Ga0105245_11219165 3300009098 Bacteria 800
84 Ga0105245_11706426 3300009098 Bacteria 682
85 Ga0114129_11067642 3300009147 Bacteria 1013
86 Ga0105243_10581229 3300009148 Bacteria 1075
87 Ga0105243_11108840 3300009148 Bacteria 800
88 Ga0105241_10008396 3300009174 Bacteria 7599
89 Ga0105241_10769836 3300009174 Bacteria 884
90 Ga0105242_10117613 3300009176 Bacteria 2276
91 Ga0105242_10204034 3300009176 Bacteria 1757
92 Ga0105242_11390281 3300009176 Bacteria 729
93 Ga0105248_10167091 3300009177 Bacteria 2480
94 Ga0105248_10698470 3300009177 Bacteria 1145
95 Ga0105237_10280666 3300009545 Bacteria 1668
96 Ga0105238_10109837 3300009551 Bacteria 2739
97 Ga0105238_11026658 3300009551 Bacteria 846
98 Ga0099796_10068136 3300010159 Bacteria 1278
99 Ga0099796_10399122 3300010159 Bacteria 603
100 Ga0105239_10080647 3300010375 Bacteria 3581
101 Ga0157370_10537594 3300013104 Bacteria 1072
102 Ga0157378_10192298 3300013297 Bacteria 1925
103 Ga0157372_11556173 3300013307 Bacteria 761
104 Ga0157375_12020114 3300013308 Bacteria 685
105 Ga0157379_11721981 3300014968 Bacteria 614
106 Ga0157379_11741817 3300014968 Bacteria 611
107 Ga0157376_10082097 3300014969 Bacteria 2769
108 Ga0157376_10208688 3300014969 Bacteria 1802
109 Ga0157376_11125288 3300014969 Bacteria 812
110 Ga0163161_10040460 3300017792 Bacteria 3348
111 Ga0206354_11305320 3300020081 Bacteria 2710
112 Ga0206353_10841173 3300020082 Bacteria 937
113 Ga0213872_10001257 3300021361 Bacteria 17069
114 Ga0213872_10097463 3300021361 Bacteria 1313
115 Ga0213876_10029306 3300021384 Bacteria 2900
116 Ga0207685_10279059 3300025905 Bacteria 819
117 Ga0207684_10080043 3300025910 Bacteria 2779
118 Ga0207654_10141919 3300025911 Bacteria 1533
119 Ga0207654_10268485 3300025911 Bacteria 1150
120 Ga0207707_10097582 3300025912 Bacteria 2568
121 Ga0207695_10472718 3300025913 Bacteria 1136
122 Ga0207671_10174928 3300025914 Bacteria 1668
123 Ga0207663_10400485 3300025916 Bacteria 1050
124 Ga0207662_10269337 3300025918 Bacteria 1123
125 Ga0207649_10074933 3300025920 Bacteria 2173
126 Ga0207652_10508099 3300025921 Bacteria 1085
127 Ga0207646_10072395 3300025922 Bacteria 3078
128 Ga0207646_10487019 3300025922 Bacteria 1112
129 Ga0207694_10079333 3300025924 Bacteria 2575
130 Ga0207694_10586896 3300025924 Bacteria 937
131 Ga0207659_10411416 3300025926 Bacteria 1133
132 Ga0207687_10140751 3300025927 Bacteria 1830
133 Ga0207687_10768404 3300025927 Bacteria 820
134 Ga0207700_11534223 3300025928 Bacteria 590
135 Ga0207690_10524223 3300025932 Bacteria 961
136 Ga0207709_10531093 3300025935 Bacteria 922
137 Ga0207670_10026518 3300025936 Bacteria 3652
138 Ga0207665_10007215 3300025939 Bacteria 7354
139 Ga0207711_10463149 3300025941 Bacteria 1180
140 Ga0207689_10136505 3300025942 Bacteria 2020
141 Ga0207679_10715581 3300025945 Bacteria 909
142 Ga0207679_10917982 3300025945 Bacteria 801
143 Ga0207667_10106069 3300025949 Bacteria 2899
144 Ga0207667_10431844 3300025949 Bacteria 1339
145 Ga0207667_10560390 3300025949 Bacteria 1155
146 Ga0207651_10113908 3300025960 Bacteria 2036
147 Ga0207712_10781154 3300025961 Bacteria 838
148 Ga0207640_10086275 3300025981 Bacteria 2161
149 Ga0207703_10564753 3300026035 Bacteria 1074
150 Ga0207639_10052068 3300026041 Bacteria 3117
151 Ga0207702_10328456 3300026078 Bacteria 1458
152 Ga0207676_10408288 3300026095 Bacteria 1271
153 Ga0207676_10884740 3300026095 Bacteria 875
154 Ga0207674_10032531 3300026116 Bacteria 5470
155 Ga0207675_100476245 3300026118 Bacteria 1240
156 Ga0207683_10157799 3300026121 Bacteria 2050
157 Ga0207683_10255389 3300026121 Bacteria 1600
158 Ga0207683_10270879 3300026121 Bacteria 1551
159 Ga0207698_10057259 3300026142 Bacteria 3014
160 Ga0209179_1001677 3300027512 Bacteria 2800
161 Ga0209588_1029616 3300027671 Bacteria 1747
162 Ga0268266_10109194 3300028379 Bacteria 2449
163 Ga0268266_11129530 3300028379 Bacteria 758
164 Ga0268264_12098922 3300028381 Bacteria 574
165 Ga0265324_10120701 3300029957 Bacteria 890
166 Ga0307511_10000005 3300030521 Bacteria 175482
167 Ga0265328_10000252 3300031239 Bacteria 24700
168 Ga0265331_10000050 3300031250 Bacteria 181286
169 Ga0265327_10000109 3300031251 Bacteria 181275
170 Ga0307509_10451762 3300031507 Bacteria 979
171 Ga0307405_10176167 3300031731 Bacteria 1530
172 Ga0307405_10843039 3300031731 Bacteria 771
173 Ga0307410_10123544 3300031852 Bacteria 1891
174 Ga0307410_10381988 3300031852 Bacteria 1133
175 Ga0307406_10021627 3300031901 Bacteria 3807
176 Ga0307407_10148156 3300031903 Bacteria 1522
177 Ga0307407_10254274 3300031903 Bacteria 1205
178 Ga0307412_10998129 3300031911 Bacteria 739
179 Ga0307409_100582369 3300031995 Bacteria 1103
180 Ga0307416_100006509 3300032002 Bacteria 7320
181 Ga0307416_100217363 3300032002 Bacteria 1829
182 Ga0307416_101553456 3300032002 Bacteria 767
183 Ga0307416_101609944 3300032002 Bacteria 755
184 Ga0307414_10391995 3300032004 Unclassified 1204
185 Ga0307411_10660035 3300032005 Bacteria 906
186 Ga0307415_100005266 3300032126 Bacteria 6845
187 Ga0307507_10157192 3300033179 Bacteria 1691
188 Ga0307507_10194298 3300033179 Bacteria 1419
189 Ga0373938_0061031 3300034957 Bacteria 882
190 Ga0373929_0212136 3300035085 Bacteria 547
191 Ga0373934_0000524 3300035086 Bacteria 13506
192 Ga0373934_0003529 3300035086 Bacteria 5750
193 Ga0373944_0006161 3300035089 Bacteria 3180
194 Ga0373944_0260760 3300035089 Bacteria 642
195 Ga0373923_0001446 3300035111 Bacteria 6812
196 Ga0373936_0003119 3300035113 Bacteria 6206
197 Ga0373941_0016592 3300035115 Bacteria 2005
198 Ga0373941_0313507 3300035115 Bacteria 629
199 Ga0373941_0438861 3300035115 Bacteria 546
200 Ga0373953_0010908 3300035117 Bacteria 3175
201 Ga0373953_0022384 3300035117 Bacteria 2382
202 Ga0373954_0006395 3300035118 Bacteria 5137
203 Ga0373954_0012566 3300035118 Bacteria 3766
204 Ga0373954_0390970 3300035118 Bacteria 687
205 Ga0373956_0000135 3300035119 Bacteria 26321
206 Ga0373956_0011618 3300035119 Bacteria 3630
207 Ga0373957_0005029 3300035120 Bacteria 4077
208 Ga0373957_0017749 3300035120 Bacteria 2484
209 Ga0373943_0140525 3300035170 Bacteria 1300
210 Ga0373946_0004173 3300035171 Bacteria 5148
211 Ga0373955_0007893 3300035172 Bacteria 4913
212 Ga0373955_0012069 3300035172 Bacteria 4143
213 Ga0373942_0040742 3300035207 Bacteria 1268
214 Ga0373924_0006358 3300035410 Bacteria 4230
215 Ga0373924_0195970 3300035410 Bacteria 890
216 Ga0373935_0035743 3300035692 Bacteria 3102
217 Ga0373927_0122877 3300035695 Bacteria 1694
218 Ga0373927_0471440 3300035695 Bacteria 829
219 Ga0373933_0005320 3300035724 Bacteria 7015
220 Ga0373933_0023905 3300035724 Bacteria 3495
221 Ga0373933_0570371 3300035724 Bacteria 743
222 Ga0373937_0047907 3300036401 Bacteria 3910
223 Ga0373937_0051759 3300036401 Bacteria 3763
224 Ga0373937_0297939 3300036401 Bacteria 1524
225 Ga0373937_0493311 3300036401 Bacteria 1163
226 Ga0373937_0782488 3300036401 Bacteria 902
227 Ga0373925_0033121 3300037068 Bacteria 3808
228 Ga0373925_0291083 3300037068 Bacteria 1317
229 Ga0395898_1735941 3300037466 Bacteria 546
230 Ga0436365_0547720 3300039437 Bacteria 3894
231 Ga0436361_0293841 3300039447 Bacteria 85519
232 Ga0436361_0921278 3300039447 Bacteria 22626
233 Ga0436361_0960744 3300039447 Bacteria 1012
234 Ga0451802_1904897 3300041460 Bacteria 660
235 Ga0451807_2684432 3300041486 Bacteria 562
236 Ga0451839_0242579 3300041496 Bacteria 641
237 Ga0453684_0000566 3300044712 Bacteria 138895
238 Ga0466957_0718811 3300044842 Bacteria 706
239 Ga0451576_1011719 3300045051 Bacteria 871
240 Ga0495592_0008918 3300046454 Bacteria 7532
241 Ga0495592_0176711 3300046454 Bacteria 1457
242 Ga0495603_0036454 3300046455 Bacteria 2953
243 Ga0495641_0003418 3300046461 Bacteria 11897
244 Ga0495651_0000274 3300046462 Bacteria 40100
245 Ga0495651_0001676 3300046462 Bacteria 17133
246 Ga0495653_0005409 3300046463 Bacteria 10393
247 Ga0495653_0382111 3300046463 Bacteria 899
248 Ga0495580_0009275 3300046472 Bacteria 7743
249 Ga0495639_0005050 3300046475 Bacteria 5667
250 Ga0495662_0003458 3300046476 Bacteria 7997
251 Ga0495664_0057801 3300046477 Bacteria 2307
252 Ga0495594_0022444 3300046499 Bacteria 3376
253 Ga0495608_0007610 3300046511 Bacteria 7636
254 Ga0495608_0238299 3300046511 Bacteria 1137
255 Ga0495618_0045943 3300046514 Bacteria 2756
256 Ga0495618_0881150 3300046514 Bacteria 517
257 Ga0495628_0033466 3300046516 Bacteria 4142
258 Ga0495628_0086220 3300046516 Bacteria 2435
259 Ga0495630_0010579 3300046517 Bacteria 6664
260 Ga0495630_0549709 3300046517 Bacteria 885
261 Ga0495652_0463774 3300046529 Bacteria 884
262 Ga0495640_0005911 3300046533 Bacteria 9704
263 Ga0495586_0009851 3300046535 Bacteria 5087
264 Ga0495587_0002749 3300046536 Bacteria 11735
265 Ga0495587_0674989 3300046536 Bacteria 567
266 Ga0495645_0133082 3300046543 Bacteria 1741
267 Ga0495622_0068469 3300046557 Bacteria 1639
268 Ga0495667_0007160 3300046559 Bacteria 7569
269 Ga0495667_0118945 3300046559 Bacteria 1706
270 Ga0495634_0004588 3300046642 Bacteria 10791
271 Ga0495635_0036115 3300046663 Bacteria 3426
272 Ga0495635_0925050 3300046663 Bacteria 557
273 Ga0495657_0029252 3300046675 Bacteria 3866
274 Ga0495657_0060866 3300046675 Bacteria 2499
275 Ga0495657_0585273 3300046675 Bacteria 646
276 Ga0495599_0003076 3300046678 Bacteria 9713
277 Ga0495599_0157366 3300046678 Bacteria 1405
278 Ga0495647_0005191 3300046681 Bacteria 4266
279 Ga0495613_0008045 3300046689 Bacteria 7841
280 Ga0495624_0034385 3300046690 Bacteria 3278
281 Ga0495600_0001375 3300046809 Bacteria 13432
282 Ga0495604_0099842 3300047317 Bacteria 2135
283 Ga0495674_0005197 3300047319 Bacteria 12503
284 Ga0495680_0027785 3300047322 Bacteria 4642
285 Ga0495680_0086561 3300047322 Bacteria 2357
286 Ga0495680_0149147 3300047322 Bacteria 1706
287 Ga0495675_0126019 3300047444 Bacteria 1593
288 Ga0495684_0004387 3300047471 Bacteria 11028
289 Ga0495602_0623001 3300048088 Bacteria 740
290 Ga0495614_0052694 3300048089 Bacteria 1744
291 Ga0496104_1053937 3300048907 Bacteria 717
292 Ga0496126_0128753 3300048929 Bacteria 2189
293 Ga0501047_0717545 3300049581 Bacteria 817
294 Ga0501233_035270 3300049668 Bacteria 1152
295 Ga0501267_016779 3300049764 Bacteria 783
296 nmdc:mga03683_137724_c1 3300050489 Bacteria 1096
297 nmdc:mga03683_91452_c1 3300050489 Bacteria 1327
298 nmdc:mga03n38_92527_c1 3300050490 Bacteria 1443
299 nmdc:mga00v17_187485_c1 3300050491 Bacteria 1335
300 nmdc:mga00v17_256719_c1 3300050491 Bacteria 1134
301 nmdc:mga0k408_133426_c1 3300050493 Bacteria 1474
302 nmdc:mga0k408_29462_c1 3300050493 Bacteria 3125
303 nmdc:mga0k408_597787_c1 3300050493 Bacteria 651
304 nmdc:mga06z11_160277_c1 3300050494 Bacteria 1285
305 nmdc:mga06z11_176500_c1 3300050494 Bacteria 1230
306 nmdc:mga04h51_83711_c1 3300050495 Bacteria 1137
307 nmdc:mga07m45_61342_c1 3300050496 Bacteria 1174
308 nmdc:mga07m45_661442_c1 3300050496 Bacteria 602
309 nmdc:mga05p37_2015984_c1 3300050507 Bacteria 545
310 nmdc:mga0n895_2002612_c1 3300050512 Bacteria 537
311 nmdc:mga08x19_135144_c1 3300050514 Bacteria 1662
312 nmdc:mga08x19_99689_c1 3300050514 Bacteria 1926
313 Ga0495601_0039128 3300053077 Bacteria 2969
314 Ga0495595_0000266 3300053084 Bacteria 20675
315 Ga0495619_0728240 3300053085 Bacteria 673
316 Ga0495619_0784504 3300053085 Bacteria 645
317 Ga0500646_0001422 3300053090 Bacteria 6353
318 Ga0500583_0371920 3300053092 Bacteria 689
319 Ga0500651_0592690 3300053093 Bacteria 602
320 Ga0500650_0028786 3300053098 Bacteria 2512
321 Ga0500650_0424029 3300053098 Bacteria 573
322 Ga0500642_0070959 3300053130 Bacteria 1585
323 Ga0500655_001174 3300053133 Bacteria 4987
324 Ga0500568_0034712 3300053139 Bacteria 2062
325 Ga0500588_0299720 3300053146 Bacteria 608
326 Ga0500604_0000649 3300053151 Bacteria 9555
327 Ga0500637_0416744 3300053178 Bacteria 692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021361 Ga0213872_10001257 Ga0213872_1000125713 107
2 3300039447 Ga0436361_0293841 Ga0436361_0293841_57803_58126 107
3 3300039447 Ga0436361_0921278 Ga0436361_0921278_3625_3948 107
4 3300029957 Ga0265324_10120701 Ga0265324_101207012 111
5 3300031239 Ga0265328_10000252 Ga0265328_1000025223 111
6 3300031250 Ga0265331_10000050 Ga0265331_10000050170 111
7 3300031251 Ga0265327_10000109 Ga0265327_1000010955 111
8 iso_pu_bacteria 2891633521 2891635458 111
9 3300006353 Ga0075370_10932968 Ga0075370_109329681 112
10 3300026121 Ga0207683_10255389 Ga0207683_102553892 112
11 3300028379 Ga0268266_10109194 Ga0268266_101091944 112
12 3300041486 Ga0451807_2684432 Ga0451807_2684432_57_398 112
13 3300041496 Ga0451839_0242579 Ga0451839_0242579_282_623 112
14 3300050496 nmdc:mga07m45_661442_c1 nmdc:mga07m45_661442_c1_136_477 112
15 3300005356 Ga0070674_100767543 Ga0070674_1007675432 113
16 3300005457 Ga0070662_101299194 Ga0070662_1012991941 113
17 3300005563 Ga0068855_101951887 Ga0068855_1019518872 113
18 3300020081 Ga0206354_11305320 Ga0206354_113053202 113
19 3300020082 Ga0206353_10841173 Ga0206353_108411732 113
20 3300025911 Ga0207654_10141919 Ga0207654_101419192 113
21 3300025920 Ga0207649_10074933 Ga0207649_100749332 113
22 3300025924 Ga0207694_10586896 Ga0207694_105868961 113
23 3300025932 Ga0207690_10524223 Ga0207690_105242232 113
24 3300025945 Ga0207679_10715581 Ga0207679_107155812 113
25 3300025949 Ga0207667_10431844 Ga0207667_104318442 113
26 3300025949 Ga0207667_10560390 Ga0207667_105603903 113
27 3300025981 Ga0207640_10086275 Ga0207640_100862754 113
28 3300026078 Ga0207702_10328456 Ga0207702_103284562 113
29 3300026142 Ga0207698_10057259 Ga0207698_100572594 113
30 3300028379 Ga0268266_11129530 Ga0268266_111295302 113
31 3300035085 Ga0373929_0212136 Ga0373929_0212136_150_515 113
32 3300006042 Ga0075368_10009961 Ga0075368_100099614 115
33 3300006051 Ga0075364_10041198 Ga0075364_100411983 115
34 3300006177 Ga0075362_10021504 Ga0075362_100215044 115
35 3300006186 Ga0075369_10052734 Ga0075369_100527342 115
36 3300006195 Ga0075366_10368741 Ga0075366_103687411 115
37 3300006353 Ga0075370_10058869 Ga0075370_100588694 115
38 3300007076 Ga0075435_100499994 Ga0075435_1004999943 115
39 3300034957 Ga0373938_0061031 Ga0373938_0061031_459_806 115
40 3300035115 Ga0373941_0313507 Ga0373941_0313507_246_593 115
41 3300050489 nmdc:mga03683_137724_c1 nmdc:mga03683_137724_c1_138_497 115
42 3300050490 nmdc:mga03n38_92527_c1 nmdc:mga03n38_92527_c1_452_811 115
43 3300050491 nmdc:mga00v17_256719_c1 nmdc:mga00v17_256719_c1_437_796 115
44 3300050493 nmdc:mga0k408_29462_c1 nmdc:mga0k408_29462_c1_1423_1782 115
45 3300050494 nmdc:mga06z11_176500_c1 nmdc:mga06z11_176500_c1_474_833 115
46 3300050495 nmdc:mga04h51_83711_c1 nmdc:mga04h51_83711_c1_537_896 115
47 3300050496 nmdc:mga07m45_61342_c1 nmdc:mga07m45_61342_c1_796_1155 115
48 3300050514 nmdc:mga08x19_99689_c1 nmdc:mga08x19_99689_c1_1016_1363 115
49 3300005330 Ga0070690_100074519 Ga0070690_1000745194 116
50 3300005334 Ga0068869_100114488 Ga0068869_1001144883 116
51 3300005340 Ga0070689_100062603 Ga0070689_1000626035 116
52 3300005343 Ga0070687_100085938 Ga0070687_1000859383 116
53 3300005345 Ga0070692_10983252 Ga0070692_109832521 116
54 3300005364 Ga0070673_100404805 Ga0070673_1004048053 116
55 3300005456 Ga0070678_100286002 Ga0070678_1002860024 116
56 3300005456 Ga0070678_101055867 Ga0070678_1010558672 116
57 3300005547 Ga0070693_100001685 Ga0070693_1000016859 116
58 3300005615 Ga0070702_100408288 Ga0070702_1004082881 116
59 3300005616 Ga0068852_101445680 Ga0068852_1014456802 116
60 3300005617 Ga0068859_101719867 Ga0068859_1017198672 116
61 3300005618 Ga0068864_100778838 Ga0068864_1007788383 116
62 3300005718 Ga0068866_10513929 Ga0068866_105139292 116
63 3300006038 Ga0075365_10165398 Ga0075365_101653983 116
64 3300006195 Ga0075366_10415174 Ga0075366_104151742 116
65 3300006195 Ga0075366_10820259 Ga0075366_108202591 116
66 3300006237 Ga0097621_100022522 Ga0097621_1000225224 116
67 3300006358 Ga0068871_100009518 Ga0068871_1000095186 116
68 3300006931 Ga0097620_101719916 Ga0097620_1017199162 116
69 3300009098 Ga0105245_10264097 Ga0105245_102640974 116
70 3300009098 Ga0105245_11176288 Ga0105245_111762881 116
71 3300009148 Ga0105243_11108840 Ga0105243_111088401 116
72 3300009174 Ga0105241_10769836 Ga0105241_107698363 116
73 3300009176 Ga0105242_10117613 Ga0105242_101176134 116
74 3300009176 Ga0105242_10204034 Ga0105242_102040344 116
75 3300009177 Ga0105248_10698470 Ga0105248_106984704 116
76 3300009551 Ga0105238_11026658 Ga0105238_110266582 116
77 3300013297 Ga0157378_10192298 Ga0157378_101922983 116
78 3300014969 Ga0157376_10082097 Ga0157376_100820975 116
79 3300025918 Ga0207662_10269337 Ga0207662_102693372 116
80 3300025927 Ga0207687_10140751 Ga0207687_101407514 116
81 3300025935 Ga0207709_10531093 Ga0207709_105310932 116
82 3300025936 Ga0207670_10026518 Ga0207670_100265184 116
83 3300025941 Ga0207711_10463149 Ga0207711_104631493 116
84 3300025942 Ga0207689_10136505 Ga0207689_101365054 116
85 3300025960 Ga0207651_10113908 Ga0207651_101139084 116
86 3300026095 Ga0207676_10408288 Ga0207676_104082882 116
87 3300026121 Ga0207683_10157799 Ga0207683_101577991 116
88 3300026121 Ga0207683_10270879 Ga0207683_102708794 116
89 3300028381 Ga0268264_12098922 Ga0268264_120989221 116
90 3300030521 Ga0307511_10000005 Ga0307511_1000000544 116
91 3300031507 Ga0307509_10451762 Ga0307509_104517623 116
92 3300032002 Ga0307416_101553456 Ga0307416_1015534562 116
93 3300036401 Ga0373937_0297939 Ga0373937_0297939_1120_1470 116
94 3300041460 Ga0451802_1904897 Ga0451802_1904897_59_409 116
95 3300044712 Ga0453684_0000566 Ga0453684_0000566_18281_18631 116
96 3300050491 nmdc:mga00v17_187485_c1 nmdc:mga00v17_187485_c1_702_1064 116
97 3300050493 nmdc:mga0k408_133426_c1 nmdc:mga0k408_133426_c1_878_1240 116
98 3300050493 nmdc:mga0k408_597787_c1 nmdc:mga0k408_597787_c1_202_564 116
99 3300053090 Ga0500646_0001422 Ga0500646_0001422_4992_5354 116
100 3300053092 Ga0500583_0371920 Ga0500583_0371920_22_384 116
101 3300053098 Ga0500650_0028786 Ga0500650_0028786_1058_1420 116
102 3300053133 Ga0500655_001174 Ga0500655_001174_2596_2958 116
103 3300053139 Ga0500568_0034712 Ga0500568_0034712_1181_1543 116
104 3300053146 Ga0500588_0299720 Ga0500588_0299720_65_427 116
105 3300053151 Ga0500604_0000649 Ga0500604_0000649_3302_3664 116
106 3300053178 Ga0500637_0416744 Ga0500637_0416744_116_478 116
107 3300005345 Ga0070692_10475285 Ga0070692_104752852 117
108 3300005364 Ga0070673_101684019 Ga0070673_1016840191 117
109 3300005441 Ga0070700_100240735 Ga0070700_1002407351 117
110 3300005456 Ga0070678_100534776 Ga0070678_1005347761 117
111 3300005842 Ga0068858_100070921 Ga0068858_1000709216 117
112 3300006237 Ga0097621_101675720 Ga0097621_1016757202 117
113 3300009148 Ga0105243_10581229 Ga0105243_105812292 117
114 3300009176 Ga0105242_11390281 Ga0105242_113902811 117
115 3300009177 Ga0105248_10167091 Ga0105248_101670915 117
116 3300013308 Ga0157375_12020114 Ga0157375_120201142 117
117 3300014968 Ga0157379_11721981 Ga0157379_117219812 117
118 3300014968 Ga0157379_11741817 Ga0157379_117418171 117
119 3300014969 Ga0157376_10208688 Ga0157376_102086884 117
120 3300017792 Ga0163161_10040460 Ga0163161_100404605 117
121 3300025926 Ga0207659_10411416 Ga0207659_104114162 117
122 3300026118 Ga0207675_100476245 Ga0207675_1004762452 117
123 3300031731 Ga0307405_10843039 Ga0307405_108430392 117
124 3300032002 Ga0307416_100006509 Ga0307416_1000065097 117
125 3300032004 Ga0307414_10391995 Ga0307414_103919951 117
126 3300032126 Ga0307415_100005266 Ga0307415_1000052661 117
127 3300033179 Ga0307507_10157192 Ga0307507_101571922 117
128 3300035207 Ga0373942_0040742 Ga0373942_0040742_259_612 117
129 3300045051 Ga0451576_1011719 Ga0451576_1011719_173_526 117
130 3300005439 Ga0070711_100202398 Ga0070711_1002023983 118
131 3300005471 Ga0070698_101592953 Ga0070698_1015929532 118
132 3300005536 Ga0070697_100106288 Ga0070697_1001062882 118
133 3300005536 Ga0070697_100445737 Ga0070697_1004457373 118
134 3300005545 Ga0070695_100592486 Ga0070695_1005924861 118
135 3300006173 Ga0070716_100010885 Ga0070716_1000108855 118
136 3300006914 Ga0075436_100014027 Ga0075436_1000140275 118
137 3300006914 Ga0075436_100038169 Ga0075436_1000381695 118
138 3300007265 Ga0099794_10035243 Ga0099794_100352434 118
139 3300007788 Ga0099795_10305656 Ga0099795_103056562 118
140 3300009147 Ga0114129_11067642 Ga0114129_110676422 118
141 3300025916 Ga0207663_10400485 Ga0207663_104004852 118
142 3300025922 Ga0207646_10487019 Ga0207646_104870193 118
143 3300025939 Ga0207665_10007215 Ga0207665_100072158 118
144 3300027512 Ga0209179_1001677 Ga0209179_10016773 118
145 3300027671 Ga0209588_1029616 Ga0209588_10296164 118
146 3300032002 Ga0307416_101609944 Ga0307416_1016099442 118
147 3300033179 Ga0307507_10194298 Ga0307507_101942983 118
148 3300035086 Ga0373934_0000524 Ga0373934_0000524_5943_6299 118
149 3300035086 Ga0373934_0003529 Ga0373934_0003529_912_1268 118
150 3300035089 Ga0373944_0006161 Ga0373944_0006161_1311_1667 118
151 3300035111 Ga0373923_0001446 Ga0373923_0001446_2716_3072 118
152 3300035113 Ga0373936_0003119 Ga0373936_0003119_5002_5358 118
153 3300035117 Ga0373953_0010908 Ga0373953_0010908_1015_1371 118
154 3300035117 Ga0373953_0022384 Ga0373953_0022384_1934_2290 118
155 3300035118 Ga0373954_0006395 Ga0373954_0006395_4348_4704 118
156 3300035118 Ga0373954_0012566 Ga0373954_0012566_1451_1807 118
157 3300035118 Ga0373954_0390970 Ga0373954_0390970_266_622 118
158 3300035119 Ga0373956_0000135 Ga0373956_0000135_19290_19646 118
159 3300035119 Ga0373956_0011618 Ga0373956_0011618_1048_1404 118
160 3300035120 Ga0373957_0005029 Ga0373957_0005029_3115_3471 118
161 3300035120 Ga0373957_0017749 Ga0373957_0017749_1740_2096 118
162 3300035170 Ga0373943_0140525 Ga0373943_0140525_912_1268 118
163 3300035171 Ga0373946_0004173 Ga0373946_0004173_3927_4283 118
164 3300035172 Ga0373955_0007893 Ga0373955_0007893_3614_3970 118
165 3300035172 Ga0373955_0012069 Ga0373955_0012069_202_558 118
166 3300035410 Ga0373924_0006358 Ga0373924_0006358_1487_1843 118
167 3300035410 Ga0373924_0195970 Ga0373924_0195970_498_854 118
168 3300035692 Ga0373935_0035743 Ga0373935_0035743_1338_1694 118
169 3300035695 Ga0373927_0122877 Ga0373927_0122877_62_418 118
170 3300035724 Ga0373933_0005320 Ga0373933_0005320_923_1279 118
171 3300035724 Ga0373933_0023905 Ga0373933_0023905_24_380 118
172 3300036401 Ga0373937_0047907 Ga0373937_0047907_1843_2199 118
173 3300036401 Ga0373937_0051759 Ga0373937_0051759_2829_3185 118
174 3300036401 Ga0373937_0493311 Ga0373937_0493311_273_629 118
175 3300037068 Ga0373925_0033121 Ga0373925_0033121_1005_1361 118
176 3300046454 Ga0495592_0008918 Ga0495592_0008918_5856_6212 118
177 3300046454 Ga0495592_0176711 Ga0495592_0176711_136_492 118
178 3300046455 Ga0495603_0036454 Ga0495603_0036454_1074_1430 118
179 3300046461 Ga0495641_0003418 Ga0495641_0003418_2062_2418 118
180 3300046462 Ga0495651_0000274 Ga0495651_0000274_20986_21342 118
181 3300046462 Ga0495651_0001676 Ga0495651_0001676_6201_6557 118
182 3300046463 Ga0495653_0005409 Ga0495653_0005409_5790_6146 118
183 3300046463 Ga0495653_0382111 Ga0495653_0382111_443_799 118
184 3300046472 Ga0495580_0009275 Ga0495580_0009275_1159_1515 118
185 3300046475 Ga0495639_0005050 Ga0495639_0005050_17_373 118
186 3300046476 Ga0495662_0003458 Ga0495662_0003458_4231_4587 118
187 3300046477 Ga0495664_0057801 Ga0495664_0057801_1929_2285 118
188 3300046499 Ga0495594_0022444 Ga0495594_0022444_2002_2358 118
189 3300046511 Ga0495608_0007610 Ga0495608_0007610_5108_5464 118
190 3300046511 Ga0495608_0238299 Ga0495608_0238299_615_971 118
191 3300046514 Ga0495618_0045943 Ga0495618_0045943_2377_2733 118
192 3300046514 Ga0495618_0881150 Ga0495618_0881150_56_412 118
193 3300046516 Ga0495628_0033466 Ga0495628_0033466_3614_3970 118
194 3300046516 Ga0495628_0086220 Ga0495628_0086220_1117_1473 118
195 3300046517 Ga0495630_0010579 Ga0495630_0010579_4988_5344 118
196 3300046517 Ga0495630_0549709 Ga0495630_0549709_418_774 118
197 3300046529 Ga0495652_0463774 Ga0495652_0463774_176_532 118
198 3300046533 Ga0495640_0005911 Ga0495640_0005911_5996_6352 118
199 3300046535 Ga0495586_0009851 Ga0495586_0009851_3742_4098 118
200 3300046536 Ga0495587_0002749 Ga0495587_0002749_5638_5994 118
201 3300046536 Ga0495587_0674989 Ga0495587_0674989_33_389 118
202 3300046543 Ga0495645_0133082 Ga0495645_0133082_709_1065 118
203 3300046557 Ga0495622_0068469 Ga0495622_0068469_599_955 118
204 3300046559 Ga0495667_0007160 Ga0495667_0007160_4805_5161 118
205 3300046559 Ga0495667_0118945 Ga0495667_0118945_816_1172 118
206 3300046642 Ga0495634_0004588 Ga0495634_0004588_3614_3970 118
207 3300046663 Ga0495635_0036115 Ga0495635_0036115_1549_1905 118
208 3300046663 Ga0495635_0925050 Ga0495635_0925050_166_522 118
209 3300046675 Ga0495657_0029252 Ga0495657_0029252_1586_1942 118
210 3300046675 Ga0495657_0060866 Ga0495657_0060866_1277_1633 118
211 3300046675 Ga0495657_0585273 Ga0495657_0585273_167_523 118
212 3300046678 Ga0495599_0003076 Ga0495599_0003076_5785_6141 118
213 3300046678 Ga0495599_0157366 Ga0495599_0157366_1005_1361 118
214 3300046681 Ga0495647_0005191 Ga0495647_0005191_3689_4045 118
215 3300046689 Ga0495613_0008045 Ga0495613_0008045_1812_2168 118
216 3300046690 Ga0495624_0034385 Ga0495624_0034385_2430_2786 118
217 3300046809 Ga0495600_0001375 Ga0495600_0001375_8438_8794 118
218 3300047317 Ga0495604_0099842 Ga0495604_0099842_867_1223 118
219 3300047319 Ga0495674_0005197 Ga0495674_0005197_4147_4503 118
220 3300047322 Ga0495680_0027785 Ga0495680_0027785_3614_3970 118
221 3300047322 Ga0495680_0086561 Ga0495680_0086561_379_735 118
222 3300047322 Ga0495680_0149147 Ga0495680_0149147_25_381 118
223 3300047444 Ga0495675_0126019 Ga0495675_0126019_1131_1487 118
224 3300047471 Ga0495684_0004387 Ga0495684_0004387_5583_5939 118
225 3300048088 Ga0495602_0623001 Ga0495602_0623001_277_633 118
226 3300048089 Ga0495614_0052694 Ga0495614_0052694_690_1046 118
227 3300050507 nmdc:mga05p37_2015984_c1 nmdc:mga05p37_2015984_c1_84_440 118
228 3300050512 nmdc:mga0n895_2002612_c1 nmdc:mga0n895_2002612_c1_25_381 118
229 3300050514 nmdc:mga08x19_135144_c1 nmdc:mga08x19_135144_c1_738_1094 118
230 3300053077 Ga0495601_0039128 Ga0495601_0039128_1837_2193 118
231 3300053084 Ga0495595_0000266 Ga0495595_0000266_8607_8963 118
232 3300053085 Ga0495619_0728240 Ga0495619_0728240_24_380 118
233 3300053085 Ga0495619_0784504 Ga0495619_0784504_160_516 118
234 3300009098 Ga0105245_11706426 Ga0105245_117064261 119
235 3300005336 Ga0070680_100092214 Ga0070680_1000922142 120
236 3300005444 Ga0070694_100256416 Ga0070694_1002564163 120
237 3300005458 Ga0070681_10029669 Ga0070681_100296697 120
238 3300005530 Ga0070679_100079001 Ga0070679_1000790014 120
239 3300005577 Ga0068857_100068889 Ga0068857_1000688896 120
240 3300005578 Ga0068854_101186754 Ga0068854_1011867541 120
241 3300005842 Ga0068858_100191231 Ga0068858_1001912314 120
242 3300005842 Ga0068858_100608579 Ga0068858_1006085793 120
243 3300005937 Ga0081455_10103214 Ga0081455_101032141 120
244 3300006051 Ga0075364_10425865 Ga0075364_104258652 120
245 3300009093 Ga0105240_10647479 Ga0105240_106474793 120
246 3300009098 Ga0105245_11219165 Ga0105245_112191652 120
247 3300009174 Ga0105241_10008396 Ga0105241_100083963 120
248 3300009545 Ga0105237_10280666 Ga0105237_102806663 120
249 3300009551 Ga0105238_10109837 Ga0105238_101098373 120
250 3300010375 Ga0105239_10080647 Ga0105239_100806474 120
251 3300013307 Ga0157372_11556173 Ga0157372_115561732 120
252 3300021384 Ga0213876_10029306 Ga0213876_100293064 120
253 3300025911 Ga0207654_10268485 Ga0207654_102684852 120
254 3300025913 Ga0207695_10472718 Ga0207695_104727183 120
255 3300025914 Ga0207671_10174928 Ga0207671_101749283 120
256 3300025921 Ga0207652_10508099 Ga0207652_105080991 120
257 3300025924 Ga0207694_10079333 Ga0207694_100793333 120
258 3300025927 Ga0207687_10768404 Ga0207687_107684042 120
259 3300025945 Ga0207679_10917982 Ga0207679_109179822 120
260 3300025961 Ga0207712_10781154 Ga0207712_107811542 120
261 3300026035 Ga0207703_10564753 Ga0207703_105647532 120
262 3300039437 Ga0436365_0547720 Ga0436365_0547720_1098_1478 120
263 3300048907 Ga0496104_1053937 Ga0496104_1053937_257_619 120
264 3300005445 Ga0070708_100549386 Ga0070708_1005493862 121
265 3300005467 Ga0070706_100024166 Ga0070706_1000241663 121
266 3300005468 Ga0070707_100392652 Ga0070707_1003926523 121
267 3300005471 Ga0070698_100007893 Ga0070698_10000789315 121
268 3300005518 Ga0070699_100125354 Ga0070699_1001253542 121
269 3300005536 Ga0070697_100435394 Ga0070697_1004353942 121
270 3300005985 Ga0081539_10013309 Ga0081539_100133092 121
271 3300006028 Ga0070717_10744324 Ga0070717_107443241 121
272 3300006163 Ga0070715_10739201 Ga0070715_107392012 121
273 3300006177 Ga0075362_10067543 Ga0075362_100675432 121
274 3300006178 Ga0075367_10324961 Ga0075367_103249612 121
275 3300006237 Ga0097621_102154728 Ga0097621_1021547281 121
276 3300007265 Ga0099794_10087996 Ga0099794_100879963 121
277 3300007265 Ga0099794_10300126 Ga0099794_103001262 121
278 3300007788 Ga0099795_10109336 Ga0099795_101093362 121
279 3300010159 Ga0099796_10068136 Ga0099796_100681362 121
280 3300010159 Ga0099796_10399122 Ga0099796_103991221 121
281 3300013104 Ga0157370_10537594 Ga0157370_105375942 121
282 3300014969 Ga0157376_11125288 Ga0157376_111252882 121
283 3300021361 Ga0213872_10097463 Ga0213872_100974632 121
284 3300025905 Ga0207685_10279059 Ga0207685_102790592 121
285 3300025910 Ga0207684_10080043 Ga0207684_100800433 121
286 3300025922 Ga0207646_10072395 Ga0207646_100723952 121
287 3300025928 Ga0207700_11534223 Ga0207700_115342231 121
288 3300031731 Ga0307405_10176167 Ga0307405_101761672 121
289 3300031852 Ga0307410_10123544 Ga0307410_101235442 121
290 3300031852 Ga0307410_10381988 Ga0307410_103819882 121
291 3300031901 Ga0307406_10021627 Ga0307406_100216274 121
292 3300031903 Ga0307407_10148156 Ga0307407_101481561 121
293 3300031903 Ga0307407_10254274 Ga0307407_102542742 121
294 3300031911 Ga0307412_10998129 Ga0307412_109981292 121
295 3300031995 Ga0307409_100582369 Ga0307409_1005823692 121
296 3300032002 Ga0307416_100217363 Ga0307416_1002173632 121
297 3300032005 Ga0307411_10660035 Ga0307411_106600351 121
298 3300035089 Ga0373944_0260760 Ga0373944_0260760_66_464 121
299 3300035115 Ga0373941_0016592 Ga0373941_0016592_1514_1900 121
300 3300035115 Ga0373941_0438861 Ga0373941_0438861_110_496 121
301 3300035695 Ga0373927_0471440 Ga0373927_0471440_81_479 121
302 3300035724 Ga0373933_0570371 Ga0373933_0570371_15_401 121
303 3300036401 Ga0373937_0782488 Ga0373937_0782488_119_505 121
304 3300037068 Ga0373925_0291083 Ga0373925_0291083_670_1068 121
305 3300037466 Ga0395898_1735941 Ga0395898_1735941_30_467 121
306 3300039447 Ga0436361_0960744 Ga0436361_0960744_41_427 121
307 3300044842 Ga0466957_0718811 Ga0466957_0718811_269_646 121
308 3300048929 Ga0496126_0128753 Ga0496126_0128753_212_598 121
309 3300049581 Ga0501047_0717545 Ga0501047_0717545_73_459 121
310 3300049668 Ga0501233_035270 Ga0501233_035270_496_873 121
311 3300049764 Ga0501267_016779 Ga0501267_016779_314_691 121
312 3300050489 nmdc:mga03683_91452_c1 nmdc:mga03683_91452_c1_177_563 121
313 3300050494 nmdc:mga06z11_160277_c1 nmdc:mga06z11_160277_c1_301_687 121
314 3300053093 Ga0500651_0592690 Ga0500651_0592690_95_481 121
315 3300053098 Ga0500650_0424029 Ga0500650_0424029_155_541 121
316 3300053130 Ga0500642_0070959 Ga0500642_0070959_1067_1453 121
317 3300005937 Ga0081455_10015320 Ga0081455_1001532010 122
318 3300026095 Ga0207676_10884740 Ga0207676_108847402 122
319 3300004800 Ga0058861_11915385 Ga0058861_119153852 126
320 3300005339 Ga0070660_100515655 Ga0070660_1005156552 126
321 3300005535 Ga0070684_100597188 Ga0070684_1005971883 126
322 3300005539 Ga0068853_100008821 Ga0068853_10000882112 126
323 3300005563 Ga0068855_100072053 Ga0068855_1000720536 126
324 3300005564 Ga0070664_100823932 Ga0070664_1008239322 126
325 3300025912 Ga0207707_10097582 Ga0207707_100975823 126
326 3300025949 Ga0207667_10106069 Ga0207667_101060693 126
327 3300026041 Ga0207639_10052068 Ga0207639_100520684 126
328 3300026116 Ga0207674_10032531 Ga0207674_100325311 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

11

117

0.98

PF01230

HIT

HIT domain

19

115

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5waa-assembly1.cif.gz_B human histidine triad nucleotide binding protein 1 (hhint1) c84r mutant 0.9675 11 115
1kpc-assembly1.cif.gz_B pkci-1-apo+zinc 0.9661 13 115
5km6-assembly1.cif.gz_A-2 human histidine triad nucleotide binding protein 1 (hhint1) h112n mutant ara-a nucleoside phosphoramidate substrate complex 0.9656 13 115
3o1z-assembly1.cif.gz_A-2 high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) double cysteine mutant from rabbit 0.9655 11 115
6ypr-assembly1.cif.gz_AAA-2 human histidine triad nucleotide-binding protein 2 (hhint2) refined to 1.26 a in h32 space group 0.9632 27 115
ID Description Score Start End Superfamily
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9661 13 115 3.30.428.10
4njyA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9631 26 115 3.30.428.10
4eguB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9422 7 118 3.30.428.10
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.937 8 121 3.30.428.10
af_Q0DA95_1_91_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9354 34 120 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A1F3ZBB0-F1-model_v4 Histidine triad nucleotide-binding protein 0.9928 7 123 GO:0003824
AF-A0A2W5IG94-F1-model_v4 deleted 0.9899 11 125
AF-A0A084XZT4-F1-model_v4 HIT-like protein (EC 3.-.-.-) 0.9882 11 123 GO:0016787
AF-A0A1W9GZF2-F1-model_v4 Histidine triad nucleotide-binding protein 0.9881 11 123 GO:0003824
AF-A0A536SZ33-F1-model_v4 Histidine triad nucleotide-binding protein 0.988 11 125 GO:0003824

Feature Viewer

pLDDT pTM Quality
92.96 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map