F409027

General Info

Members Datasets Scaffolds Average Seq Length
327 211 654 323

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2984551494|2984551997
Length 365
Sequence TVPPVSAVTPLARCAGTGGWGPPPVRRRAGSQAVASCIESVTRLRRSATNGRGYHRVRSGRGFSYRDPDGTTVTDAAVRQRLEDLVIPPAWDDVWISPYENGHILATGIDGAGRRQYMYHPSWRERMDRIKYDRALALAESLPVARRGVTMDLRRPEPDRQRALAAAFRMLDQGSLRVGSERYATEHGSRGLSTLLCAHAHVSGDDIELDFPGKSGQEWSSSIHDPDLAIVIAGMKRRGPNARLLSFRARRGAEWEPLSAEDINEYVKERAGDEFTAKDFRTLHGTVAAAVDLAATGPQSSVTKRKKAVSHAVKVASEELGNTPTVCRQSYIDPRLLDAYDHGETIDPDRMHAAESEVRALLYRQ

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
14 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
15 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
23 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
37 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
40 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
43 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
44 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
48 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
49 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
50 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
51 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
54 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
55 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
56 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
57 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
58 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
59 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
60 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
61 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
62 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
65 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
66 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
67 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
68 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
73 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
74 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
75 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
76 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
77 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
78 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
79 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
80 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
81 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
82 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
85 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
86 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
87 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
90 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
91 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
92 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
107 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
110 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
135 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
136 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
137 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
138 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
139 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
140 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
141 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
144 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
145 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
146 2643221553 Microbacterium sp. Root553 Isolate Unclassified
147 2643221630 Microbacterium sp. Root322 Isolate Unclassified
148 2643221649 Leifsonia sp. Root4 Isolate Unclassified
149 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
150 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
151 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
152 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
153 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
154 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
155 2773857759 Microbacterium sp. 1294 Isolate Unclassified
156 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
157 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
158 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
159 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
160 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
161 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
162 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
163 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
164 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
165 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
166 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
167 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
168 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
169 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
170 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
171 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
172 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
173 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
174 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
175 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
176 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
177 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
178 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
179 2919069694 Microbacterium sp. 1154 Isolate Unclassified
180 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
181 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
182 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
183 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
184 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
185 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
186 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
187 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
188 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
189 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
190 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
191 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
192 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
193 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
194 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
195 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
196 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
197 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
198 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
199 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
200 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
201 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
202 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
203 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
204 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
205 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
206 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
207 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
208 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
209 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
210 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
211 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.2
Metatranscriptomes 0
Isolates 20.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 7.95
Nodule 0
Rhizoplane 6.42
Rhizosphere 63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001389 3300000549 Bacteria 3623
2 LJQas_1001982 3300000549 Bacteria 2953
3 JGI25154J39366_1001181 3300002738 Bacteria 9987
4 Ga0065714_10010943 3300005288 Bacteria 3486
5 Ga0070658_10000034 3300005327 Bacteria 146880
6 Ga0070676_10015218 3300005328 Bacteria 4242
7 Ga0070670_100371159 3300005331 Bacteria 1259
8 Ga0070668_100173745 3300005347 Bacteria 1755
9 Ga0070673_100035750 3300005364 Bacteria 3769
10 Ga0070659_100047483 3300005366 Bacteria 3368
11 Ga0070678_100037692 3300005456 Bacteria 3397
12 Ga0070672_100115679 3300005543 Bacteria 2190
13 Ga0075365_10022284 3300006038 Bacteria 3967
14 Ga0075365_10213535 3300006038 Bacteria 1353
15 Ga0075432_10001664 3300006058 Bacteria 7316
16 Ga0075432_10063510 3300006058 Bacteria 1318
17 Ga0105251_10007630 3300009011 Bacteria 6625
18 Ga0105242_10177310 3300009176 Bacteria 1878
19 Ga0105248_10139066 3300009177 Bacteria 2739
20 Ga0157373_10012930 3300013100 Bacteria 6128
21 Ga0157370_10081609 3300013104 Bacteria 3042
22 Ga0157369_10002060 3300013105 Bacteria 24257
23 Ga0157369_10006838 3300013105 Bacteria 13157
24 Ga0163162_10082614 3300013306 Bacteria 3285
25 Ga0157375_10044656 3300013308 Bacteria 4307
26 Ga0209646_1000168 3300025246 Bacteria 86352
27 Ga0209148_1004244 3300025254 Bacteria 3583
28 Ga0207697_10000796 3300025315 Bacteria 17885
29 Ga0207682_10007610 3300025893 Bacteria 4310
30 Ga0207680_10015678 3300025903 Bacteria 3962
31 Ga0207645_10005194 3300025907 Bacteria 9506
32 Ga0207705_10000001 3300025909 Bacteria 2061880
33 Ga0207709_10073666 3300025935 Bacteria 2177
34 Ga0207669_10049893 3300025937 Bacteria 2498
35 Ga0207711_10082308 3300025941 Bacteria 2813
36 Ga0207668_10250971 3300025972 Bacteria 1437
37 Ga0207658_10239143 3300025986 Bacteria 1537
38 Ga0207678_10087998 3300026067 Bacteria 2655
39 Ga0207683_10002047 3300026121 Bacteria 17847
40 Ga0207428_10021782 3300027907 Bacteria 5422
41 Ga0307515_10096493 3300028794 Bacteria 3625
42 Ga0307515_10358784 3300028794 Bacteria 1100
43 Ga0307408_100001166 3300031548 Bacteria 19960
44 Ga0307408_100012412 3300031548 Bacteria 5643
45 Ga0307408_100041843 3300031548 Bacteria 3250
46 Ga0307405_10027043 3300031731 Bacteria 3320
47 Ga0307405_10029301 3300031731 Bacteria 3216
48 Ga0307405_10063310 3300031731 Bacteria 2345
49 Ga0307413_10047881 3300031824 Bacteria 2552
50 Ga0307413_10094856 3300031824 Bacteria 1954
51 Ga0307413_10246029 3300031824 Bacteria 1323
52 Ga0307410_10011187 3300031852 Bacteria 5120
53 Ga0307410_10011610 3300031852 Bacteria 5046
54 Ga0307410_10025828 3300031852 Bacteria 3689
55 Ga0307410_10070961 3300031852 Bacteria 2414
56 Ga0307406_10001639 3300031901 Bacteria 12304
57 Ga0307406_10412729 3300031901 Bacteria 1073
58 Ga0307407_10024657 3300031903 Bacteria 3158
59 Ga0307407_10038194 3300031903 Bacteria 2659
60 Ga0307412_10000576 3300031911 Bacteria 21799
61 Ga0307412_10018716 3300031911 Bacteria 4175
62 Ga0307412_10047755 3300031911 Bacteria 2812
63 Ga0307412_10117896 3300031911 Bacteria 1906
64 Ga0307412_10238285 3300031911 Bacteria 1405
65 Ga0307409_100000390 3300031995 Bacteria 18601
66 Ga0307409_100077634 3300031995 Bacteria 2668
67 Ga0307409_100133563 3300031995 Bacteria 2125
68 Ga0307416_100007429 3300032002 Bacteria 6970
69 Ga0307416_100071445 3300032002 Bacteria 2883
70 Ga0307416_100169242 3300032002 Bacteria 2031
71 Ga0307416_100170260 3300032002 Bacteria 2026
72 Ga0307416_100180575 3300032002 Bacteria 1977
73 Ga0307416_100186640 3300032002 Bacteria 1950
74 Ga0307416_100220493 3300032002 Bacteria 1818
75 Ga0307414_10009567 3300032004 Bacteria 5578
76 Ga0307414_10037191 3300032004 Bacteria 3257
77 Ga0307414_10110928 3300032004 Bacteria 2088
78 Ga0307411_10064327 3300032005 Bacteria 2455
79 Ga0307415_100095279 3300032126 Bacteria 2166
80 Ga0307415_100180735 3300032126 Bacteria 1655
81 Ga0395900_0061306 3300037418 Bacteria 3867
82 Ga0395900_0140512 3300037418 Bacteria 2473
83 Ga0395898_0033035 3300037466 Bacteria 5165
84 Ga0395901_0081580 3300038443 Bacteria 3378
85 Ga0439466_0067639 3300041411 Bacteria 1142
86 Ga0451793_0488128 3300041452 Bacteria 1165
87 Ga0451806_167190 3300041462 Bacteria 1388
88 Ga0439433_0003180 3300041999 Bacteria 3519
89 Ga0439442_000400 3300042002 Bacteria 10185
90 Ga0439442_000801 3300042002 Bacteria 6525
91 Ga0439442_004070 3300042002 Bacteria 2899
92 Ga0439442_008859 3300042002 Bacteria 2032
93 Ga0439449_0004242 3300042007 Bacteria 5541
94 Ga0439449_0024092 3300042007 Bacteria 2276
95 Ga0450920_004643 3300042122 Bacteria 2421
96 Ga0450920_008195 3300042122 Bacteria 1906
97 Ga0450907_001723 3300042146 Bacteria 4547
98 Ga0450907_018696 3300042146 Bacteria 1160
99 Ga0439434_0000125 3300042435 Bacteria 20489
100 Ga0466965_0000003 3300044683 Bacteria 265985
101 Ga0466970_0092319 3300044765 Bacteria 1644
102 Ga0495627_001196 3300046453 Bacteria 16379
103 Ga0495590_0000196 3300046457 Bacteria 34096
104 Ga0495653_0012109 3300046463 Bacteria 7038
105 Ga0495582_0035427 3300046473 Bacteria 2745
106 Ga0495639_0029517 3300046475 Bacteria 2434
107 Ga0495662_0018938 3300046476 Bacteria 3332
108 Ga0495594_0026972 3300046499 Bacteria 3094
109 Ga0495630_0256558 3300046517 Bacteria 1336
110 Ga0495642_0019103 3300046528 Bacteria 2684
111 Ga0495665_0000383 3300046531 Bacteria 22400
112 Ga0495586_0005813 3300046535 Bacteria 6594
113 Ga0495586_0012637 3300046535 Bacteria 4477
114 Ga0495587_0000688 3300046536 Bacteria 22715
115 Ga0495645_0020204 3300046543 Bacteria 4802
116 Ga0495633_0060376 3300046558 Bacteria 1777
117 Ga0495667_0000988 3300046559 Bacteria 18401
118 Ga0495668_0126884 3300046616 Bacteria 1397
119 Ga0495588_0069488 3300046674 Bacteria 1830
120 Ga0495588_0070253 3300046674 Bacteria 1820
121 Ga0495657_0005450 3300046675 Bacteria 10077
122 Ga0495670_0055271 3300046691 Bacteria 1990
123 Ga0495670_0060430 3300046691 Bacteria 1904
124 Ga0495600_0006179 3300046809 Bacteria 7264
125 Ga0495600_0064373 3300046809 Bacteria 2397
126 Ga0495581_0001144 3300047315 Bacteria 14505
127 Ga0495581_0036489 3300047315 Bacteria 2844
128 Ga0495675_0006965 3300047444 Bacteria 6949
129 Ga0495677_0079093 3300047445 Bacteria 1231
130 Ga0495681_0115475 3300047470 Bacteria 1158
131 Ga0495684_0143568 3300047471 Bacteria 1789
132 Ga0495686_0042238 3300047472 Bacteria 2901
133 Ga0495686_0160168 3300047472 Bacteria 1316
134 Ga0495593_0013775 3300047673 Bacteria 4606
135 Ga0495615_0022861 3300048090 Bacteria 1427
136 Ga0495626_0044431 3300048091 Bacteria 2079
137 Ga0496100_0212801 3300048903 Bacteria 1414
138 Ga0496101_0021095 3300048904 Bacteria 4471
139 Ga0496101_0128602 3300048904 Bacteria 1921
140 Ga0496102_0212347 3300048905 Bacteria 1824
141 Ga0496102_0286490 3300048905 Bacteria 1552
142 Ga0496103_0002175 3300048906 Bacteria 12451
143 Ga0496103_0053445 3300048906 Bacteria 2503
144 Ga0496106_0003494 3300048909 Bacteria 11706
145 Ga0496106_0187420 3300048909 Bacteria 1644
146 Ga0496107_0007033 3300048910 Bacteria 7752
147 Ga0496107_0091078 3300048910 Bacteria 2228
148 Ga0496108_0048174 3300048911 Bacteria 3562
149 Ga0496109_0024512 3300048912 Bacteria 5364
150 Ga0496109_0279027 3300048912 Bacteria 1575
151 Ga0496109_0395002 3300048912 Bacteria 1306
152 Ga0496110_0046999 3300048913 Bacteria 3777
153 Ga0496111_0008286 3300048914 Bacteria 6873
154 Ga0496111_0514812 3300048914 Bacteria 880
155 Ga0496114_0025108 3300048917 Bacteria 4868
156 Ga0496117_0001098 3300048920 Bacteria 40887
157 Ga0496117_0010175 3300048920 Bacteria 8627
158 Ga0496117_0047077 3300048920 Bacteria 3096
159 Ga0496118_0000116 3300048921 Bacteria 145054
160 Ga0496119_0005657 3300048922 Bacteria 11864
161 Ga0496119_0006205 3300048922 Bacteria 11177
162 Ga0496120_0011067 3300048923 Bacteria 6226
163 Ga0496120_0011855 3300048923 Bacteria 5965
164 Ga0496120_0103764 3300048923 Bacteria 1497
165 Ga0496121_0000497 3300048924 Bacteria 75061
166 Ga0496121_0176159 3300048924 Bacteria 1548
167 Ga0496122_0005147 3300048925 Bacteria 15769
168 Ga0496122_0007272 3300048925 Bacteria 12379
169 Ga0496122_0018764 3300048925 Bacteria 6362
170 Ga0496122_0039215 3300048925 Bacteria 3780
171 Ga0496122_0099878 3300048925 Bacteria 1944
172 Ga0496123_0005624 3300048926 Bacteria 12519
173 Ga0496123_0019848 3300048926 Bacteria 5277
174 Ga0496123_0066475 3300048926 Bacteria 2283
175 Ga0496123_0103402 3300048926 Bacteria 1650
176 Ga0496124_0000160 3300048927 Bacteria 136959
177 Ga0496124_0013342 3300048927 Bacteria 8029
178 Ga0496124_0066653 3300048927 Bacteria 2997
179 Ga0496124_0068703 3300048927 Bacteria 2944
180 Ga0496124_0174219 3300048927 Bacteria 1662
181 Ga0496125_0002725 3300048928 Bacteria 22449
182 Ga0496125_0004508 3300048928 Bacteria 16017
183 Ga0496125_0025445 3300048928 Bacteria 5418
184 Ga0496125_0061356 3300048928 Bacteria 3015
185 Ga0496125_0065507 3300048928 Bacteria 2878
186 Ga0496125_0153116 3300048928 Bacteria 1580
187 Ga0496126_0002423 3300048929 Bacteria 25250
188 Ga0496126_0011140 3300048929 Bacteria 9336
189 Ga0496126_0019257 3300048929 Bacteria 6726
190 Ga0496126_0033561 3300048929 Bacteria 4827
191 Ga0496126_0375494 3300048929 Bacteria 1158
192 Ga0501032_0014681 3300049569 Bacteria 5545
193 Ga0501032_0050681 3300049569 Bacteria 2799
194 Ga0501032_0107916 3300049569 Bacteria 1843
195 Ga0501032_0250536 3300049569 Bacteria 1150
196 Ga0501033_0004858 3300049570 Bacteria 10708
197 Ga0501033_0072080 3300049570 Bacteria 2537
198 Ga0501034_0000465 3300049571 Bacteria 67251
199 Ga0501034_0005817 3300049571 Bacteria 13410
200 Ga0501034_0012006 3300049571 Bacteria 8952
201 Ga0501034_0056113 3300049571 Bacteria 3964
202 Ga0501034_0263609 3300049571 Bacteria 1665
203 Ga0501034_0295551 3300049571 Bacteria 1557
204 Ga0501034_0306003 3300049571 Bacteria 1525
205 Ga0501034_0521885 3300049571 Bacteria 1099
206 Ga0501036_0073852 3300049572 Bacteria 2883
207 Ga0501037_0036981 3300049573 Bacteria 3598
208 Ga0501037_0043403 3300049573 Bacteria 3304
209 Ga0501037_0118413 3300049573 Bacteria 1905
210 Ga0501037_0224139 3300049573 Bacteria 1322
211 Ga0501038_0007375 3300049574 Bacteria 10145
212 Ga0501038_0012974 3300049574 Bacteria 7602
213 Ga0501038_0066125 3300049574 Bacteria 3079
214 Ga0501038_0072587 3300049574 Bacteria 2916
215 Ga0501038_0144723 3300049574 Bacteria 1941
216 Ga0501039_0101551 3300049575 Bacteria 2245
217 Ga0501039_0274372 3300049575 Bacteria 1325
218 Ga0501043_0023966 3300049579 Bacteria 4788
219 Ga0501043_0053166 3300049579 Bacteria 3180
220 Ga0501043_0093532 3300049579 Bacteria 2363
221 Ga0501046_0246333 3300049580 Bacteria 1317
222 Ga0501047_0059588 3300049581 Bacteria 3685
223 Ga0501047_0242610 3300049581 Bacteria 1652
224 Ga0501067_0050412 3300049583 Bacteria 2307
225 Ga0501068_0034331 3300049584 Bacteria 3025
226 Ga0501069_0056199 3300049585 Bacteria 2192
227 Ga0501069_0182880 3300049585 Bacteria 1212
228 Ga0501070_0000874 3300049586 Bacteria 27417
229 Ga0501070_0006573 3300049586 Bacteria 9895
230 Ga0501070_0075336 3300049586 Bacteria 2794
231 Ga0501070_0270426 3300049586 Bacteria 1388
232 Ga0501073_0000030 3300049589 Bacteria 115949
233 Ga0501080_0000208 3300049742 Bacteria 43436
234 Ga0501080_0010822 3300049742 Bacteria 8345
235 Ga0501083_0146991 3300049744 Bacteria 1543
236 Ga0501044_0021477 3300049823 Bacteria 6884
237 nmdc:mga00v17_20712_c1 3300050491 Bacteria 3771
238 nmdc:mga00v17_28965_c1 3300050491 Bacteria 3247
239 nmdc:mga00v17_58911_c1 3300050491 Bacteria 2354
240 nmdc:mga0yw44_5182_c1 3300050492 Bacteria 5494
241 Ga0500643_001952 3300053087 Bacteria 11184
242 Ga0500556_0000020 3300053104 Bacteria 185929
243 Ga0500556_0000151 3300053104 Bacteria 57882
244 Ga0500593_000975 3300053117 Bacteria 10477
245 Ga0500655_000533 3300053133 Bacteria 7650
246 Ga0500559_0000196 3300053136 Bacteria 48408
247 Ga0500559_0003481 3300053136 Bacteria 7724
248 Ga0500559_0016224 3300053136 Bacteria 3145
249 Ga0500568_0000038 3300053139 Bacteria 134267
250 Ga0500568_0001283 3300053139 Bacteria 16535
251 Ga0500568_0018986 3300053139 Bacteria 2999
252 Ga0500568_0045372 3300053139 Bacteria 1749
253 Ga0500573_0000018 3300053140 Bacteria 177945
254 Ga0500573_0008827 3300053140 Bacteria 5565
255 Ga0500573_0011990 3300053140 Bacteria 4861
256 Ga0500577_0026116 3300053142 Bacteria 1985
257 Ga0500616_0000027 3300053153 Bacteria 441053
258 Ga0500616_0000117 3300053153 Bacteria 145655
259 Ga0500645_021820 3300053730 Bacteria 1974
260 2984551997 2984551494 Bacteria 3877562
261 2643733912 2643221542 Bacteria 3563959
262 2643785497 2643221553 Bacteria 3544260
263 2644170493 2643221630 Bacteria 3601215
264 2644278906 2643221649 Bacteria 3867359
265 2644679912 2643221724 Bacteria 3593515
266 2691514946 2690315906 Bacteria 4517044
267 2730229378 2728369380 Bacteria 3620317
268 2747954179 2747842429 Bacteria 3914386
269 2753303701 2751185788 Bacteria 4541048
270 2774379113 2773857758 Bacteria 3592392
271 2774382589 2773857759 Bacteria 2963774
272 2775655366 2775506735 Bacteria 4556596
273 2808828055 2808606357 Bacteria 4466944
274 2808853412 2808606360 Bacteria 4404006
275 2808878093 2808606366 Bacteria 4415912
276 2808892293 2808606370 Bacteria 4942454
277 2808897405 2808606371 Bacteria 4251511
278 2812320187 2811994871 Bacteria 4497550
279 2844854308 2844852863 Bacteria 3849151
280 2852665028 2852663356 Bacteria 4090475
281 2852680672 2852677369 Bacteria 3768884
282 2857723547 2857723135 Bacteria 4217853
283 2857730234 2857729791 Bacteria 4040535
284 2857738252 2857737099 Bacteria 3104305
285 2862993644 2862993130 Bacteria 3860849
286 2870622880 2870622029 Bacteria 3643329
287 2904432374 2904430863 Bacteria 3486923
288 2904501830 2904501621 Bacteria 3401437
289 2904510565 2904509784 Bacteria 3520416
290 2908676116 2908674828 Bacteria 3382763
291 2908678203 2908678064 Bacteria 3482747
292 2909076593 2909074476 Bacteria 3436050
293 2919040076 2919039151 Bacteria 3391018
294 2919043171 2919042368 Bacteria 3905917
295 2919070511 2919069694 Bacteria 3622919
296 2919392975 2919391150 Bacteria 4884741
297 2928105466 2928104781 Bacteria 3877447
298 2928123456 2928121344 Bacteria 3972376
299 2928501008 2928500415 Bacteria 3384541
300 2939599019 2939598168 Bacteria 4687164
301 2939661059 2939660829 Bacteria 3784848
302 2945917916 2945916053 Bacteria 4555517
303 2945921774 2945920336 Bacteria 4501603
304 2945942003 2945941187 Bacteria 4682474
305 2945960218 2945956166 Bacteria 5110334
306 2946035740 2946033335 Bacteria 3835514
307 2946037980 2946037020 Bacteria 4900426
308 2946043930 2946041624 Bacteria 4191385
309 2946081195 2946080515 Bacteria 4310960
310 2953999259 2953998280 Bacteria 4812144
311 2964328445 2964326757 Bacteria 3290868
312 2966922541 2966921586 Bacteria 3092803
313 2966926517 2966924647 Bacteria 3268643
314 2974295147 2974294766 Bacteria 3767688
315 2974305977 2974302888 Bacteria 4369871
316 2974325049 2974324384 Bacteria 3750535
317 2977230084 2977228692 Bacteria 3450105
318 2977237848 2977236895 Bacteria 3569373
319 2977252773 2977251589 Bacteria 2952848
320 2977265296 2977264416 Bacteria 3750737
321 2984544370 2984542743 Bacteria 3569378
322 8004185384 8004182704 Bacteria 3391155
323 8004214061 8004212874 Bacteria 2861420
324 8016255403 8016254467 Bacteria 3797036
325 8054110748 8054107350 Bacteria 5022511
326 8056039395 8056037122 Bacteria 3854319
327 8057347397 8057345674 Bacteria 4160394
328 LJQas_1001389
329 LJQas_1001982
330 JGI25154J39366_1001181
331 Ga0065714_10010943
332 Ga0070658_10000034
333 Ga0070676_10015218
334 Ga0070670_100371159
335 Ga0070668_100173745
336 Ga0070673_100035750
337 Ga0070659_100047483
338 Ga0070678_100037692
339 Ga0070672_100115679
340 Ga0075365_10022284
341 Ga0075365_10213535
342 Ga0075432_10001664
343 Ga0075432_10063510
344 Ga0105251_10007630
345 Ga0105242_10177310
346 Ga0105248_10139066
347 Ga0157373_10012930
348 Ga0157370_10081609
349 Ga0157369_10002060
350 Ga0157369_10006838
351 Ga0163162_10082614
352 Ga0157375_10044656
353 Ga0209646_1000168
354 Ga0209148_1004244
355 Ga0207697_10000796
356 Ga0207682_10007610
357 Ga0207680_10015678
358 Ga0207645_10005194
359 Ga0207705_10000001
360 Ga0207709_10073666
361 Ga0207669_10049893
362 Ga0207711_10082308
363 Ga0207668_10250971
364 Ga0207658_10239143
365 Ga0207678_10087998
366 Ga0207683_10002047
367 Ga0207428_10021782
368 Ga0307515_10096493
369 Ga0307515_10358784
370 Ga0307408_100001166
371 Ga0307408_100012412
372 Ga0307408_100041843
373 Ga0307405_10027043
374 Ga0307405_10029301
375 Ga0307405_10063310
376 Ga0307413_10047881
377 Ga0307413_10094856
378 Ga0307413_10246029
379 Ga0307410_10011187
380 Ga0307410_10011610
381 Ga0307410_10025828
382 Ga0307410_10070961
383 Ga0307406_10001639
384 Ga0307406_10412729
385 Ga0307407_10024657
386 Ga0307407_10038194
387 Ga0307412_10000576
388 Ga0307412_10018716
389 Ga0307412_10047755
390 Ga0307412_10117896
391 Ga0307412_10238285
392 Ga0307409_100000390
393 Ga0307409_100077634
394 Ga0307409_100133563
395 Ga0307416_100007429
396 Ga0307416_100071445
397 Ga0307416_100169242
398 Ga0307416_100170260
399 Ga0307416_100180575
400 Ga0307416_100186640
401 Ga0307416_100220493
402 Ga0307414_10009567
403 Ga0307414_10037191
404 Ga0307414_10110928
405 Ga0307411_10064327
406 Ga0307415_100095279
407 Ga0307415_100180735
408 Ga0395900_0061306
409 Ga0395900_0140512
410 Ga0395898_0033035
411 Ga0395901_0081580
412 Ga0439466_0067639
413 Ga0451793_0488128
414 Ga0451806_167190
415 Ga0439433_0003180
416 Ga0439442_000400
417 Ga0439442_000801
418 Ga0439442_004070
419 Ga0439442_008859
420 Ga0439449_0004242
421 Ga0439449_0024092
422 Ga0450920_004643
423 Ga0450920_008195
424 Ga0450907_001723
425 Ga0450907_018696
426 Ga0439434_0000125
427 Ga0466965_0000003
428 Ga0466970_0092319
429 Ga0495627_001196
430 Ga0495590_0000196
431 Ga0495653_0012109
432 Ga0495582_0035427
433 Ga0495639_0029517
434 Ga0495662_0018938
435 Ga0495594_0026972
436 Ga0495630_0256558
437 Ga0495642_0019103
438 Ga0495665_0000383
439 Ga0495586_0005813
440 Ga0495586_0012637
441 Ga0495587_0000688
442 Ga0495645_0020204
443 Ga0495633_0060376
444 Ga0495667_0000988
445 Ga0495668_0126884
446 Ga0495588_0069488
447 Ga0495588_0070253
448 Ga0495657_0005450
449 Ga0495670_0055271
450 Ga0495670_0060430
451 Ga0495600_0006179
452 Ga0495600_0064373
453 Ga0495581_0001144
454 Ga0495581_0036489
455 Ga0495675_0006965
456 Ga0495677_0079093
457 Ga0495681_0115475
458 Ga0495684_0143568
459 Ga0495686_0042238
460 Ga0495686_0160168
461 Ga0495593_0013775
462 Ga0495615_0022861
463 Ga0495626_0044431
464 Ga0496100_0212801
465 Ga0496101_0021095
466 Ga0496101_0128602
467 Ga0496102_0212347
468 Ga0496102_0286490
469 Ga0496103_0002175
470 Ga0496103_0053445
471 Ga0496106_0003494
472 Ga0496106_0187420
473 Ga0496107_0007033
474 Ga0496107_0091078
475 Ga0496108_0048174
476 Ga0496109_0024512
477 Ga0496109_0279027
478 Ga0496109_0395002
479 Ga0496110_0046999
480 Ga0496111_0008286
481 Ga0496111_0514812
482 Ga0496114_0025108
483 Ga0496117_0001098
484 Ga0496117_0010175
485 Ga0496117_0047077
486 Ga0496118_0000116
487 Ga0496119_0005657
488 Ga0496119_0006205
489 Ga0496120_0011067
490 Ga0496120_0011855
491 Ga0496120_0103764
492 Ga0496121_0000497
493 Ga0496121_0176159
494 Ga0496122_0005147
495 Ga0496122_0007272
496 Ga0496122_0018764
497 Ga0496122_0039215
498 Ga0496122_0099878
499 Ga0496123_0005624
500 Ga0496123_0019848
501 Ga0496123_0066475
502 Ga0496123_0103402
503 Ga0496124_0000160
504 Ga0496124_0013342
505 Ga0496124_0066653
506 Ga0496124_0068703
507 Ga0496124_0174219
508 Ga0496125_0002725
509 Ga0496125_0004508
510 Ga0496125_0025445
511 Ga0496125_0061356
512 Ga0496125_0065507
513 Ga0496125_0153116
514 Ga0496126_0002423
515 Ga0496126_0011140
516 Ga0496126_0019257
517 Ga0496126_0033561
518 Ga0496126_0375494
519 Ga0501032_0014681
520 Ga0501032_0050681
521 Ga0501032_0107916
522 Ga0501032_0250536
523 Ga0501033_0004858
524 Ga0501033_0072080
525 Ga0501034_0000465
526 Ga0501034_0005817
527 Ga0501034_0012006
528 Ga0501034_0056113
529 Ga0501034_0263609
530 Ga0501034_0295551
531 Ga0501034_0306003
532 Ga0501034_0521885
533 Ga0501036_0073852
534 Ga0501037_0036981
535 Ga0501037_0043403
536 Ga0501037_0118413
537 Ga0501037_0224139
538 Ga0501038_0007375
539 Ga0501038_0012974
540 Ga0501038_0066125
541 Ga0501038_0072587
542 Ga0501038_0144723
543 Ga0501039_0101551
544 Ga0501039_0274372
545 Ga0501043_0023966
546 Ga0501043_0053166
547 Ga0501043_0093532
548 Ga0501046_0246333
549 Ga0501047_0059588
550 Ga0501047_0242610
551 Ga0501067_0050412
552 Ga0501068_0034331
553 Ga0501069_0056199
554 Ga0501069_0182880
555 Ga0501070_0000874
556 Ga0501070_0006573
557 Ga0501070_0075336
558 Ga0501070_0270426
559 Ga0501073_0000030
560 Ga0501080_0000208
561 Ga0501080_0010822
562 Ga0501083_0146991
563 Ga0501044_0021477
564 nmdc:mga00v17_20712_c1
565 nmdc:mga00v17_28965_c1
566 nmdc:mga00v17_58911_c1
567 nmdc:mga0yw44_5182_c1
568 Ga0500643_001952
569 Ga0500556_0000020
570 Ga0500556_0000151
571 Ga0500593_000975
572 Ga0500655_000533
573 Ga0500559_0000196
574 Ga0500559_0003481
575 Ga0500559_0016224
576 Ga0500568_0000038
577 Ga0500568_0001283
578 Ga0500568_0018986
579 Ga0500568_0045372
580 Ga0500573_0000018
581 Ga0500573_0008827
582 Ga0500573_0011990
583 Ga0500577_0026116
584 Ga0500616_0000027
585 Ga0500616_0000117
586 Ga0500645_021820
587 2984551997
588 2643733912
589 2643785497
590 2644170493
591 2644278906
592 2644679912
593 2691514946
594 2730229378
595 2747954179
596 2753303701
597 2774379113
598 2774382589
599 2775655366
600 2808828055
601 2808853412
602 2808878093
603 2808892293
604 2808897405
605 2812320187
606 2844854308
607 2852665028
608 2852680672
609 2857723547
610 2857730234
611 2857738252
612 2862993644
613 2870622880
614 2904432374
615 2904501830
616 2904510565
617 2908676116
618 2908678203
619 2909076593
620 2919040076
621 2919043171
622 2919070511
623 2919392975
624 2928105466
625 2928123456
626 2928501008
627 2939599019
628 2939661059
629 2945917916
630 2945921774
631 2945942003
632 2945960218
633 2946035740
634 2946037980
635 2946043930
636 2946081195
637 2953999259
638 2964328445
639 2966922541
640 2966926517
641 2974295147
642 2974305977
643 2974325049
644 2977230084
645 2977237848
646 2977252773
647 2977265296
648 2984544370
649 8004185384
650 8004214061
651 8016255403
652 8054110748
653 8056039395
654 8057347397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21338

Top1B_N_bact

Bacterial DNA topoisomerase IB, N-terminal domain

62

110

0.99

PF01028

Topoisom_I

Eukaryotic DNA topoisomerase I, catalytic core

120

351

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b9s-assembly1.cif.gz_A crystal structure of heterodimeric l. donovani topoisomerase i-vanadate-dna complex 0.8314 62 280
1a31-assembly1.cif.gz_A human reconstituted dna topoisomerase i in covalent complex with a 22 base pair dna duplex 0.7993 63 297
1ej9-assembly1.cif.gz_A crystal structure of human topoisomerase i dna complex 0.7841 58 313
1rr8-assembly1.cif.gz_C structural mechanisms of camptothecin resistance by mutations in human topoisomerase i 0.7793 58 313
2h7g-assembly1.cif.gz_X structure of variola topoisomerase non-covalently bound to dna 0.7688 13 322
ID Description Score Start End Superfamily
3m4aA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.935 114 226 3.90.15.10
3m4aA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.8898 114 226 3.90.15.10
2f4qA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.8872 114 229 3.90.15.10
2b9sA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.8852 83 280 3.90.15.10
3m4aA01 Alpha Beta;2-Layer Sandwich;Viral Topoisomerase I;DNA topoisomerase I domain 0.8779 36 82 3.30.66.10
ID Description Score Start End GO Terms
AF-A0A4Q3WKX7-F1-model_v4 DNA topoisomerase IB 0.9817 3 88 GO:0016853
AF-A0A3B9W0S2-F1-model_v4 DNA topoisomerase 0.9799 1 111 GO:0016853
AF-A0A2S9YM08-F1-model_v4 DNA topoisomerase IB N-terminal domain-containing protein 0.9773 3 91
AF-A0A7W3PK79-F1-model_v4 DNA topoisomerase (EC 5.6.2.1) 0.972 93 321 GO:0003677
GO:0003917
GO:0006265
AF-A0A356W2I0-F1-model_v4 DNA topoisomerase IB N-terminal domain-containing protein 0.9719 3 85

Map