F408938

General Info

Members Datasets Scaffolds Average Seq Length
327 178 654 195

Family's Representative Sequence

Representative Sequence 3300046683|Ga0495658_0156063|Ga0495658_0156063_403_1029
Length 208
Sequence MGTVHECTGGNEEIDMSLKFRLIMVTAICAIACGMAAAQTNGQPERFTANAVSLSPQYGTGQQTVEINVNRWSPSSDRQTLIAALMKSPDELLKQLQKMRPVGTIRTPDSIGYDLHYAQQTPLPEGGRSIVIATDRPIGFWEATNRPRSIDYPFTVIQMNLDRNGMGSGTMSYATRITTKNNIIELEDFATQPIMLNNVHAEPKKTKS

Samples

Sample ID Description Type Environment
1 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
164 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 0.31
Rhizosphere 98.78
Stem 0
Stem Tuber 0
Unclassified 20.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495658_0156063 3300046683 Bacteria 1405
2 JGI24749J21850_1007212 3300002076 Unclassified 1546
3 rootL2_10379365 3300003322 Bacteria 1758
4 Ga0032354_1020279 3300003693 Bacteria 1063
5 Ga0065715_10019470 3300005293 Bacteria 1681
6 Ga0065707_10105715 3300005295 Bacteria 2632
7 Ga0065707_10108965 3300005295 Bacteria 2487
8 Ga0070676_10001894 3300005328 Bacteria 10633
9 Ga0070676_10010305 3300005328 Bacteria 5069
10 Ga0070683_100994597 3300005329 Bacteria 805
11 Ga0070690_100007109 3300005330 Bacteria 6394
12 Ga0070690_100352567 3300005330 Unclassified 1068
13 Ga0070670_100615156 3300005331 Unclassified 973
14 Ga0070670_100782817 3300005331 Unclassified 861
15 Ga0070677_10005855 3300005333 Bacteria 4071
16 Ga0068869_100007299 3300005334 Bacteria 7046
17 Ga0068869_100016411 3300005334 Bacteria 4991
18 Ga0068869_100028320 3300005334 Bacteria 3914
19 Ga0070666_10005517 3300005335 Bacteria 7761
20 Ga0070666_10288729 3300005335 Bacteria 1167
21 Ga0070680_101096037 3300005336 Unclassified 688
22 Ga0068868_100299774 3300005338 Bacteria 1365
23 Ga0070660_100091551 3300005339 Bacteria 2399
24 Ga0070689_100012007 3300005340 Bacteria 6225
25 Ga0070691_10067566 3300005341 Bacteria 1729
26 Ga0070687_100084616 3300005343 Bacteria 1739
27 Ga0070661_100106938 3300005344 Bacteria 2086
28 Ga0070668_100009383 3300005347 Bacteria 7259
29 Ga0070668_100014554 3300005347 Bacteria 5878
30 Ga0070668_100102622 3300005347 Unclassified 2268
31 Ga0070669_100180788 3300005353 Bacteria 1650
32 Ga0070675_100049840 3300005354 Bacteria 3437
33 Ga0070675_100055496 3300005354 Bacteria 3261
34 Ga0070675_100143840 3300005354 Bacteria 2040
35 Ga0070675_100451761 3300005354 Unclassified 1153
36 Ga0070671_100026464 3300005355 Bacteria 4767
37 Ga0070673_100009640 3300005364 Bacteria 6493
38 Ga0070673_100024110 3300005364 Bacteria 4455
39 Ga0070673_100132537 3300005364 Unclassified 2093
40 Ga0070688_100025020 3300005365 Bacteria 3530
41 Ga0070659_100043494 3300005366 Bacteria 3513
42 Ga0070667_100020030 3300005367 Bacteria 5553
43 Ga0070701_10259311 3300005438 Bacteria 1053
44 Ga0070705_100085045 3300005440 Bacteria 1954
45 Ga0070700_100001612 3300005441 Bacteria 11252
46 Ga0070700_100004539 3300005441 Bacteria 7261
47 Ga0070700_100124616 3300005441 Unclassified 1731
48 Ga0070700_100144030 3300005441 Bacteria 1622
49 Ga0070700_100196608 3300005441 Bacteria 1414
50 Ga0070694_100063722 3300005444 Unclassified 2521
51 Ga0070694_100706351 3300005444 Unclassified 820
52 Ga0070708_100296930 3300005445 Unclassified 1521
53 Ga0070708_100333088 3300005445 Unclassified 1430
54 Ga0070663_100165142 3300005455 Bacteria 1707
55 Ga0070678_100014164 3300005456 Bacteria 5022
56 Ga0070662_100020875 3300005457 Bacteria 4467
57 Ga0070662_100158849 3300005457 Unclassified 1767
58 Ga0070662_100684763 3300005457 Bacteria 866
59 Ga0068867_100016414 3300005459 Bacteria 5257
60 Ga0068867_100024631 3300005459 Bacteria 4313
61 Ga0068867_100627789 3300005459 Unclassified 940
62 Ga0070706_100207875 3300005467 Bacteria 1828
63 Ga0070707_100036724 3300005468 Bacteria 4676
64 Ga0070698_100003010 3300005471 Bacteria 18556
65 Ga0070698_100407878 3300005471 Unclassified 1293
66 Ga0070699_100003110 3300005518 Bacteria 14684
67 Ga0070672_100072941 3300005543 Bacteria 2735
68 Ga0070672_100256414 3300005543 Bacteria 1474
69 Ga0070686_100013349 3300005544 Bacteria 4700
70 Ga0070695_100012521 3300005545 Bacteria 5091
71 Ga0070696_100003376 3300005546 Bacteria 10652
72 Ga0070696_100031065 3300005546 Bacteria 3659
73 Ga0070665_101086778 3300005548 Viruses 811
74 Ga0070704_100123699 3300005549 Bacteria 1992
75 Ga0070704_100138290 3300005549 Unclassified 1898
76 Ga0070704_100261328 3300005549 Unclassified 1426
77 Ga0070704_100671597 3300005549 Unclassified 916
78 Ga0070664_100010017 3300005564 Bacteria 7681
79 Ga0070664_100214879 3300005564 Bacteria 1719
80 Ga0070664_100362555 3300005564 Bacteria 1320
81 Ga0068857_100145628 3300005577 Bacteria 2143
82 Ga0068857_100648134 3300005577 Bacteria 1001
83 Ga0070702_100002065 3300005615 Bacteria 8502
84 Ga0070702_100071764 3300005615 Bacteria 2047
85 Ga0068852_100046797 3300005616 Bacteria 3687
86 Ga0068859_100056740 3300005617 Bacteria 3943
87 Ga0068859_100304365 3300005617 Bacteria 1687
88 Ga0068864_100435415 3300005618 Bacteria 1252
89 Ga0068864_101260616 3300005618 Bacteria 739
90 Ga0068861_100003768 3300005719 Bacteria 10122
91 Ga0068861_100206014 3300005719 Bacteria 1654
92 Ga0068861_100209085 3300005719 Bacteria 1642
93 Ga0068861_100256848 3300005719 Bacteria 1494
94 Ga0068861_100263758 3300005719 Bacteria 1476
95 Ga0068861_100387486 3300005719 Unclassified 1236
96 Ga0068870_10000317 3300005840 Bacteria 17849
97 Ga0068870_10068782 3300005840 Bacteria 1925
98 Ga0068863_100064676 3300005841 Bacteria 3459
99 Ga0068858_100014529 3300005842 Bacteria 7418
100 Ga0068860_100038166 3300005843 Bacteria 4595
101 Ga0068862_100051562 3300005844 Bacteria 3519
102 Ga0068862_100132627 3300005844 Bacteria 2205
103 Ga0068862_100400580 3300005844 Bacteria 1284
104 Ga0075432_10030666 3300006058 Unclassified 1859
105 Ga0075432_10057086 3300006058 Bacteria 1385
106 Ga0075427_10007024 3300006194 Bacteria 1648
107 Ga0068871_100484181 3300006358 Bacteria 1113
108 Ga0075428_100027163 3300006844 Bacteria 6337
109 Ga0075428_100344637 3300006844 Unclassified 1599
110 Ga0075428_100660035 3300006844 Bacteria 1115
111 Ga0075428_100954623 3300006844 Unclassified 908
112 Ga0075430_100011432 3300006846 Bacteria 7538
113 Ga0075430_100040121 3300006846 Bacteria 3963
114 Ga0075430_100070093 3300006846 Bacteria 2940
115 Ga0075430_100096026 3300006846 Unclassified 2477
116 Ga0075430_100098876 3300006846 Bacteria 2437
117 Ga0075430_100194153 3300006846 Unclassified 1687
118 Ga0075430_100847805 3300006846 Unclassified 753
119 Ga0075431_100011669 3300006847 Bacteria 8865
120 Ga0075431_100121076 3300006847 Bacteria 2700
121 Ga0075431_100248184 3300006847 Unclassified 1809
122 Ga0075433_10047396 3300006852 Bacteria 3738
123 Ga0075433_10133978 3300006852 Bacteria 2202
124 Ga0075433_10543780 3300006852 Bacteria 1021
125 Ga0075434_100003349 3300006871 Bacteria 14338
126 Ga0075434_100005431 3300006871 Bacteria 11605
127 Ga0075434_100014640 3300006871 Bacteria 7502
128 Ga0075429_100004166 3300006880 Bacteria 12375
129 Ga0075429_100014557 3300006880 Bacteria 6816
130 Ga0075429_100023042 3300006880 Bacteria 5397
131 Ga0075429_100144364 3300006880 Unclassified 2083
132 Ga0075429_100145484 3300006880 Unclassified 2075
133 Ga0075429_100349371 3300006880 Bacteria 1295
134 Ga0075429_100685160 3300006880 Unclassified 898
135 Ga0068865_100136425 3300006881 Bacteria 1845
136 Ga0097620_100056740 3300006931 Bacteria 3943
137 Ga0097620_100304360 3300006931 Bacteria 1687
138 Ga0075435_100012978 3300007076 Bacteria 6182
139 Ga0075435_100126159 3300007076 Bacteria 2139
140 Ga0105251_10240388 3300009011 Unclassified 816
141 Ga0111539_10010155 3300009094 Bacteria 11865
142 Ga0111539_10011193 3300009094 Bacteria 11275
143 Ga0111539_10047512 3300009094 Bacteria 5129
144 Ga0111539_10212561 3300009094 Unclassified 2253
145 Ga0111539_11082759 3300009094 Bacteria 931
146 Ga0111539_11437090 3300009094 Bacteria 800
147 Ga0111539_11594169 3300009094 Unclassified 757
148 Ga0105247_10134566 3300009101 Bacteria 1614
149 Ga0114129_10007946 3300009147 Bacteria 15099
150 Ga0114129_10015653 3300009147 Bacteria 10786
151 Ga0114129_10040044 3300009147 Bacteria 6609
152 Ga0114129_10126781 3300009147 Unclassified 3509
153 Ga0114129_10329542 3300009147 Unclassified 2027
154 Ga0114129_10395541 3300009147 Bacteria 1822
155 Ga0114129_10495218 3300009147 Bacteria 1597
156 Ga0105243_10051225 3300009148 Bacteria 3265
157 Ga0105248_10113580 3300009177 Bacteria 3055
158 Ga0157375_10232968 3300013308 Bacteria 2000
159 Ga0163163_10043292 3300014325 Bacteria 4413
160 Ga0157380_10097584 3300014326 Bacteria 2439
161 Ga0157380_10112480 3300014326 Bacteria 2291
162 Ga0157380_10671324 3300014326 Bacteria 1037
163 Ga0157379_10072266 3300014968 Bacteria 3086
164 Ga0157376_11062486 3300014969 Viruses 834
165 Ga0163161_10002658 3300017792 Bacteria 12701
166 Ga0206350_11521541 3300020080 Bacteria 1642
167 Ga0224712_10102326 3300022467 Bacteria 1217
168 Ga0207673_1007481 3300025290 Bacteria 1371
169 Ga0207697_10000530 3300025315 Bacteria 21540
170 Ga0207682_10000349 3300025893 Bacteria 21134
171 Ga0207682_10074163 3300025893 Bacteria 1446
172 Ga0207710_10072553 3300025900 Bacteria 1581
173 Ga0207688_10000951 3300025901 Bacteria 14699
174 Ga0207680_10227403 3300025903 Unclassified 1281
175 Ga0207680_10508214 3300025903 Bacteria 859
176 Ga0207645_10000777 3300025907 Bacteria 26632
177 Ga0207645_10003785 3300025907 Bacteria 11363
178 Ga0207643_10001670 3300025908 Bacteria 12449
179 Ga0207643_10058885 3300025908 Bacteria 2191
180 Ga0207684_10887029 3300025910 Bacteria 750
181 Ga0207662_10001557 3300025918 Bacteria 11201
182 Ga0207662_10291395 3300025918 Bacteria 1083
183 Ga0207649_10081490 3300025920 Bacteria 2096
184 Ga0207646_10025792 3300025922 Bacteria 5374
185 Ga0207681_10027696 3300025923 Bacteria 3666
186 Ga0207681_10179027 3300025923 Bacteria 1613
187 Ga0207681_10840676 3300025923 Bacteria 768
188 Ga0207659_10016446 3300025926 Bacteria 4815
189 Ga0207659_10016813 3300025926 Bacteria 4769
190 Ga0207659_10120840 3300025926 Bacteria 2007
191 Ga0207659_10318857 3300025926 Unclassified 1282
192 Ga0207700_10174548 3300025928 Unclassified 1795
193 Ga0207644_10015697 3300025931 Bacteria 5089
194 Ga0207690_10238507 3300025932 Bacteria 1399
195 Ga0207706_10004701 3300025933 Bacteria 12792
196 Ga0207706_10253308 3300025933 Bacteria 1537
197 Ga0207706_10303292 3300025933 Unclassified 1391
198 Ga0207670_10042716 3300025936 Bacteria 2989
199 Ga0207670_10166776 3300025936 Bacteria 1648
200 Ga0207669_10395627 3300025937 Bacteria 1081
201 Ga0207704_10262614 3300025938 Bacteria 1303
202 Ga0207691_10015583 3300025940 Bacteria 7227
203 Ga0207711_10219859 3300025941 Bacteria 1737
204 Ga0207689_10003093 3300025942 Bacteria 15311
205 Ga0207689_10011216 3300025942 Bacteria 7690
206 Ga0207689_10032076 3300025942 Bacteria 4371
207 Ga0207661_10920468 3300025944 Bacteria 805
208 Ga0207679_10010360 3300025945 Bacteria 5999
209 Ga0207679_10235288 3300025945 Bacteria 1549
210 Ga0207679_10396831 3300025945 Bacteria 1213
211 Ga0207651_10008725 3300025960 Bacteria 5496
212 Ga0207651_10189219 3300025960 Unclassified 1640
213 Ga0207651_10217388 3300025960 Bacteria 1542
214 Ga0207651_10592123 3300025960 Bacteria 968
215 Ga0207712_10012248 3300025961 Bacteria 5479
216 Ga0207668_10034677 3300025972 Unclassified 3353
217 Ga0207658_10628657 3300025986 Bacteria 966
218 Ga0207703_10164913 3300026035 Unclassified 1943
219 Ga0207708_10000929 3300026075 Bacteria 21955
220 Ga0207708_10003754 3300026075 Bacteria 11192
221 Ga0207708_10070267 3300026075 Bacteria 2681
222 Ga0207708_10129943 3300026075 Unclassified 1969
223 Ga0207641_10019961 3300026088 Bacteria 5500
224 Ga0207648_10008765 3300026089 Bacteria 9748
225 Ga0207648_10020569 3300026089 Bacteria 5941
226 Ga0207648_10414237 3300026089 Bacteria 1223
227 Ga0207648_10425734 3300026089 Bacteria 1206
228 Ga0207676_10373550 3300026095 Bacteria 1325
229 Ga0207676_10497556 3300026095 Bacteria 1157
230 Ga0207674_10191426 3300026116 Unclassified 1995
231 Ga0207675_100002731 3300026118 Bacteria 17370
232 Ga0207675_100018785 3300026118 Bacteria 6451
233 Ga0207675_100019064 3300026118 Bacteria 6404
234 Ga0207675_100083336 3300026118 Unclassified 2999
235 Ga0207675_100466157 3300026118 Unclassified 1254
236 Ga0207683_10008765 3300026121 Bacteria 8636
237 Ga0207698_10151707 3300026142 Bacteria 2012
238 Ga0207428_10000319 3300027907 Bacteria 62926
239 Ga0207428_10007941 3300027907 Bacteria 9639
240 Ga0207428_10134964 3300027907 Bacteria 1887
241 Ga0207428_10189761 3300027907 Unclassified 1550
242 Ga0207428_10234794 3300027907 Unclassified 1371
243 Ga0268266_11473659 3300028379 Viruses 656
244 Ga0268265_10052960 3300028380 Bacteria 3072
245 Ga0268265_10166577 3300028380 Bacteria 1879
246 Ga0268265_10306651 3300028380 Unclassified 1432
247 Ga0268265_10358564 3300028380 Bacteria 1334
248 Ga0268265_11616287 3300028380 Unclassified 653
249 Ga0307408_100322274 3300031548 Bacteria 1302
250 Ga0307508_10241935 3300031616 Bacteria 1402
251 Ga0307413_10156582 3300031824 Bacteria 1595
252 Ga0307413_10196852 3300031824 Bacteria 1452
253 Ga0307410_10036746 3300031852 Bacteria 3193
254 Ga0307410_10147957 3300031852 Bacteria 1745
255 Ga0307410_10201372 3300031852 Bacteria 1520
256 Ga0307406_10189631 3300031901 Bacteria 1504
257 Ga0307407_10116720 3300031903 Bacteria 1685
258 Ga0307412_10071339 3300031911 Bacteria 2371
259 Ga0307409_100005596 3300031995 Bacteria 7267
260 Ga0307416_100182259 3300032002 Bacteria 1969
261 Ga0307414_10094276 3300032004 Bacteria 2234
262 Ga0307411_10338711 3300032005 Bacteria 1221
263 Ga0307415_100027639 3300032126 Bacteria 3597
264 Ga0373935_0089203 3300035692 Unclassified 2016
265 Ga0373933_0134303 3300035724 Bacteria 1558
266 Ga0373937_0105686 3300036401 Unclassified 2616
267 Ga0373925_0315520 3300037068 Bacteria 1264
268 Ga0439439_0043130 3300041406 Bacteria 1173
269 Ga0451577_0127960 3300042876 Bacteria 2277
270 Ga0439440_0098473 3300042993 Unclassified 793
271 Ga0451576_0012741 3300045051 Bacteria 9439
272 Ga0451576_0049852 3300045051 Bacteria 4394
273 Ga0495603_0062305 3300046455 Bacteria 2202
274 Ga0495580_0433844 3300046472 Bacteria 883
275 Ga0495594_0074101 3300046499 Bacteria 1896
276 Ga0495621_0039698 3300046539 Unclassified 1647
277 Ga0495656_0034084 3300046615 Bacteria 2082
278 Ga0495588_0022843 3300046674 Bacteria 3093
279 Ga0495588_0291938 3300046674 Bacteria 859
280 Ga0495669_0060605 3300046684 Bacteria 1711
281 Ga0495636_0084501 3300047318 Unclassified 1371
282 Ga0495675_0249145 3300047444 Bacteria 1067
283 Ga0496113_0115307 3300048916 Bacteria 2096
284 Ga0501298_013979 3300049521 Bacteria 1429
285 Ga0501041_0167496 3300049577 Bacteria 1374
286 Ga0501042_0033440 3300049578 Bacteria 3645
287 Ga0501069_0497336 3300049585 Unclassified 727
288 Ga0501076_0062484 3300049592 Bacteria 2966
289 Ga0501249_018527 3300049679 Bacteria 1507
290 Ga0501245_036135 3300049708 Bacteria 834
291 Ga0501080_0164772 3300049742 Bacteria 2046
292 Ga0501081_0047276 3300049743 Archaea 2961
293 nmdc:mga05p37_22668_c1 3300050507 Bacteria 7616
294 nmdc:mga05p37_23553_c1 3300050507 Bacteria 7471
295 nmdc:mga05p37_370728_c1 3300050507 Bacteria 1680
296 nmdc:mga05p37_384859_c1 3300050507 Bacteria 1642
297 nmdc:mga09592_18625_c1 3300050508 Bacteria 5694
298 nmdc:mga09592_212179_c1 3300050508 Bacteria 1677
299 nmdc:mga09592_234597_c1 3300050508 Unclassified 1589
300 nmdc:mga09592_361989_c1 3300050508 Bacteria 1255
301 nmdc:mga09592_409706_c1 3300050508 Unclassified 1171
302 nmdc:mga09592_418472_c1 3300050508 Bacteria 1158
303 nmdc:mga09592_47848_c1 3300050508 Bacteria 3605
304 nmdc:mga09592_489897_c1 3300050508 Bacteria 1059
305 nmdc:mga09592_504701_c1 3300050508 Unclassified 1041
306 nmdc:mga0qj67_283066_c1 3300050509 Bacteria 1344
307 nmdc:mga0qj67_378247_c1 3300050509 Bacteria 1144
308 nmdc:mga0qj67_41730_c1 3300050509 Unclassified 3610
309 nmdc:mga0qj67_42883_c1 3300050509 Bacteria 3562
310 nmdc:mga0qj67_65423_c1 3300050509 Bacteria 2894
311 nmdc:mga06r32_121762_c1 3300050510 Bacteria 2574
312 nmdc:mga06r32_184219_c1 3300050510 Unclassified 2074
313 nmdc:mga06r32_254611_c1 3300050510 Unclassified 1743
314 nmdc:mga06r32_62926_c1 3300050510 Unclassified 3575
315 nmdc:mga08y16_1069787_c1 3300050511 Bacteria 783
316 nmdc:mga08y16_111582_c1 3300050511 Bacteria 2847
317 nmdc:mga08y16_282538_c1 3300050511 Bacteria 1712
318 nmdc:mga08y16_29566_c1 3300050511 Bacteria 5772
319 nmdc:mga08y16_55771_c1 3300050511 Bacteria 4129
320 nmdc:mga0n895_354090_c1 3300050512 Bacteria 1487
321 nmdc:mga0rr50_427686_c1 3300050513 Bacteria 1121
322 nmdc:mga0a205_193440_c1 3300050515 Unclassified 1925
323 Ga0500593_119248 3300053117 Unclassified 1072
324 Ga0501084_0185799 3300054114 Bacteria 1754
325 Ga0501084_0693388 3300054114 Bacteria 859
326 Ga0590077_005908 3300059426 Bacteria 2506
327 Ga0501082_0481638 3300060353 Unclassified 1085
328 Ga0495658_0156063
329 JGI24749J21850_1007212
330 rootL2_10379365
331 Ga0032354_1020279
332 Ga0065715_10019470
333 Ga0065707_10105715
334 Ga0065707_10108965
335 Ga0070676_10001894
336 Ga0070676_10010305
337 Ga0070683_100994597
338 Ga0070690_100007109
339 Ga0070690_100352567
340 Ga0070670_100615156
341 Ga0070670_100782817
342 Ga0070677_10005855
343 Ga0068869_100007299
344 Ga0068869_100016411
345 Ga0068869_100028320
346 Ga0070666_10005517
347 Ga0070666_10288729
348 Ga0070680_101096037
349 Ga0068868_100299774
350 Ga0070660_100091551
351 Ga0070689_100012007
352 Ga0070691_10067566
353 Ga0070687_100084616
354 Ga0070661_100106938
355 Ga0070668_100009383
356 Ga0070668_100014554
357 Ga0070668_100102622
358 Ga0070669_100180788
359 Ga0070675_100049840
360 Ga0070675_100055496
361 Ga0070675_100143840
362 Ga0070675_100451761
363 Ga0070671_100026464
364 Ga0070673_100009640
365 Ga0070673_100024110
366 Ga0070673_100132537
367 Ga0070688_100025020
368 Ga0070659_100043494
369 Ga0070667_100020030
370 Ga0070701_10259311
371 Ga0070705_100085045
372 Ga0070700_100001612
373 Ga0070700_100004539
374 Ga0070700_100124616
375 Ga0070700_100144030
376 Ga0070700_100196608
377 Ga0070694_100063722
378 Ga0070694_100706351
379 Ga0070708_100296930
380 Ga0070708_100333088
381 Ga0070663_100165142
382 Ga0070678_100014164
383 Ga0070662_100020875
384 Ga0070662_100158849
385 Ga0070662_100684763
386 Ga0068867_100016414
387 Ga0068867_100024631
388 Ga0068867_100627789
389 Ga0070706_100207875
390 Ga0070707_100036724
391 Ga0070698_100003010
392 Ga0070698_100407878
393 Ga0070699_100003110
394 Ga0070672_100072941
395 Ga0070672_100256414
396 Ga0070686_100013349
397 Ga0070695_100012521
398 Ga0070696_100003376
399 Ga0070696_100031065
400 Ga0070665_101086778
401 Ga0070704_100123699
402 Ga0070704_100138290
403 Ga0070704_100261328
404 Ga0070704_100671597
405 Ga0070664_100010017
406 Ga0070664_100214879
407 Ga0070664_100362555
408 Ga0068857_100145628
409 Ga0068857_100648134
410 Ga0070702_100002065
411 Ga0070702_100071764
412 Ga0068852_100046797
413 Ga0068859_100056740
414 Ga0068859_100304365
415 Ga0068864_100435415
416 Ga0068864_101260616
417 Ga0068861_100003768
418 Ga0068861_100206014
419 Ga0068861_100209085
420 Ga0068861_100256848
421 Ga0068861_100263758
422 Ga0068861_100387486
423 Ga0068870_10000317
424 Ga0068870_10068782
425 Ga0068863_100064676
426 Ga0068858_100014529
427 Ga0068860_100038166
428 Ga0068862_100051562
429 Ga0068862_100132627
430 Ga0068862_100400580
431 Ga0075432_10030666
432 Ga0075432_10057086
433 Ga0075427_10007024
434 Ga0068871_100484181
435 Ga0075428_100027163
436 Ga0075428_100344637
437 Ga0075428_100660035
438 Ga0075428_100954623
439 Ga0075430_100011432
440 Ga0075430_100040121
441 Ga0075430_100070093
442 Ga0075430_100096026
443 Ga0075430_100098876
444 Ga0075430_100194153
445 Ga0075430_100847805
446 Ga0075431_100011669
447 Ga0075431_100121076
448 Ga0075431_100248184
449 Ga0075433_10047396
450 Ga0075433_10133978
451 Ga0075433_10543780
452 Ga0075434_100003349
453 Ga0075434_100005431
454 Ga0075434_100014640
455 Ga0075429_100004166
456 Ga0075429_100014557
457 Ga0075429_100023042
458 Ga0075429_100144364
459 Ga0075429_100145484
460 Ga0075429_100349371
461 Ga0075429_100685160
462 Ga0068865_100136425
463 Ga0097620_100056740
464 Ga0097620_100304360
465 Ga0075435_100012978
466 Ga0075435_100126159
467 Ga0105251_10240388
468 Ga0111539_10010155
469 Ga0111539_10011193
470 Ga0111539_10047512
471 Ga0111539_10212561
472 Ga0111539_11082759
473 Ga0111539_11437090
474 Ga0111539_11594169
475 Ga0105247_10134566
476 Ga0114129_10007946
477 Ga0114129_10015653
478 Ga0114129_10040044
479 Ga0114129_10126781
480 Ga0114129_10329542
481 Ga0114129_10395541
482 Ga0114129_10495218
483 Ga0105243_10051225
484 Ga0105248_10113580
485 Ga0157375_10232968
486 Ga0163163_10043292
487 Ga0157380_10097584
488 Ga0157380_10112480
489 Ga0157380_10671324
490 Ga0157379_10072266
491 Ga0157376_11062486
492 Ga0163161_10002658
493 Ga0206350_11521541
494 Ga0224712_10102326
495 Ga0207673_1007481
496 Ga0207697_10000530
497 Ga0207682_10000349
498 Ga0207682_10074163
499 Ga0207710_10072553
500 Ga0207688_10000951
501 Ga0207680_10227403
502 Ga0207680_10508214
503 Ga0207645_10000777
504 Ga0207645_10003785
505 Ga0207643_10001670
506 Ga0207643_10058885
507 Ga0207684_10887029
508 Ga0207662_10001557
509 Ga0207662_10291395
510 Ga0207649_10081490
511 Ga0207646_10025792
512 Ga0207681_10027696
513 Ga0207681_10179027
514 Ga0207681_10840676
515 Ga0207659_10016446
516 Ga0207659_10016813
517 Ga0207659_10120840
518 Ga0207659_10318857
519 Ga0207700_10174548
520 Ga0207644_10015697
521 Ga0207690_10238507
522 Ga0207706_10004701
523 Ga0207706_10253308
524 Ga0207706_10303292
525 Ga0207670_10042716
526 Ga0207670_10166776
527 Ga0207669_10395627
528 Ga0207704_10262614
529 Ga0207691_10015583
530 Ga0207711_10219859
531 Ga0207689_10003093
532 Ga0207689_10011216
533 Ga0207689_10032076
534 Ga0207661_10920468
535 Ga0207679_10010360
536 Ga0207679_10235288
537 Ga0207679_10396831
538 Ga0207651_10008725
539 Ga0207651_10189219
540 Ga0207651_10217388
541 Ga0207651_10592123
542 Ga0207712_10012248
543 Ga0207668_10034677
544 Ga0207658_10628657
545 Ga0207703_10164913
546 Ga0207708_10000929
547 Ga0207708_10003754
548 Ga0207708_10070267
549 Ga0207708_10129943
550 Ga0207641_10019961
551 Ga0207648_10008765
552 Ga0207648_10020569
553 Ga0207648_10414237
554 Ga0207648_10425734
555 Ga0207676_10373550
556 Ga0207676_10497556
557 Ga0207674_10191426
558 Ga0207675_100002731
559 Ga0207675_100018785
560 Ga0207675_100019064
561 Ga0207675_100083336
562 Ga0207675_100466157
563 Ga0207683_10008765
564 Ga0207698_10151707
565 Ga0207428_10000319
566 Ga0207428_10007941
567 Ga0207428_10134964
568 Ga0207428_10189761
569 Ga0207428_10234794
570 Ga0268266_11473659
571 Ga0268265_10052960
572 Ga0268265_10166577
573 Ga0268265_10306651
574 Ga0268265_10358564
575 Ga0268265_11616287
576 Ga0307408_100322274
577 Ga0307508_10241935
578 Ga0307413_10156582
579 Ga0307413_10196852
580 Ga0307410_10036746
581 Ga0307410_10147957
582 Ga0307410_10201372
583 Ga0307406_10189631
584 Ga0307407_10116720
585 Ga0307412_10071339
586 Ga0307409_100005596
587 Ga0307416_100182259
588 Ga0307414_10094276
589 Ga0307411_10338711
590 Ga0307415_100027639
591 Ga0373935_0089203
592 Ga0373933_0134303
593 Ga0373937_0105686
594 Ga0373925_0315520
595 Ga0439439_0043130
596 Ga0451577_0127960
597 Ga0439440_0098473
598 Ga0451576_0012741
599 Ga0451576_0049852
600 Ga0495603_0062305
601 Ga0495580_0433844
602 Ga0495594_0074101
603 Ga0495621_0039698
604 Ga0495656_0034084
605 Ga0495588_0022843
606 Ga0495588_0291938
607 Ga0495669_0060605
608 Ga0495636_0084501
609 Ga0495675_0249145
610 Ga0496113_0115307
611 Ga0501298_013979
612 Ga0501041_0167496
613 Ga0501042_0033440
614 Ga0501069_0497336
615 Ga0501076_0062484
616 Ga0501249_018527
617 Ga0501245_036135
618 Ga0501080_0164772
619 Ga0501081_0047276
620 nmdc:mga05p37_22668_c1
621 nmdc:mga05p37_23553_c1
622 nmdc:mga05p37_370728_c1
623 nmdc:mga05p37_384859_c1
624 nmdc:mga09592_18625_c1
625 nmdc:mga09592_212179_c1
626 nmdc:mga09592_234597_c1
627 nmdc:mga09592_361989_c1
628 nmdc:mga09592_409706_c1
629 nmdc:mga09592_418472_c1
630 nmdc:mga09592_47848_c1
631 nmdc:mga09592_489897_c1
632 nmdc:mga09592_504701_c1
633 nmdc:mga0qj67_283066_c1
634 nmdc:mga0qj67_378247_c1
635 nmdc:mga0qj67_41730_c1
636 nmdc:mga0qj67_42883_c1
637 nmdc:mga0qj67_65423_c1
638 nmdc:mga06r32_121762_c1
639 nmdc:mga06r32_184219_c1
640 nmdc:mga06r32_254611_c1
641 nmdc:mga06r32_62926_c1
642 nmdc:mga08y16_1069787_c1
643 nmdc:mga08y16_111582_c1
644 nmdc:mga08y16_282538_c1
645 nmdc:mga08y16_29566_c1
646 nmdc:mga08y16_55771_c1
647 nmdc:mga0n895_354090_c1
648 nmdc:mga0rr50_427686_c1
649 nmdc:mga0a205_193440_c1
650 Ga0500593_119248
651 Ga0501084_0185799
652 Ga0501084_0693388
653 Ga0590077_005908
654 Ga0501082_0481638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rm3-assembly1.cif.gz_LS0 evolutionary compaction and adaptation visualized by the structure of the dormant microsporidian ribosome 0.6668 30 58
6j8o-assembly1.cif.gz_B structure of a hypothetical protease 0.6238 34 60
6j8n-assembly2.cif.gz_D crystal structure of svbp-vash1 complex, mutation c169a of vash1 0.6205 34 60
6jzc-assembly1.cif.gz_A structural basis of tubulin detyrosination 0.6135 34 64
6jzd-assembly1.cif.gz_A crystal structure of peptide-bound vash2-svbp complex 0.6069 34 64
ID Description Score Start End Superfamily
af_Q18914_218_460_3.90.215.10 Alpha Beta;Alpha-Beta Complex;Gamma Fibrinogen; Chain A, domain 1;Gamma Fibrinogen, chain A, domain 1 0.6315 34 67 3.90.215.10
af_F1QXP0_64_308_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.6093 32 60 3.10.620.30
af_A4I2N2_4_229_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.5987 30 61 3.10.620.30
af_Q58244_1_238_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.5544 37 60 3.10.620.30
4u8uN02 Mainly Beta;Beta Barrel;Lipocalin; 0.5174 32 196 2.40.128.620
ID Description Score Start End GO Terms
AF-A0A2V8ASU3-F1-model_v4 Uncharacterized protein 0.9045 44 196
AF-A0A2W0AN34-F1-model_v4 PLAT domain-containing protein 0.8891 37 191
AF-A0A7V8WH04-F1-model_v4 Membrane dipeptidase 0.8838 24 192 GO:0006508
GO:0070573
AF-A0A2V8ASU3-F1-model_v4 Uncharacterized protein 0.8769 44 196
AF-A0A2V8FZL8-F1-model_v4 Uncharacterized protein 0.8688 39 197

Map