F408928

General Info

Members Datasets Scaffolds Average Seq Length
327 243 322 256

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0000008|Ga0495583_0000008_195386_196225
Length 279
Sequence MLPSAFWRQRNDHPFLFHSPLSGDMTMDLPINHFKHAIAAGKLQLGLWSGLSNNITVEVLANSGFDWLLLDTEHSPNELPMVHSQLQAISQGKAHPIVRPPWNDTVTIKRYLDVGVQTLLIPFIQDTQEARDAVAATRYPPRGVRGYSAAARASDYGRVKDYPTRCEEELCVLLQVETPHALSNIEAIAAVDGVDGIFIGPGDLSASMGFIGQPMHPEVVAAIEDAVRRIRACGKQAGILVGDEALARHYIEIGCTFVAVGSDIGILARGAEALAAKFK

Samples

Sample ID Description Type Environment
1 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
2 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
3 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
4 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
5 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
192 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.28
Nodule 0.31
Rhizoplane 5.5
Rhizosphere 82.87
Stem 0
Stem Tuber 0
Unclassified 7.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007333 3300003203 Bacteria 5043
2 rootH1_10141528 3300003316 Bacteria 2389
3 rootL2_10061828 3300003322 Bacteria 5280
4 JGI25160J50197_1000455 3300003354 Bacteria 25464
5 Ga0065165_1003040 3300005262 Bacteria 12611
6 Ga0070690_100029872 3300005330 Bacteria 3384
7 Ga0070670_100147597 3300005331 Bacteria 2035
8 Ga0068869_100007559 3300005334 Bacteria 6955
9 Ga0070680_100325095 3300005336 Bacteria 1306
10 Ga0070660_100000456 3300005339 Bacteria 27268
11 Ga0070689_100030080 3300005340 Bacteria 4119
12 Ga0070661_100006027 3300005344 Bacteria 8340
13 Ga0070692_10066422 3300005345 Bacteria 1912
14 Ga0070669_100281829 3300005353 Bacteria 1332
15 Ga0070675_100030913 3300005354 Bacteria 4325
16 Ga0070674_100007696 3300005356 Bacteria 6363
17 Ga0070673_100058664 3300005364 Bacteria 3044
18 Ga0070688_100154555 3300005365 Bacteria 1571
19 Ga0070659_100000410 3300005366 Bacteria 32528
20 Ga0070667_100172016 3300005367 Bacteria 1913
21 Ga0070713_100393540 3300005436 Bacteria 1293
22 Ga0070701_10023001 3300005438 Bacteria 2995
23 Ga0070701_10340443 3300005438 Bacteria 934
24 Ga0070700_100034314 3300005441 Bacteria 3064
25 Ga0070694_100219479 3300005444 Bacteria 1425
26 Ga0070663_100004251 3300005455 Bacteria 8386
27 Ga0070678_100027838 3300005456 Bacteria 3844
28 Ga0070662_100000295 3300005457 Bacteria 29429
29 Ga0070662_100314542 3300005457 Bacteria 1275
30 Ga0070681_10270593 3300005458 Unclassified 1610
31 Ga0068867_100010035 3300005459 Bacteria 6674
32 Ga0068867_100521551 3300005459 Bacteria 1025
33 Ga0070685_10004869 3300005466 Bacteria 6791
34 Ga0070707_100145676 3300005468 Bacteria 2305
35 Ga0070699_100118623 3300005518 Bacteria 2326
36 Ga0070679_100044399 3300005530 Bacteria 4427
37 Ga0068853_100033335 3300005539 Unclassified 4369
38 Ga0070672_100065300 3300005543 Bacteria 2878
39 Ga0070686_100605044 3300005544 Bacteria 864
40 Ga0070695_100231186 3300005545 Bacteria 1337
41 Ga0068855_100000402 3300005563 Bacteria 53511
42 Ga0068854_100583239 3300005578 Bacteria 952
43 Ga0068856_100002782 3300005614 Bacteria 17909
44 Ga0068859_100025603 3300005617 Bacteria 5918
45 Ga0068859_100128742 3300005617 Bacteria 2602
46 Ga0068861_100048035 3300005719 Bacteria 3224
47 Ga0068863_100033548 3300005841 Bacteria 4890
48 Ga0068858_100078182 3300005842 Bacteria 3074
49 Ga0068860_100004032 3300005843 Bacteria 15081
50 Ga0068862_100028174 3300005844 Bacteria 4729
51 Ga0068862_100036940 3300005844 Bacteria 4139
52 Ga0081539_10000770 3300005985 Bacteria 62993
53 Ga0075365_10017298 3300006038 Bacteria 4408
54 Ga0075365_10031081 3300006038 Bacteria 3424
55 Ga0075367_10025196 3300006178 Bacteria 3362
56 Ga0075366_10000087 3300006195 Bacteria 36461
57 Ga0097621_100221265 3300006237 Bacteria 1650
58 Ga0097621_100507269 3300006237 Bacteria 1093
59 Ga0075428_100079310 3300006844 Bacteria 3583
60 Ga0075428_100083134 3300006844 Bacteria 3493
61 Ga0075431_100001101 3300006847 Bacteria 24221
62 Ga0075431_100454826 3300006847 Bacteria 1276
63 Ga0075434_100000378 3300006871 Bacteria 32511
64 Ga0075434_100236165 3300006871 Bacteria 1848
65 Ga0075429_100046222 3300006880 Bacteria 3788
66 Ga0068865_100001630 3300006881 Bacteria 13150
67 Ga0075436_100000442 3300006914 Bacteria 26532
68 Ga0075436_100027447 3300006914 Bacteria 3918
69 Ga0097620_100025602 3300006931 Bacteria 5918
70 Ga0097620_100128747 3300006931 Bacteria 2602
71 Ga0075435_100003085 3300007076 Bacteria 11245
72 Ga0075435_100392318 3300007076 Bacteria 1193
73 Ga0075435_100649831 3300007076 Bacteria 915
74 Ga0099794_10016591 3300007265 Bacteria 3268
75 Ga0105244_10003409 3300009036 Bacteria 11339
76 Ga0111539_10004475 3300009094 Bacteria 18275
77 Ga0111539_10086560 3300009094 Bacteria 3682
78 Ga0111539_10136968 3300009094 Bacteria 2867
79 Ga0105245_10035562 3300009098 Bacteria 4421
80 Ga0114129_10064962 3300009147 Bacteria 5093
81 Ga0114129_10435833 3300009147 Bacteria 1721
82 Ga0105243_10010045 3300009148 Bacteria 7199
83 Ga0105242_10027110 3300009176 Bacteria 4546
84 Ga0105242_10415751 3300009176 Bacteria 1259
85 Ga0105248_10003843 3300009177 Bacteria 16638
86 Ga0105248_10014776 3300009177 Bacteria 8596
87 Ga0105249_10086728 3300009553 Bacteria 2919
88 Ga0105249_10533038 3300009553 Bacteria 1223
89 Ga0157371_10000474 3300013102 Bacteria 49133
90 Ga0157370_10032256 3300013104 Bacteria 5116
91 Ga0157374_10437013 3300013296 Bacteria 1309
92 Ga0157374_10533168 3300013296 Bacteria 1181
93 Ga0157378_10156203 3300013297 Bacteria 2130
94 Ga0157378_10158145 3300013297 Bacteria 2117
95 Ga0163162_10157705 3300013306 Bacteria 2390
96 Ga0157375_10124463 3300013308 Bacteria 2692
97 Ga0157380_10001485 3300014326 Bacteria 15341
98 Ga0157377_10009599 3300014745 Bacteria 4756
99 Ga0157379_10068285 3300014968 Bacteria 3178
100 Ga0213874_10123364 3300021377 Bacteria 882
101 Ga0213876_10000025 3300021384 Bacteria 236747
102 Ga0213876_10016021 3300021384 Bacteria 3965
103 Ga0213871_10071027 3300021441 Bacteria 984
104 Ga0209130_1005743 3300025284 Bacteria 4207
105 Ga0209564_1015636 3300025295 Bacteria 3072
106 Ga0207426_1000014 3300025302 Bacteria 649413
107 Ga0207655_1032505 3300025728 Bacteria 2382
108 Ga0207645_10078809 3300025907 Bacteria 2111
109 Ga0207643_10054012 3300025908 Bacteria 2283
110 Ga0207707_10228578 3300025912 Unclassified 1619
111 Ga0207662_10003601 3300025918 Bacteria 8001
112 Ga0207662_10196496 3300025918 Bacteria 1304
113 Ga0207657_10003840 3300025919 Bacteria 15957
114 Ga0207646_10064171 3300025922 Bacteria 3278
115 Ga0207646_10146266 3300025922 Bacteria 2130
116 Ga0207650_10109448 3300025925 Bacteria 2137
117 Ga0207659_10068722 3300025926 Bacteria 2577
118 Ga0207706_10000014 3300025933 Bacteria 177082
119 Ga0207706_10083433 3300025933 Bacteria 2810
120 Ga0207691_10031837 3300025940 Bacteria 4922
121 Ga0207691_10200661 3300025940 Bacteria 1736
122 Ga0207691_10431965 3300025940 Bacteria 1122
123 Ga0207711_10032375 3300025941 Bacteria 4421
124 Ga0207711_10422131 3300025941 Bacteria 1240
125 Ga0207689_10016026 3300025942 Bacteria 6344
126 Ga0207667_10019527 3300025949 Bacteria 7562
127 Ga0207668_10287045 3300025972 Bacteria 1352
128 Ga0207640_10599460 3300025981 Bacteria 932
129 Ga0207658_10043122 3300025986 Bacteria 3278
130 Ga0207708_10013480 3300026075 Bacteria 6112
131 Ga0207708_10152103 3300026075 Unclassified 1823
132 Ga0207702_10005920 3300026078 Bacteria 10621
133 Ga0207648_10016486 3300026089 Bacteria 6748
134 Ga0207675_100017531 3300026118 Bacteria 6683
135 Ga0207675_100189595 3300026118 Bacteria 1972
136 Ga0207683_10028239 3300026121 Bacteria 4851
137 Ga0209588_1030125 3300027671 Bacteria 1732
138 Ga0207428_10000139 3300027907 Bacteria 98277
139 Ga0268265_10036478 3300028380 Bacteria 3601
140 Ga0268265_10056964 3300028380 Bacteria 2976
141 Ga0268264_10081857 3300028381 Bacteria 2760
142 Ga0268264_10235671 3300028381 Bacteria 1692
143 Ga0265318_10009806 3300028577 Bacteria 4197
144 Ga0265336_10006991 3300028666 Bacteria 4037
145 Ga0265338_10003849 3300028800 Bacteria 20825
146 Ga0265338_10218188 3300028800 Bacteria 1426
147 Ga0265330_10000295 3300031235 Bacteria 36064
148 Ga0265332_10006489 3300031238 Bacteria 5306
149 Ga0265320_10050835 3300031240 Bacteria 2013
150 Ga0265325_10001053 3300031241 Bacteria 19829
151 Ga0265340_10001444 3300031247 Bacteria 13626
152 Ga0265340_10041555 3300031247 Bacteria 2260
153 Ga0265339_10001295 3300031249 Bacteria 18718
154 Ga0265339_10047917 3300031249 Bacteria 2345
155 Ga0265327_10000914 3300031251 Bacteria 43245
156 Ga0265316_10009116 3300031344 Bacteria 9140
157 Ga0265313_10000483 3300031595 Bacteria 41854
158 Ga0265313_10000772 3300031595 Bacteria 32541
159 Ga0265314_10000033 3300031711 Bacteria 254594
160 Ga0265314_10135565 3300031711 Bacteria 1529
161 Ga0265314_10150488 3300031711 Bacteria 1428
162 Ga0265342_10005584 3300031712 Bacteria 9536
163 Ga0307409_100162517 3300031995 Bacteria 1955
164 Ga0307409_100334087 3300031995 Bacteria 1423
165 Ga0307411_10739478 3300032005 Bacteria 861
166 Ga0373939_0051229 3300035114 Bacteria 1283
167 Ga0373955_0161190 3300035172 Bacteria 1324
168 Ga0373931_0343582 3300035691 Bacteria 933
169 Ga0373935_0055949 3300035692 Bacteria 2514
170 Ga0373927_0138220 3300035695 Bacteria 1593
171 Ga0373933_0314350 3300035724 Bacteria 1015
172 Ga0373947_0028970 3300035725 Bacteria 3249
173 Ga0373937_0218500 3300036401 Bacteria 1794
174 Ga0395899_0021263 3300037312 Bacteria 4922
175 Ga0395900_0084875 3300037418 Bacteria 3254
176 Ga0395900_0183030 3300037418 Bacteria 2128
177 Ga0395900_0213677 3300037418 Bacteria 1947
178 Ga0395898_0060297 3300037466 Bacteria 3687
179 Ga0395905_0075468 3300037471 Bacteria 3160
180 Ga0395905_0084323 3300037471 Bacteria 2977
181 Ga0395901_0001319 3300038443 Bacteria 26126
182 Ga0436365_1111336 3300039437 Bacteria 2114
183 Ga0436365_1279401 3300039437 Bacteria 294819
184 Ga0436365_1491795 3300039437 Bacteria 11364
185 Ga0436365_1536293 3300039437 Bacteria 1730
186 Ga0436365_1900921 3300039437 Bacteria 1369
187 Ga0436363_0651980 3300039450 Bacteria 2149
188 Ga0436362_0954077 3300039453 Bacteria 2164
189 Ga0466965_0000613 3300044683 Bacteria 13026
190 Ga0466966_0003879 3300044684 Bacteria 9877
191 Ga0466961_0004681 3300044693 Bacteria 8595
192 Ga0466970_0008418 3300044765 Bacteria 5190
193 Ga0466957_0001149 3300044842 Bacteria 13693
194 Ga0466957_0272594 3300044842 Bacteria 1130
195 Ga0466959_0160559 3300045049 Bacteria 1580
196 Ga0466958_0004300 3300045836 Bacteria 7500
197 Ga0466967_0000292 3300045976 Bacteria 22396
198 Ga0495650_0000051 3300046471 Bacteria 318297
199 Ga0495580_0219272 3300046472 Bacteria 1307
200 Ga0495605_0197546 3300046474 Bacteria 878
201 Ga0495584_0049437 3300046491 Bacteria 2118
202 Ga0495596_0005651 3300046500 Bacteria 5874
203 Ga0495583_0000008 3300046506 Bacteria 411092
204 Ga0495583_0003176 3300046506 Bacteria 12935
205 Ga0495583_0050997 3300046506 Bacteria 1888
206 Ga0495583_0187247 3300046506 Bacteria 845
207 Ga0495606_0024769 3300046507 Bacteria 4315
208 Ga0495608_0223259 3300046511 Bacteria 1181
209 Ga0495616_0127357 3300046513 Bacteria 1170
210 Ga0495631_0018606 3300046518 Bacteria 3268
211 Ga0495643_0010749 3300046522 Bacteria 5622
212 Ga0495643_0044887 3300046522 Bacteria 2400
213 Ga0495643_0207315 3300046522 Bacteria 937
214 Ga0495663_0002098 3300046525 Bacteria 6097
215 Ga0495642_0003870 3300046528 Bacteria 5870
216 Ga0495642_0092105 3300046528 Bacteria 1284
217 Ga0495665_0079602 3300046531 Bacteria 1724
218 Ga0495609_0002221 3300046538 Bacteria 12154
219 Ga0495609_0064730 3300046538 Bacteria 1612
220 Ga0495621_0020868 3300046539 Bacteria 2154
221 Ga0495597_0033956 3300046542 Bacteria 2307
222 Ga0495597_0053603 3300046542 Bacteria 1773
223 Ga0495597_0138162 3300046542 Bacteria 1007
224 Ga0495622_0086868 3300046557 Bacteria 1438
225 Ga0495622_0100010 3300046557 Bacteria 1329
226 Ga0495656_0001999 3300046615 Bacteria 6716
227 Ga0495668_0103284 3300046616 Bacteria 1559
228 Ga0495635_0150823 3300046663 Bacteria 1583
229 Ga0495661_0002483 3300046665 Bacteria 14184
230 Ga0495661_0106974 3300046665 Bacteria 1564
231 Ga0495658_0461923 3300046683 Bacteria 811
232 Ga0495624_0358167 3300046690 Bacteria 877
233 Ga0495670_0157640 3300046691 Bacteria 1192
234 Ga0495589_0043084 3300046794 Bacteria 2248
235 Ga0495660_0003562 3300046810 Bacteria 9602
236 Ga0495636_0012858 3300047318 Bacteria 3317
237 Ga0495672_0000063 3300047320 Bacteria 201893
238 Ga0495676_0003866 3300047321 Bacteria 13625
239 Ga0495676_0069546 3300047321 Bacteria 2716
240 Ga0495680_0235237 3300047322 Bacteria 1303
241 Ga0495687_003041 3300047443 Bacteria 12601
242 Ga0495687_014850 3300047443 Bacteria 3982
243 Ga0495677_0015439 3300047445 Bacteria 2774
244 Ga0495685_043647 3300047447 Bacteria 1530
245 Ga0495673_0044390 3300047469 Bacteria 1982
246 Ga0495686_0026755 3300047472 Bacteria 3773
247 Ga0495615_0000581 3300048090 Bacteria 5145
248 Ga0495626_0177632 3300048091 Bacteria 884
249 Ga0496100_0025139 3300048903 Bacteria 3639
250 Ga0496100_0341863 3300048903 Bacteria 1128
251 Ga0496101_0012329 3300048904 Bacteria 5702
252 Ga0496101_0098596 3300048904 Bacteria 2183
253 Ga0496102_0000182 3300048905 Bacteria 84891
254 Ga0496102_0001026 3300048905 Bacteria 25986
255 Ga0496102_0390437 3300048905 Bacteria 1309
256 Ga0496102_0592645 3300048905 Bacteria 1031
257 Ga0496103_0000740 3300048906 Bacteria 24075
258 Ga0496103_0152762 3300048906 Bacteria 1479
259 Ga0496103_0168112 3300048906 Bacteria 1407
260 Ga0496104_0175956 3300048907 Bacteria 2050
261 Ga0496105_0044854 3300048908 Bacteria 3647
262 Ga0496108_0529338 3300048911 Bacteria 1029
263 Ga0496112_0001121 3300048915 Bacteria 19909
264 Ga0496113_0017103 3300048916 Bacteria 5027
265 Ga0496115_0136432 3300048918 Bacteria 2023
266 Ga0496117_0016673 3300048920 Bacteria 6180
267 Ga0496118_0002360 3300048921 Bacteria 25579
268 Ga0496119_0039919 3300048922 Bacteria 3011
269 Ga0496121_0002356 3300048924 Bacteria 29139
270 Ga0496121_0019730 3300048924 Bacteria 6723
271 Ga0496122_0002964 3300048925 Bacteria 23146
272 Ga0496122_0007229 3300048925 Bacteria 12423
273 Ga0496122_0208663 3300048925 Bacteria 1134
274 Ga0496123_0000171 3300048926 Bacteria 130780
275 Ga0496123_0003004 3300048926 Bacteria 19494
276 Ga0496123_0027332 3300048926 Bacteria 4252
277 Ga0496126_0272626 3300048929 Bacteria 1404
278 Ga0495678_003091 3300049459 Bacteria 10551
279 Ga0501032_0005417 3300049569 Bacteria 9489
280 Ga0501032_0263357 3300049569 Bacteria 1118
281 Ga0501034_0085163 3300049571 Bacteria 3162
282 Ga0501036_0030797 3300049572 Bacteria 4533
283 Ga0501038_0079965 3300049574 Bacteria 2756
284 Ga0501038_0120406 3300049574 Bacteria 2165
285 Ga0501040_0010599 3300049576 Bacteria 6028
286 Ga0501040_0139108 3300049576 Bacteria 1710
287 Ga0501042_0061569 3300049578 Bacteria 2681
288 Ga0501046_0025545 3300049580 Bacteria 4833
289 Ga0501046_0340187 3300049580 Bacteria 1091
290 Ga0501047_0018083 3300049581 Bacteria 6754
291 Ga0501048_0150253 3300049582 Bacteria 1647
292 Ga0501067_0107506 3300049583 Bacteria 1551
293 Ga0501068_0028883 3300049584 Bacteria 3282
294 Ga0501072_0154037 3300049588 Bacteria 1833
295 Ga0501073_0009834 3300049589 Bacteria 7039
296 Ga0501074_0255908 3300049590 Bacteria 1245
297 Ga0501079_0106678 3300049741 Bacteria 2174
298 Ga0501080_0030494 3300049742 Bacteria 5023
299 Ga0501035_0436147 3300049822 Bacteria 1086
300 Ga0501044_0015410 3300049823 Bacteria 8233
301 Ga0501045_0135699 3300049824 Bacteria 1829
302 nmdc:mga03n38_142766_c1 3300050490 Bacteria 1197
303 nmdc:mga0yw44_125320_c1 3300050492 Bacteria 1658
304 nmdc:mga06z11_15822_c1 3300050494 Bacteria 3378
305 nmdc:mga07m45_19079_c1 3300050496 Bacteria 3712
306 nmdc:mga05p37_146985_c1 3300050507 Bacteria 2885
307 nmdc:mga05p37_196810_c1 3300050507 Bacteria 2443
308 nmdc:mga05p37_617790_c1 3300050507 Bacteria 1220
309 nmdc:mga09592_290008_c1 3300050508 Bacteria 1419
310 nmdc:mga06r32_794014_c1 3300050510 Bacteria 908
311 nmdc:mga08y16_227442_c1 3300050511 Bacteria 1930
312 nmdc:mga08y16_3634_c1 3300050511 Bacteria 16027
313 nmdc:mga0n895_104300_c1 3300050512 Bacteria 2848
314 nmdc:mga0n895_375397_c1 3300050512 Bacteria 1439
315 nmdc:mga0n895_422_c1 3300050512 Bacteria 28375
316 nmdc:mga0rr50_2911_c1 3300050513 Bacteria 9768
317 nmdc:mga0rr50_510903_c1 3300050513 Bacteria 1022
318 nmdc:mga08x19_62528_c1 3300050514 Bacteria 2414
319 nmdc:mga08x19_81_c1 3300050514 Bacteria 87015
320 nmdc:mga0a205_84382_c1 3300050515 Bacteria 3068
321 Ga0500616_0041381 3300053153 Bacteria 2473
322 Ga0501084_0173227 3300054114 Bacteria 1821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_104300_c1 nmdc:mga0n895_104300_c1_784_1551 226
2 3300050515 nmdc:mga0a205_84382_c1 nmdc:mga0a205_84382_c1_1899_2666 226
3 3300005436 Ga0070713_100393540 Ga0070713_1003935402 229
4 3300005544 Ga0070686_100605044 Ga0070686_1006050441 229
5 3300025922 Ga0207646_10146266 Ga0207646_101462662 229
6 3300031251 Ga0265327_10000914 Ga0265327_1000091430 229
7 3300049574 Ga0501038_0120406 Ga0501038_0120406_906_1676 231
8 3300049581 Ga0501047_0018083 Ga0501047_0018083_4010_4780 231
9 3300049582 Ga0501048_0150253 Ga0501048_0150253_160_930 231
10 3300049583 Ga0501067_0107506 Ga0501067_0107506_685_1455 231
11 3300049823 Ga0501044_0015410 Ga0501044_0015410_5709_6479 231
12 3300026075 Ga0207708_10152103 Ga0207708_101521032 232
13 3300007265 Ga0099794_10016591 Ga0099794_100165912 234
14 3300027671 Ga0209588_1030125 Ga0209588_10301252 234
15 3300037418 Ga0395900_0084875 Ga0395900_0084875_555_1325 234
16 3300037418 Ga0395900_0213677 Ga0395900_0213677_452_1222 234
17 3300037466 Ga0395898_0060297 Ga0395898_0060297_2404_3174 234
18 3300038443 Ga0395901_0001319 Ga0395901_0001319_15922_16692 234
19 3300021384 Ga0213876_10016021 Ga0213876_100160212 235
20 3300031595 Ga0265313_10000483 Ga0265313_100004838 235
21 3300039437 Ga0436365_1491795 Ga0436365_1491795_7753_8538 235
22 3300005444 Ga0070694_100219479 Ga0070694_1002194791 236
23 3300005545 Ga0070695_100231186 Ga0070695_1002311861 236
24 3300021377 Ga0213874_10123364 Ga0213874_101233641 236
25 3300039437 Ga0436365_1536293 Ga0436365_1536293_286_1050 236
26 3300039437 Ga0436365_1900921 Ga0436365_1900921_472_1236 236
27 3300039450 Ga0436363_0651980 Ga0436363_0651980_1061_1825 236
28 3300039453 Ga0436362_0954077 Ga0436362_0954077_1143_1907 236
29 3300046690 Ga0495624_0358167 Ga0495624_0358167_16_780 236
30 3300049822 Ga0501035_0436147 Ga0501035_0436147_72_848 236
31 3300009147 Ga0114129_10435833 Ga0114129_104358332 237
32 3300006237 Ga0097621_100221265 Ga0097621_1002212651 238
33 3300031247 Ga0265340_10041555 Ga0265340_100415554 238
34 3300031711 Ga0265314_10135565 Ga0265314_101355652 238
35 3300049580 Ga0501046_0340187 Ga0501046_0340187_147_911 238
36 3300049588 Ga0501072_0154037 Ga0501072_0154037_497_1261 238
37 iso_pu_bacteria 2609459761 2609912596 238
38 iso_pu_bacteria 2945874760 2945879461 238
39 3300049459 Ga0495678_003091 Ga0495678_003091_4116_4883 239
40 iso_pu_bacteria 2562617112 2563057541 240
41 iso_pu_bacteria 2711768613 2713473761 240
42 iso_pu_bacteria 2921643360 2921652192 240
43 3300037471 Ga0395905_0075468 Ga0395905_0075468_2082_2843 241
44 3300006847 Ga0075431_100001101 Ga0075431_10000110112 242
45 3300006871 Ga0075434_100000378 Ga0075434_10000037821 242
46 3300006914 Ga0075436_100027447 Ga0075436_1000274472 242
47 3300007076 Ga0075435_100003085 Ga0075435_1000030852 242
48 3300009036 Ga0105244_10003409 Ga0105244_100034094 242
49 3300021384 Ga0213876_10000025 Ga0213876_1000002575 242
50 3300025728 Ga0207655_1032505 Ga0207655_10325052 242
51 3300039437 Ga0436365_1279401 Ga0436365_1279401_128562_129326 242
52 3300046491 Ga0495584_0049437 Ga0495584_0049437_47_811 242
53 3300046500 Ga0495596_0005651 Ga0495596_0005651_2561_3325 242
54 3300046506 Ga0495583_0000008 Ga0495583_0000008_195386_196225 242
55 3300046506 Ga0495583_0003176 Ga0495583_0003176_1865_2635 242
56 3300046506 Ga0495583_0187247 Ga0495583_0187247_46_810 242
57 3300046518 Ga0495631_0018606 Ga0495631_0018606_510_1274 242
58 3300046528 Ga0495642_0092105 Ga0495642_0092105_133_897 242
59 3300046538 Ga0495609_0002221 Ga0495609_0002221_8326_9090 242
60 3300046557 Ga0495622_0100010 Ga0495622_0100010_157_921 242
61 3300046616 Ga0495668_0103284 Ga0495668_0103284_373_1137 242
62 3300046794 Ga0495589_0043084 Ga0495589_0043084_966_1730 242
63 3300047321 Ga0495676_0003866 Ga0495676_0003866_9108_9872 242
64 3300047445 Ga0495677_0015439 Ga0495677_0015439_490_1254 242
65 3300047469 Ga0495673_0044390 Ga0495673_0044390_959_1723 242
66 3300048925 Ga0496122_0002964 Ga0496122_0002964_13370_14134 242
67 3300048925 Ga0496122_0007229 Ga0496122_0007229_8117_8884 242
68 3300048926 Ga0496123_0000171 Ga0496123_0000171_60866_61630 242
69 3300048926 Ga0496123_0003004 Ga0496123_0003004_11758_12525 242
70 3300050512 nmdc:mga0n895_422_c1 nmdc:mga0n895_422_c1_24228_24992 242
71 3300050513 nmdc:mga0rr50_2911_c1 nmdc:mga0rr50_2911_c1_5539_6303 242
72 3300050514 nmdc:mga08x19_62528_c1 nmdc:mga08x19_62528_c1_1481_2245 242
73 3300005339 Ga0070660_100000456 Ga0070660_10000045611 243
74 3300005344 Ga0070661_100006027 Ga0070661_1000060272 243
75 3300005366 Ga0070659_100000410 Ga0070659_10000041018 243
76 3300005457 Ga0070662_100000295 Ga0070662_10000029520 243
77 3300005458 Ga0070681_10270593 Ga0070681_102705932 243
78 3300005459 Ga0068867_100521551 Ga0068867_1005215511 243
79 3300005468 Ga0070707_100145676 Ga0070707_1001456762 243
80 3300005518 Ga0070699_100118623 Ga0070699_1001186232 243
81 3300005539 Ga0068853_100033335 Ga0068853_1000333353 243
82 3300005563 Ga0068855_100000402 Ga0068855_10000040256 243
83 3300005578 Ga0068854_100583239 Ga0068854_1005832391 243
84 3300005614 Ga0068856_100002782 Ga0068856_10000278215 243
85 3300006237 Ga0097621_100507269 Ga0097621_1005072691 243
86 3300006847 Ga0075431_100454826 Ga0075431_1004548261 243
87 3300006871 Ga0075434_100236165 Ga0075434_1002361652 243
88 3300009176 Ga0105242_10415751 Ga0105242_104157512 243
89 3300009177 Ga0105248_10014776 Ga0105248_100147766 243
90 3300013102 Ga0157371_10000474 Ga0157371_1000047439 243
91 3300013296 Ga0157374_10437013 Ga0157374_104370132 243
92 3300013297 Ga0157378_10156203 Ga0157378_101562033 243
93 3300021441 Ga0213871_10071027 Ga0213871_100710272 243
94 3300025912 Ga0207707_10228578 Ga0207707_102285782 243
95 3300025919 Ga0207657_10003840 Ga0207657_100038406 243
96 3300025922 Ga0207646_10064171 Ga0207646_100641713 243
97 3300025933 Ga0207706_10000014 Ga0207706_10000014136 243
98 3300025940 Ga0207691_10431965 Ga0207691_104319652 243
99 3300025949 Ga0207667_10019527 Ga0207667_100195275 243
100 3300025972 Ga0207668_10287045 Ga0207668_102870452 243
101 3300025981 Ga0207640_10599460 Ga0207640_105994601 243
102 3300026078 Ga0207702_10005920 Ga0207702_100059202 243
103 3300031995 Ga0307409_100162517 Ga0307409_1001625171 243
104 3300035172 Ga0373955_0161190 Ga0373955_0161190_145_909 243
105 3300035691 Ga0373931_0343582 Ga0373931_0343582_112_876 243
106 3300035724 Ga0373933_0314350 Ga0373933_0314350_129_893 243
107 3300039437 Ga0436365_1111336 Ga0436365_1111336_775_1539 243
108 3300044842 Ga0466957_0272594 Ga0466957_0272594_202_972 243
109 3300045976 Ga0466967_0000292 Ga0466967_0000292_12109_12879 243
110 3300046683 Ga0495658_0461923 Ga0495658_0461923_19_783 243
111 3300047321 Ga0495676_0069546 Ga0495676_0069546_493_1257 243
112 3300049569 Ga0501032_0263357 Ga0501032_0263357_31_819 243
113 3300049574 Ga0501038_0079965 Ga0501038_0079965_1694_2482 243
114 3300049576 Ga0501040_0010599 Ga0501040_0010599_4362_5150 243
115 3300049578 Ga0501042_0061569 Ga0501042_0061569_1255_2043 243
116 3300049741 Ga0501079_0106678 Ga0501079_0106678_547_1335 243
117 3300049824 Ga0501045_0135699 Ga0501045_0135699_426_1214 243
118 3300050507 nmdc:mga05p37_617790_c1 nmdc:mga05p37_617790_c1_321_1106 243
119 3300050510 nmdc:mga06r32_794014_c1 nmdc:mga06r32_794014_c1_30_824 243
120 3300050512 nmdc:mga0n895_375397_c1 nmdc:mga0n895_375397_c1_180_944 243
121 3300054114 Ga0501084_0173227 Ga0501084_0173227_538_1326 243
122 3300003203 JGI25406J46586_10007333 JGI25406J46586_100073332 244
123 3300003316 rootH1_10141528 rootH1_101415282 244
124 3300003322 rootL2_10061828 rootL2_100618281 244
125 3300003354 JGI25160J50197_1000455 JGI25160J50197_10004553 244
126 3300005262 Ga0065165_1003040 Ga0065165_10030402 244
127 3300005330 Ga0070690_100029872 Ga0070690_1000298723 244
128 3300005331 Ga0070670_100147597 Ga0070670_1001475972 244
129 3300005334 Ga0068869_100007559 Ga0068869_1000075594 244
130 3300005336 Ga0070680_100325095 Ga0070680_1003250952 244
131 3300005340 Ga0070689_100030080 Ga0070689_1000300802 244
132 3300005345 Ga0070692_10066422 Ga0070692_100664222 244
133 3300005353 Ga0070669_100281829 Ga0070669_1002818292 244
134 3300005354 Ga0070675_100030913 Ga0070675_1000309132 244
135 3300005356 Ga0070674_100007696 Ga0070674_1000076963 244
136 3300005364 Ga0070673_100058664 Ga0070673_1000586643 244
137 3300005365 Ga0070688_100154555 Ga0070688_1001545552 244
138 3300005367 Ga0070667_100172016 Ga0070667_1001720162 244
139 3300005438 Ga0070701_10023001 Ga0070701_100230012 244
140 3300005438 Ga0070701_10340443 Ga0070701_103404431 244
141 3300005441 Ga0070700_100034314 Ga0070700_1000343142 244
142 3300005455 Ga0070663_100004251 Ga0070663_1000042514 244
143 3300005456 Ga0070678_100027838 Ga0070678_1000278382 244
144 3300005457 Ga0070662_100314542 Ga0070662_1003145422 244
145 3300005459 Ga0068867_100010035 Ga0068867_1000100354 244
146 3300005466 Ga0070685_10004869 Ga0070685_100048694 244
147 3300005530 Ga0070679_100044399 Ga0070679_1000443992 244
148 3300005543 Ga0070672_100065300 Ga0070672_1000653002 244
149 3300005617 Ga0068859_100025603 Ga0068859_1000256032 244
150 3300005617 Ga0068859_100128742 Ga0068859_1001287423 244
151 3300005719 Ga0068861_100048035 Ga0068861_1000480353 244
152 3300005841 Ga0068863_100033548 Ga0068863_1000335482 244
153 3300005842 Ga0068858_100078182 Ga0068858_1000781822 244
154 3300005843 Ga0068860_100004032 Ga0068860_1000040327 244
155 3300005844 Ga0068862_100028174 Ga0068862_1000281742 244
156 3300005844 Ga0068862_100036940 Ga0068862_1000369402 244
157 3300005985 Ga0081539_10000770 Ga0081539_1000077063 244
158 3300006038 Ga0075365_10017298 Ga0075365_100172982 244
159 3300006038 Ga0075365_10031081 Ga0075365_100310813 244
160 3300006178 Ga0075367_10025196 Ga0075367_100251962 244
161 3300006195 Ga0075366_10000087 Ga0075366_100000879 244
162 3300006844 Ga0075428_100079310 Ga0075428_1000793105 244
163 3300006844 Ga0075428_100083134 Ga0075428_1000831342 244
164 3300006880 Ga0075429_100046222 Ga0075429_1000462222 244
165 3300006881 Ga0068865_100001630 Ga0068865_1000016303 244
166 3300006914 Ga0075436_100000442 Ga0075436_10000044221 244
167 3300006931 Ga0097620_100025602 Ga0097620_1000256024 244
168 3300006931 Ga0097620_100128747 Ga0097620_1001287473 244
169 3300007076 Ga0075435_100392318 Ga0075435_1003923182 244
170 3300007076 Ga0075435_100649831 Ga0075435_1006498311 244
171 3300009094 Ga0111539_10004475 Ga0111539_1000447510 244
172 3300009094 Ga0111539_10086560 Ga0111539_100865602 244
173 3300009094 Ga0111539_10136968 Ga0111539_101369683 244
174 3300009098 Ga0105245_10035562 Ga0105245_100355622 244
175 3300009147 Ga0114129_10064962 Ga0114129_100649621 244
176 3300009148 Ga0105243_10010045 Ga0105243_100100455 244
177 3300009176 Ga0105242_10027110 Ga0105242_100271102 244
178 3300009177 Ga0105248_10003843 Ga0105248_100038438 244
179 3300009553 Ga0105249_10086728 Ga0105249_100867282 244
180 3300009553 Ga0105249_10533038 Ga0105249_105330382 244
181 3300013104 Ga0157370_10032256 Ga0157370_100322564 244
182 3300013296 Ga0157374_10533168 Ga0157374_105331682 244
183 3300013297 Ga0157378_10158145 Ga0157378_101581452 244
184 3300013306 Ga0163162_10157705 Ga0163162_101577053 244
185 3300013308 Ga0157375_10124463 Ga0157375_101244633 244
186 3300014326 Ga0157380_10001485 Ga0157380_100014858 244
187 3300014745 Ga0157377_10009599 Ga0157377_100095994 244
188 3300014968 Ga0157379_10068285 Ga0157379_100682852 244
189 3300025284 Ga0209130_1005743 Ga0209130_10057433 244
190 3300025295 Ga0209564_1015636 Ga0209564_10156363 244
191 3300025302 Ga0207426_1000014 Ga0207426_1000014442 244
192 3300025907 Ga0207645_10078809 Ga0207645_100788092 244
193 3300025908 Ga0207643_10054012 Ga0207643_100540121 244
194 3300025918 Ga0207662_10003601 Ga0207662_100036016 244
195 3300025918 Ga0207662_10196496 Ga0207662_101964962 244
196 3300025925 Ga0207650_10109448 Ga0207650_101094483 244
197 3300025926 Ga0207659_10068722 Ga0207659_100687222 244
198 3300025933 Ga0207706_10083433 Ga0207706_100834332 244
199 3300025940 Ga0207691_10031837 Ga0207691_100318372 244
200 3300025940 Ga0207691_10200661 Ga0207691_102006612 244
201 3300025941 Ga0207711_10032375 Ga0207711_100323752 244
202 3300025941 Ga0207711_10422131 Ga0207711_104221312 244
203 3300025942 Ga0207689_10016026 Ga0207689_100160262 244
204 3300025986 Ga0207658_10043122 Ga0207658_100431222 244
205 3300026075 Ga0207708_10013480 Ga0207708_100134802 244
206 3300026089 Ga0207648_10016486 Ga0207648_100164862 244
207 3300026118 Ga0207675_100017531 Ga0207675_1000175312 244
208 3300026118 Ga0207675_100189595 Ga0207675_1001895952 244
209 3300026121 Ga0207683_10028239 Ga0207683_100282393 244
210 3300027907 Ga0207428_10000139 Ga0207428_1000013926 244
211 3300028380 Ga0268265_10036478 Ga0268265_100364782 244
212 3300028380 Ga0268265_10056964 Ga0268265_100569642 244
213 3300028381 Ga0268264_10081857 Ga0268264_100818572 244
214 3300028381 Ga0268264_10235671 Ga0268264_102356712 244
215 3300028577 Ga0265318_10009806 Ga0265318_100098062 244
216 3300028666 Ga0265336_10006991 Ga0265336_100069912 244
217 3300028800 Ga0265338_10003849 Ga0265338_100038497 244
218 3300028800 Ga0265338_10218188 Ga0265338_102181881 244
219 3300031235 Ga0265330_10000295 Ga0265330_1000029524 244
220 3300031238 Ga0265332_10006489 Ga0265332_100064893 244
221 3300031240 Ga0265320_10050835 Ga0265320_100508352 244
222 3300031241 Ga0265325_10001053 Ga0265325_1000105318 244
223 3300031247 Ga0265340_10001444 Ga0265340_1000144412 244
224 3300031249 Ga0265339_10001295 Ga0265339_100012959 244
225 3300031249 Ga0265339_10047917 Ga0265339_100479172 244
226 3300031344 Ga0265316_10009116 Ga0265316_100091163 244
227 3300031595 Ga0265313_10000772 Ga0265313_1000077224 244
228 3300031711 Ga0265314_10000033 Ga0265314_10000033143 244
229 3300031711 Ga0265314_10150488 Ga0265314_101504881 244
230 3300031712 Ga0265342_10005584 Ga0265342_100055848 244
231 3300031995 Ga0307409_100334087 Ga0307409_1003340871 244
232 3300032005 Ga0307411_10739478 Ga0307411_107394781 244
233 3300035114 Ga0373939_0051229 Ga0373939_0051229_260_1045 244
234 3300035692 Ga0373935_0055949 Ga0373935_0055949_780_1550 244
235 3300035695 Ga0373927_0138220 Ga0373927_0138220_600_1370 244
236 3300035725 Ga0373947_0028970 Ga0373947_0028970_248_1018 244
237 3300036401 Ga0373937_0218500 Ga0373937_0218500_425_1195 244
238 3300037312 Ga0395899_0021263 Ga0395899_0021263_875_1645 244
239 3300037418 Ga0395900_0183030 Ga0395900_0183030_453_1223 244
240 3300037471 Ga0395905_0084323 Ga0395905_0084323_391_1161 244
241 3300044683 Ga0466965_0000613 Ga0466965_0000613_7059_7829 244
242 3300044684 Ga0466966_0003879 Ga0466966_0003879_7398_8168 244
243 3300044693 Ga0466961_0004681 Ga0466961_0004681_1454_2224 244
244 3300044765 Ga0466970_0008418 Ga0466970_0008418_395_1165 244
245 3300044842 Ga0466957_0001149 Ga0466957_0001149_6505_7275 244
246 3300045049 Ga0466959_0160559 Ga0466959_0160559_488_1258 244
247 3300045836 Ga0466958_0004300 Ga0466958_0004300_4651_5421 244
248 3300046471 Ga0495650_0000051 Ga0495650_0000051_91494_92261 244
249 3300046472 Ga0495580_0219272 Ga0495580_0219272_228_1010 244
250 3300046474 Ga0495605_0197546 Ga0495605_0197546_28_798 244
251 3300046506 Ga0495583_0050997 Ga0495583_0050997_743_1525 244
252 3300046507 Ga0495606_0024769 Ga0495606_0024769_2423_3247 244
253 3300046511 Ga0495608_0223259 Ga0495608_0223259_139_909 244
254 3300046513 Ga0495616_0127357 Ga0495616_0127357_210_992 244
255 3300046522 Ga0495643_0010749 Ga0495643_0010749_4036_4806 244
256 3300046522 Ga0495643_0044887 Ga0495643_0044887_923_1693 244
257 3300046522 Ga0495643_0207315 Ga0495643_0207315_121_891 244
258 3300046525 Ga0495663_0002098 Ga0495663_0002098_1354_2130 244
259 3300046528 Ga0495642_0003870 Ga0495642_0003870_2869_3639 244
260 3300046531 Ga0495665_0079602 Ga0495665_0079602_910_1692 244
261 3300046538 Ga0495609_0064730 Ga0495609_0064730_554_1378 244
262 3300046539 Ga0495621_0020868 Ga0495621_0020868_304_1074 244
263 3300046542 Ga0495597_0033956 Ga0495597_0033956_566_1336 244
264 3300046542 Ga0495597_0053603 Ga0495597_0053603_647_1417 244
265 3300046542 Ga0495597_0138162 Ga0495597_0138162_14_784 244
266 3300046557 Ga0495622_0086868 Ga0495622_0086868_486_1268 244
267 3300046615 Ga0495656_0001999 Ga0495656_0001999_5376_6152 244
268 3300046663 Ga0495635_0150823 Ga0495635_0150823_113_883 244
269 3300046665 Ga0495661_0002483 Ga0495661_0002483_307_1077 244
270 3300046665 Ga0495661_0106974 Ga0495661_0106974_717_1487 244
271 3300046691 Ga0495670_0157640 Ga0495670_0157640_349_1125 244
272 3300046810 Ga0495660_0003562 Ga0495660_0003562_5772_6596 244
273 3300047318 Ga0495636_0012858 Ga0495636_0012858_915_1691 244
274 3300047320 Ga0495672_0000063 Ga0495672_0000063_146463_147233 244
275 3300047322 Ga0495680_0235237 Ga0495680_0235237_121_891 244
276 3300047443 Ga0495687_003041 Ga0495687_003041_5782_6552 244
277 3300047443 Ga0495687_014850 Ga0495687_014850_466_1245 244
278 3300047447 Ga0495685_043647 Ga0495685_043647_696_1466 244
279 3300047472 Ga0495686_0026755 Ga0495686_0026755_730_1554 244
280 3300048090 Ga0495615_0000581 Ga0495615_0000581_3716_4492 244
281 3300048091 Ga0495626_0177632 Ga0495626_0177632_64_846 244
282 3300048903 Ga0496100_0025139 Ga0496100_0025139_1760_2542 244
283 3300048903 Ga0496100_0341863 Ga0496100_0341863_146_928 244
284 3300048904 Ga0496101_0012329 Ga0496101_0012329_3307_4089 244
285 3300048904 Ga0496101_0098596 Ga0496101_0098596_442_1224 244
286 3300048905 Ga0496102_0000182 Ga0496102_0000182_83552_84322 244
287 3300048905 Ga0496102_0001026 Ga0496102_0001026_23591_24373 244
288 3300048905 Ga0496102_0390437 Ga0496102_0390437_213_989 244
289 3300048905 Ga0496102_0592645 Ga0496102_0592645_24_806 244
290 3300048906 Ga0496103_0000740 Ga0496103_0000740_21684_22466 244
291 3300048906 Ga0496103_0152762 Ga0496103_0152762_330_1100 244
292 3300048906 Ga0496103_0168112 Ga0496103_0168112_250_1026 244
293 3300048907 Ga0496104_0175956 Ga0496104_0175956_692_1474 244
294 3300048908 Ga0496105_0044854 Ga0496105_0044854_335_1117 244
295 3300048911 Ga0496108_0529338 Ga0496108_0529338_195_986 244
296 3300048915 Ga0496112_0001121 Ga0496112_0001121_15482_16264 244
297 3300048916 Ga0496113_0017103 Ga0496113_0017103_4008_4790 244
298 3300048918 Ga0496115_0136432 Ga0496115_0136432_147_929 244
299 3300048920 Ga0496117_0016673 Ga0496117_0016673_2383_3165 244
300 3300048921 Ga0496118_0002360 Ga0496118_0002360_23184_23966 244
301 3300048922 Ga0496119_0039919 Ga0496119_0039919_1656_2438 244
302 3300048924 Ga0496121_0002356 Ga0496121_0002356_5345_6127 244
303 3300048924 Ga0496121_0019730 Ga0496121_0019730_1023_1805 244
304 3300048925 Ga0496122_0208663 Ga0496122_0208663_124_906 244
305 3300048926 Ga0496123_0027332 Ga0496123_0027332_282_1064 244
306 3300048929 Ga0496126_0272626 Ga0496126_0272626_488_1270 244
307 3300049569 Ga0501032_0005417 Ga0501032_0005417_7522_8292 244
308 3300049571 Ga0501034_0085163 Ga0501034_0085163_127_897 244
309 3300049572 Ga0501036_0030797 Ga0501036_0030797_1685_2455 244
310 3300049576 Ga0501040_0139108 Ga0501040_0139108_480_1247 244
311 3300049580 Ga0501046_0025545 Ga0501046_0025545_1083_1853 244
312 3300049584 Ga0501068_0028883 Ga0501068_0028883_1646_2416 244
313 3300049589 Ga0501073_0009834 Ga0501073_0009834_3636_4406 244
314 3300049590 Ga0501074_0255908 Ga0501074_0255908_428_1198 244
315 3300049742 Ga0501080_0030494 Ga0501080_0030494_1988_2758 244
316 3300050490 nmdc:mga03n38_142766_c1 nmdc:mga03n38_142766_c1_381_1166 244
317 3300050492 nmdc:mga0yw44_125320_c1 nmdc:mga0yw44_125320_c1_870_1643 244
318 3300050494 nmdc:mga06z11_15822_c1 nmdc:mga06z11_15822_c1_1280_2065 244
319 3300050496 nmdc:mga07m45_19079_c1 nmdc:mga07m45_19079_c1_1972_2757 244
320 3300050507 nmdc:mga05p37_146985_c1 nmdc:mga05p37_146985_c1_2052_2837 244
321 3300050507 nmdc:mga05p37_196810_c1 nmdc:mga05p37_196810_c1_1596_2372 244
322 3300050508 nmdc:mga09592_290008_c1 nmdc:mga09592_290008_c1_327_1112 244
323 3300050511 nmdc:mga08y16_227442_c1 nmdc:mga08y16_227442_c1_936_1706 244
324 3300050511 nmdc:mga08y16_3634_c1 nmdc:mga08y16_3634_c1_11522_12307 244
325 3300050513 nmdc:mga0rr50_510903_c1 nmdc:mga0rr50_510903_c1_23_790 244
326 3300050514 nmdc:mga08x19_81_c1 nmdc:mga08x19_81_c1_58138_58905 244
327 3300053153 Ga0500616_0041381 Ga0500616_0041381_394_1164 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

44

270

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b5w-assembly1.cif.gz_C crystal structures of divalent metal dependent pyruvate aldolase r70a mutant, hpai, in complex with pyruvate 0.9702 4 243
7v8t-assembly1.cif.gz_F crystal structure of class ii pyruvate aldolase from pseudomonas aeruginosa. 0.9552 2 242
4b5x-assembly1.cif.gz_B crystal structures of divalent metal dependent pyruvate aldolase (hpai), mutant d42a 0.954 4 244
4b5w-assembly1.cif.gz_C crystal structures of divalent metal dependent pyruvate aldolase r70a mutant, hpai, in complex with pyruvate 0.9508 4 243
2vws-assembly1.cif.gz_A crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12 0.9507 1 243
ID Description Score Start End Superfamily
af_P76469_1_267_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9666 2 244 3.20.20.60
af_P76469_1_267_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9589 2 244 3.20.20.60
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.945 2 243 3.20.20.60
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9338 2 243 3.20.20.60
af_Q4CQY1_6_194_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9265 8 172 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A239G7X7-F1-model_v4 2,4-dihydroxyhept-2-enedioate aldolase 0.9741 1 241 GO:0005737
GO:0016832
AF-A0A210B2P2-F1-model_v4 deleted 0.9733 4 233
AF-A0A4Q3J8J3-F1-model_v4 4-hydroxy-2-oxoheptanedioate aldolase (EC 4.1.2.52) 0.9713 3 227 GO:0005737
GO:0010124
GO:0016832
AF-A0A6X7QF02-F1-model_v4 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase (EC 4.1.2.52) (2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase) (HHED aldolase) (4-hydroxy-2-ketoheptane-1,7-dioate aldolase) (HKHD aldolase) 0.9709 4 241 GO:0005737
GO:0010124
GO:0016832
GO:0046872
GO:1901023
AF-A0A3X9GIQ5-F1-model_v4 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase (EC 4.1.2.52) (2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase) (HHED aldolase) (4-hydroxy-2-ketoheptane-1,7-dioate aldolase) (HKHD aldolase) 0.9708 4 241 GO:0005737
GO:0010124
GO:0016832
GO:0046872
GO:1901023

Feature Viewer

pLDDT pTM Quality
92.63 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map