F408858

General Info

Members Datasets Scaffolds Average Seq Length
327 169 654 145

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10358014|Ga0307414_103580142
Length 172
Sequence MADIAPIIETLENRWMRAWASGDARTLKALTSRKFRMVVGTKPSVLLDCKSWLDGASSSFLCHSYRFGDIYARDLGGVTVFATQLDMEASIDGHEWSGRMWVTDLWRKSRVRRNWQMIERVISRPESDKQVAAAIRALQLWQRPAKRQALASSTSTHHSPSLRSATDIPSAS

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
118 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
119 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
120 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
121 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
124 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
125 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
151 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
152 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
153 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
154 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
155 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
156 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
157 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
158 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
159 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
160 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
161 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
164 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
165 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
166 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
167 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
168 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.75
Rhizosphere 97.25
Stem 0
Stem Tuber 0
Unclassified 13.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10358014 3300032004 Bacteria 1255
2 MBSR1b_contig_6903281 2162886012 Bacteria 1132
3 JGI24749J21850_1007968 3300002076 Bacteria 1474
4 JGI24033J26618_1013061 3300002155 Bacteria 1005
5 JGI24034J26672_10013805 3300002239 Bacteria 1228
6 Ga0065712_10806114 3300005290 Unclassified 509
7 Ga0065715_10007198 3300005293 Bacteria 4171
8 Ga0070658_10095744 3300005327 Bacteria 2451
9 Ga0070658_10099977 3300005327 Bacteria 2397
10 Ga0070676_10282407 3300005328 Bacteria 1119
11 Ga0070676_10617890 3300005328 Bacteria 783
12 Ga0070683_100249969 3300005329 Bacteria 1686
13 Ga0070690_100197492 3300005330 Bacteria 1398
14 Ga0070670_100002100 3300005331 Bacteria 16335
15 Ga0070677_10063434 3300005333 Bacteria 1532
16 Ga0070677_10396581 3300005333 Bacteria 726
17 Ga0070666_10110269 3300005335 Bacteria 1902
18 Ga0070660_100107282 3300005339 Bacteria 2219
19 Ga0070661_100019412 3300005344 Bacteria 4845
20 Ga0070661_100255323 3300005344 Unclassified 1354
21 Ga0070661_100279184 3300005344 Bacteria 1295
22 Ga0070668_100005256 3300005347 Bacteria 9604
23 Ga0070668_100098956 3300005347 Bacteria 2309
24 Ga0070668_100166679 3300005347 Bacteria 1791
25 Ga0070669_100026611 3300005353 Bacteria 4162
26 Ga0070669_101491404 3300005353 Unclassified 588
27 Ga0070675_100012981 3300005354 Bacteria 6541
28 Ga0070671_100012902 3300005355 Bacteria 6736
29 Ga0070671_100119775 3300005355 Bacteria 2215
30 Ga0070671_100670637 3300005355 Bacteria 898
31 Ga0070674_100009504 3300005356 Bacteria 5822
32 Ga0070674_100366678 3300005356 Bacteria 1168
33 Ga0070673_100010591 3300005364 Bacteria 6249
34 Ga0070659_100172988 3300005366 Bacteria 1770
35 Ga0070659_100188073 3300005366 Bacteria 1697
36 Ga0070667_100031405 3300005367 Bacteria 4430
37 Ga0070701_10180938 3300005438 Bacteria 1234
38 Ga0070663_100173949 3300005455 Bacteria 1666
39 Ga0070663_100316055 3300005455 Bacteria 1254
40 Ga0070678_100031327 3300005456 Bacteria 3667
41 Ga0070678_100119598 3300005456 Bacteria 2075
42 Ga0070662_100003052 3300005457 Bacteria 10409
43 Ga0070662_100423462 3300005457 Bacteria 1102
44 Ga0070662_101309734 3300005457 Bacteria 623
45 Ga0068867_100225414 3300005459 Bacteria 1512
46 Ga0070685_10218948 3300005466 Bacteria 1246
47 Ga0070684_100002906 3300005535 Bacteria 12729
48 Ga0068853_100048087 3300005539 Bacteria 3662
49 Ga0070672_100001472 3300005543 Bacteria 14619
50 Ga0070693_100068816 3300005547 Bacteria 2079
51 Ga0070665_100085692 3300005548 Unclassified 3156
52 Ga0070664_100232661 3300005564 Bacteria 1652
53 Ga0070664_100380401 3300005564 Bacteria 1288
54 Ga0068854_100108648 3300005578 Bacteria 2089
55 Ga0068852_100057084 3300005616 Bacteria 3376
56 Ga0068859_100019739 3300005617 Bacteria 6766
57 Ga0068859_100358666 3300005617 Bacteria 1553
58 Ga0068864_100017702 3300005618 Bacteria 5943
59 Ga0068864_100087525 3300005618 Bacteria 2742
60 Ga0068864_100089601 3300005618 Bacteria 2710
61 Ga0068861_100010248 3300005719 Bacteria 6506
62 Ga0068870_10041018 3300005840 Bacteria 2403
63 Ga0068870_10478143 3300005840 Unclassified 826
64 Ga0068863_100416559 3300005841 Bacteria 1316
65 Ga0068863_100436863 3300005841 Bacteria 1283
66 Ga0068860_100399773 3300005843 Bacteria 1359
67 Ga0068860_100975510 3300005843 Bacteria 865
68 Ga0068862_100007818 3300005844 Bacteria 8843
69 Ga0068862_100019002 3300005844 Bacteria 5730
70 Ga0068862_100063565 3300005844 Bacteria 3176
71 Ga0068862_101117520 3300005844 Bacteria 784
72 Ga0068871_100387303 3300006358 Bacteria 1243
73 Ga0075431_100888336 3300006847 Unclassified 861
74 Ga0097620_100019739 3300006931 Bacteria 6766
75 Ga0097620_100358661 3300006931 Bacteria 1553
76 Ga0105250_10358056 3300009092 Unclassified 640
77 Ga0111539_10036148 3300009094 Bacteria 5975
78 Ga0111539_11435934 3300009094 Bacteria 800
79 Ga0105248_10090729 3300009177 Bacteria 3441
80 Ga0105248_10318776 3300009177 Bacteria 1751
81 Ga0105248_11237477 3300009177 Unclassified 844
82 Ga0105238_11148702 3300009551 Unclassified 800
83 Ga0105249_10015431 3300009553 Bacteria 6761
84 Ga0105249_10539852 3300009553 Bacteria 1215
85 Ga0157371_10065643 3300013102 Bacteria 2570
86 Ga0157370_10141676 3300013104 Unclassified 2240
87 Ga0157370_10479014 3300013104 Unclassified 1144
88 Ga0157369_10048768 3300013105 Bacteria 4594
89 Ga0157369_10126287 3300013105 Bacteria 2712
90 Ga0157372_10298838 3300013307 Bacteria 1873
91 Ga0157372_10458011 3300013307 Bacteria 1486
92 Ga0157375_10326432 3300013308 Bacteria 1699
93 Ga0157375_10524138 3300013308 Bacteria 1348
94 Ga0157380_10042557 3300014326 Bacteria 3550
95 Ga0157380_10257544 3300014326 Bacteria 1583
96 Ga0157380_10794567 3300014326 Bacteria 963
97 Ga0163161_10018444 3300017792 Bacteria 4890
98 Ga0163161_10607645 3300017792 Unclassified 902
99 Ga0206356_10789442 3300020070 Unclassified 909
100 Ga0207697_10002575 3300025315 Bacteria 9336
101 Ga0207697_10068336 3300025315 Bacteria 1487
102 Ga0207682_10092013 3300025893 Bacteria 1316
103 Ga0207688_10223038 3300025901 Bacteria 1136
104 Ga0207645_10002599 3300025907 Bacteria 14084
105 Ga0207643_10158664 3300025908 Bacteria 1360
106 Ga0207705_10147301 3300025909 Bacteria 1762
107 Ga0207705_10242678 3300025909 Bacteria 1373
108 Ga0207705_10908014 3300025909 Bacteria 682
109 Ga0207657_10255608 3300025919 Unclassified 1395
110 Ga0207649_10132901 3300025920 Bacteria 1693
111 Ga0207652_11418035 3300025921 Unclassified 598
112 Ga0207652_11883555 3300025921 Unclassified 503
113 Ga0207681_10165677 3300025923 Bacteria 1670
114 Ga0207650_10080083 3300025925 Bacteria 2475
115 Ga0207650_10091798 3300025925 Bacteria 2321
116 Ga0207659_10083314 3300025926 Bacteria 2370
117 Ga0207644_10013594 3300025931 Bacteria 5432
118 Ga0207644_10392714 3300025931 Bacteria 1133
119 Ga0207690_10069602 3300025932 Bacteria 2421
120 Ga0207690_10175453 3300025932 Bacteria 1609
121 Ga0207706_10001747 3300025933 Bacteria 21319
122 Ga0207706_10002443 3300025933 Bacteria 18135
123 Ga0207669_10021944 3300025937 Bacteria 3382
124 Ga0207669_10307474 3300025937 Bacteria 1208
125 Ga0207691_10002544 3300025940 Bacteria 17820
126 Ga0207691_10138052 3300025940 Bacteria 2149
127 Ga0207661_10115477 3300025944 Bacteria 2277
128 Ga0207661_10559780 3300025944 Unclassified 1048
129 Ga0207679_10456419 3300025945 Bacteria 1134
130 Ga0207667_10301322 3300025949 Bacteria 1638
131 Ga0207651_10045921 3300025960 Bacteria 2933
132 Ga0207651_10049202 3300025960 Bacteria 2854
133 Ga0207712_10400017 3300025961 Bacteria 1154
134 Ga0207712_10811610 3300025961 Bacteria 823
135 Ga0207668_10084396 3300025972 Bacteria 2314
136 Ga0207668_10153541 3300025972 Bacteria 1785
137 Ga0207668_10555084 3300025972 Bacteria 995
138 Ga0207640_10319009 3300025981 Bacteria 1236
139 Ga0207640_10335237 3300025981 Bacteria 1209
140 Ga0207658_10030093 3300025986 Bacteria 3841
141 Ga0207703_10231245 3300026035 Bacteria 1657
142 Ga0207639_10050361 3300026041 Bacteria 3163
143 Ga0207678_10041808 3300026067 Bacteria 3973
144 Ga0207702_10468058 3300026078 Bacteria 1225
145 Ga0207641_10434594 3300026088 Bacteria 1266
146 Ga0207648_10120250 3300026089 Bacteria 2309
147 Ga0207648_10872454 3300026089 Bacteria 840
148 Ga0207676_10006149 3300026095 Bacteria 8476
149 Ga0207676_10058467 3300026095 Bacteria 3041
150 Ga0207675_100003939 3300026118 Bacteria 14410
151 Ga0207683_10152227 3300026121 Bacteria 2088
152 Ga0207683_10306161 3300026121 Bacteria 1454
153 Ga0209974_10007775 3300027876 Bacteria 3685
154 Ga0268265_10010848 3300028380 Bacteria 6154
155 Ga0268265_10041561 3300028380 Bacteria 3404
156 Ga0268265_10304598 3300028380 Bacteria 1436
157 Ga0268265_10975279 3300028380 Unclassified 836
158 Ga0268265_11732499 3300028380 Unclassified 631
159 Ga0268264_10740595 3300028381 Bacteria 978
160 Ga0268264_10865149 3300028381 Bacteria 906
161 Ga0316182_1241446 3300030745 Bacteria 1677
162 Ga0307408_100387080 3300031548 Bacteria 1197
163 Ga0307408_100943813 3300031548 Bacteria 792
164 Ga0307405_10060769 3300031731 Bacteria 2385
165 Ga0307405_10351312 3300031731 Bacteria 1137
166 Ga0307405_10416706 3300031731 Bacteria 1056
167 Ga0307405_10559329 3300031731 Bacteria 927
168 Ga0307405_10692424 3300031731 Bacteria 843
169 Ga0307405_10909414 3300031731 Unclassified 745
170 Ga0307405_11007367 3300031731 Bacteria 711
171 Ga0307413_10025802 3300031824 Bacteria 3228
172 Ga0307413_10043343 3300031824 Bacteria 2651
173 Ga0307413_10067204 3300031824 Bacteria 2240
174 Ga0307413_10067946 3300031824 Bacteria 2230
175 Ga0307413_10154929 3300031824 Bacteria 1601
176 Ga0307413_10250991 3300031824 Bacteria 1312
177 Ga0307413_11493456 3300031824 Bacteria 597
178 Ga0307410_10006235 3300031852 Bacteria 6417
179 Ga0307410_10030449 3300031852 Bacteria 3449
180 Ga0307410_10051207 3300031852 Bacteria 2781
181 Ga0307410_10115071 3300031852 Bacteria 1952
182 Ga0307410_10138810 3300031852 Bacteria 1795
183 Ga0307410_10152124 3300031852 Bacteria 1724
184 Ga0307410_10196800 3300031852 Unclassified 1536
185 Ga0307410_10833398 3300031852 Bacteria 786
186 Ga0307410_11220729 3300031852 Unclassified 655
187 Ga0307406_10067115 3300031901 Bacteria 2337
188 Ga0307406_10149012 3300031901 Bacteria 1666
189 Ga0307406_10367835 3300031901 Bacteria 1129
190 Ga0307406_10811825 3300031901 Bacteria 790
191 Ga0307407_10021430 3300031903 Bacteria 3332
192 Ga0307407_10022579 3300031903 Bacteria 3267
193 Ga0307407_10042612 3300031903 Bacteria 2546
194 Ga0307407_10060830 3300031903 Bacteria 2205
195 Ga0307407_10126672 3300031903 Bacteria 1627
196 Ga0307412_10068170 3300031911 Bacteria 2418
197 Ga0307412_10139976 3300031911 Bacteria 1770
198 Ga0307412_10306420 3300031911 Bacteria 1258
199 Ga0307412_10406846 3300031911 Bacteria 1109
200 Ga0307412_12043828 3300031911 Unclassified 531
201 Ga0307409_100018285 3300031995 Bacteria 4706
202 Ga0307409_100046242 3300031995 Bacteria 3293
203 Ga0307409_100052531 3300031995 Bacteria 3126
204 Ga0307409_100089124 3300031995 Bacteria 2521
205 Ga0307409_100116005 3300031995 Bacteria 2256
206 Ga0307409_100138129 3300031995 Unclassified 2095
207 Ga0307409_100551583 3300031995 Bacteria 1131
208 Ga0307409_100988551 3300031995 Bacteria 859
209 Ga0307409_101223345 3300031995 Unclassified 775
210 Ga0307409_101533657 3300031995 Bacteria 694
211 Ga0307416_100033999 3300032002 Bacteria 3873
212 Ga0307416_100112485 3300032002 Bacteria 2403
213 Ga0307416_100205941 3300032002 Bacteria 1871
214 Ga0307416_100270201 3300032002 Bacteria 1668
215 Ga0307416_100281363 3300032002 Unclassified 1640
216 Ga0307416_100333725 3300032002 Bacteria 1525
217 Ga0307416_100480033 3300032002 Bacteria 1303
218 Ga0307416_101117632 3300032002 Bacteria 893
219 Ga0307414_10020509 3300032004 Bacteria 4121
220 Ga0307414_10059073 3300032004 Bacteria 2705
221 Ga0307414_10069466 3300032004 Bacteria 2532
222 Ga0307414_10146376 3300032004 Unclassified 1857
223 Ga0307414_10212848 3300032004 Bacteria 1581
224 Ga0307414_10253407 3300032004 Bacteria 1464
225 Ga0307414_10358813 3300032004 Bacteria 1253
226 Ga0307414_10378569 3300032004 Bacteria 1223
227 Ga0307414_10907136 3300032004 Unclassified 808
228 Ga0307411_10053928 3300032005 Bacteria 2637
229 Ga0307411_10072633 3300032005 Bacteria 2337
230 Ga0307411_10141541 3300032005 Bacteria 1774
231 Ga0307411_10183208 3300032005 Bacteria 1591
232 Ga0307411_10187338 3300032005 Unclassified 1576
233 Ga0307411_10207649 3300032005 Bacteria 1509
234 Ga0307411_10214203 3300032005 Unclassified 1489
235 Ga0307411_10270955 3300032005 Bacteria 1346
236 Ga0307411_10861105 3300032005 Bacteria 802
237 Ga0307415_100003404 3300032126 Bacteria 8095
238 Ga0307415_100154860 3300032126 Bacteria 1768
239 Ga0307415_100177751 3300032126 Bacteria 1666
240 Ga0307415_100334865 3300032126 Bacteria 1268
241 Ga0307415_100614826 3300032126 Bacteria 969
242 Ga0307415_100838911 3300032126 Bacteria 842
243 Ga0395899_0090373 3300037312 Bacteria 2220
244 Ga0395899_0112240 3300037312 Bacteria 1958
245 Ga0395900_0000336 3300037418 Bacteria 69212
246 Ga0395900_0014927 3300037418 Bacteria 7916
247 Ga0395900_1249333 3300037418 Unclassified 657
248 Ga0395898_0201402 3300037466 Bacteria 1900
249 Ga0395905_0207558 3300037471 Bacteria 1836
250 Ga0395901_0002173 3300038443 Bacteria 20032
251 Ga0395901_0042338 3300038443 Bacteria 4721
252 Ga0439449_0013779 3300042007 Bacteria 3042
253 Ga0439450_017611 3300042008 Bacteria 1492
254 Ga0450914_002394 3300042118 Archaea 1334
255 Ga0450920_033228 3300042122 Bacteria 1019
256 Ga0450892_015584 3300042130 Bacteria 710
257 Ga0439446_0149093 3300042156 Bacteria 768
258 Ga0439434_0147662 3300042435 Bacteria 777
259 Ga0439464_0017031 3300042439 Bacteria 1968
260 Ga0439460_0361523 3300042461 Unclassified 512
261 Ga0450916_051011 3300042530 Bacteria 652
262 Ga0466963_0266418 3300044694 Bacteria 1203
263 Ga0466963_0635664 3300044694 Bacteria 753
264 Ga0466957_0024259 3300044842 Bacteria 3588
265 Ga0466957_0099978 3300044842 Bacteria 1827
266 Ga0466958_0010858 3300045836 Bacteria 5113
267 Ga0466958_0626284 3300045836 Bacteria 700
268 Ga0466967_0004438 3300045976 Bacteria 9460
269 Ga0466967_0021364 3300045976 Bacteria 5255
270 Ga0466967_0035005 3300045976 Bacteria 4269
271 Ga0466967_0496108 3300045976 Bacteria 1198
272 Ga0466967_0678090 3300045976 Bacteria 1020
273 Ga0466967_1134074 3300045976 Unclassified 779
274 Ga0466967_1530652 3300045976 Unclassified 664
275 Ga0495596_0322604 3300046500 Unclassified 601
276 Ga0495583_0251291 3300046506 Unclassified 709
277 Ga0495663_0004740 3300046525 Bacteria 3806
278 Ga0495663_0011162 3300046525 Bacteria 2500
279 Ga0495663_0029544 3300046525 Bacteria 1619
280 Ga0495663_0042571 3300046525 Bacteria 1385
281 Ga0495663_0083423 3300046525 Bacteria 1032
282 Ga0495598_0030811 3300046537 Bacteria 1505
283 Ga0495621_0000052 3300046539 Bacteria 22615
284 Ga0495621_0001674 3300046539 Bacteria 5814
285 Ga0495621_0266956 3300046539 Bacteria 702
286 Ga0495669_0602905 3300046684 Bacteria 534
287 Ga0495670_0011890 3300046691 Bacteria 4283
288 Ga0495670_0129202 3300046691 Bacteria 1316
289 Ga0495677_0006241 3300047445 Bacteria 4500
290 Ga0495677_0039772 3300047445 Bacteria 1719
291 Ga0495677_0094204 3300047445 Unclassified 1130
292 Ga0495677_0111449 3300047445 Bacteria 1040
293 Ga0496102_0851257 3300048905 Unclassified 834
294 Ga0496107_0302741 3300048910 Bacteria 1190
295 Ga0496107_0622428 3300048910 Unclassified 797
296 Ga0496108_0186294 3300048911 Bacteria 1798
297 Ga0496109_0388714 3300048912 Bacteria 1318
298 Ga0496109_0919581 3300048912 Unclassified 813
299 Ga0496110_0605151 3300048913 Unclassified 994
300 Ga0496111_0506045 3300048914 Bacteria 889
301 Ga0496112_0063029 3300048915 Bacteria 3657
302 Ga0501067_0287332 3300049583 Bacteria 916
303 Ga0501070_0435999 3300049586 Unclassified 1057
304 Ga0501071_0727475 3300049587 Bacteria 764
305 Ga0501073_0919875 3300049589 Bacteria 602
306 Ga0501074_0321610 3300049590 Bacteria 1099
307 Ga0501198_100188 3300049649 Unclassified 586
308 Ga0501199_008851 3300049650 Bacteria 1059
309 Ga0501209_075161 3300049656 Bacteria 967
310 Ga0501217_009052 3300049661 Bacteria 2159
311 Ga0501235_011560 3300049669 Bacteria 1936
312 Ga0501236_020566 3300049670 Bacteria 972
313 Ga0501242_010973 3300049674 Bacteria 1088
314 Ga0501242_011781 3300049674 Bacteria 1059
315 Ga0501247_012026 3300049677 Bacteria 1049
316 Ga0501249_050844 3300049679 Bacteria 951
317 Ga0501258_039005 3300049687 Unclassified 628
318 Ga0501259_055135 3300049688 Unclassified 817
319 Ga0501221_030356 3300049704 Bacteria 1123
320 Ga0501225_0009307 3300049705 Bacteria 2800
321 Ga0501229_006587 3300049706 Bacteria 1438
322 Ga0501262_004600 3300049759 Bacteria 1605
323 Ga0501268_012267 3300049765 Bacteria 1367
324 Ga0501270_074022 3300049767 Bacteria 664
325 Ga0501271_027778 3300049768 Bacteria 686
326 Ga0501273_010968 3300049770 Bacteria 1122
327 Ga0501045_0509345 3300049824 Bacteria 894
328 Ga0307414_10358014
329 MBSR1b_contig_6903281
330 JGI24749J21850_1007968
331 JGI24033J26618_1013061
332 JGI24034J26672_10013805
333 Ga0065712_10806114
334 Ga0065715_10007198
335 Ga0070658_10095744
336 Ga0070658_10099977
337 Ga0070676_10282407
338 Ga0070676_10617890
339 Ga0070683_100249969
340 Ga0070690_100197492
341 Ga0070670_100002100
342 Ga0070677_10063434
343 Ga0070677_10396581
344 Ga0070666_10110269
345 Ga0070660_100107282
346 Ga0070661_100019412
347 Ga0070661_100255323
348 Ga0070661_100279184
349 Ga0070668_100005256
350 Ga0070668_100098956
351 Ga0070668_100166679
352 Ga0070669_100026611
353 Ga0070669_101491404
354 Ga0070675_100012981
355 Ga0070671_100012902
356 Ga0070671_100119775
357 Ga0070671_100670637
358 Ga0070674_100009504
359 Ga0070674_100366678
360 Ga0070673_100010591
361 Ga0070659_100172988
362 Ga0070659_100188073
363 Ga0070667_100031405
364 Ga0070701_10180938
365 Ga0070663_100173949
366 Ga0070663_100316055
367 Ga0070678_100031327
368 Ga0070678_100119598
369 Ga0070662_100003052
370 Ga0070662_100423462
371 Ga0070662_101309734
372 Ga0068867_100225414
373 Ga0070685_10218948
374 Ga0070684_100002906
375 Ga0068853_100048087
376 Ga0070672_100001472
377 Ga0070693_100068816
378 Ga0070665_100085692
379 Ga0070664_100232661
380 Ga0070664_100380401
381 Ga0068854_100108648
382 Ga0068852_100057084
383 Ga0068859_100019739
384 Ga0068859_100358666
385 Ga0068864_100017702
386 Ga0068864_100087525
387 Ga0068864_100089601
388 Ga0068861_100010248
389 Ga0068870_10041018
390 Ga0068870_10478143
391 Ga0068863_100416559
392 Ga0068863_100436863
393 Ga0068860_100399773
394 Ga0068860_100975510
395 Ga0068862_100007818
396 Ga0068862_100019002
397 Ga0068862_100063565
398 Ga0068862_101117520
399 Ga0068871_100387303
400 Ga0075431_100888336
401 Ga0097620_100019739
402 Ga0097620_100358661
403 Ga0105250_10358056
404 Ga0111539_10036148
405 Ga0111539_11435934
406 Ga0105248_10090729
407 Ga0105248_10318776
408 Ga0105248_11237477
409 Ga0105238_11148702
410 Ga0105249_10015431
411 Ga0105249_10539852
412 Ga0157371_10065643
413 Ga0157370_10141676
414 Ga0157370_10479014
415 Ga0157369_10048768
416 Ga0157369_10126287
417 Ga0157372_10298838
418 Ga0157372_10458011
419 Ga0157375_10326432
420 Ga0157375_10524138
421 Ga0157380_10042557
422 Ga0157380_10257544
423 Ga0157380_10794567
424 Ga0163161_10018444
425 Ga0163161_10607645
426 Ga0206356_10789442
427 Ga0207697_10002575
428 Ga0207697_10068336
429 Ga0207682_10092013
430 Ga0207688_10223038
431 Ga0207645_10002599
432 Ga0207643_10158664
433 Ga0207705_10147301
434 Ga0207705_10242678
435 Ga0207705_10908014
436 Ga0207657_10255608
437 Ga0207649_10132901
438 Ga0207652_11418035
439 Ga0207652_11883555
440 Ga0207681_10165677
441 Ga0207650_10080083
442 Ga0207650_10091798
443 Ga0207659_10083314
444 Ga0207644_10013594
445 Ga0207644_10392714
446 Ga0207690_10069602
447 Ga0207690_10175453
448 Ga0207706_10001747
449 Ga0207706_10002443
450 Ga0207669_10021944
451 Ga0207669_10307474
452 Ga0207691_10002544
453 Ga0207691_10138052
454 Ga0207661_10115477
455 Ga0207661_10559780
456 Ga0207679_10456419
457 Ga0207667_10301322
458 Ga0207651_10045921
459 Ga0207651_10049202
460 Ga0207712_10400017
461 Ga0207712_10811610
462 Ga0207668_10084396
463 Ga0207668_10153541
464 Ga0207668_10555084
465 Ga0207640_10319009
466 Ga0207640_10335237
467 Ga0207658_10030093
468 Ga0207703_10231245
469 Ga0207639_10050361
470 Ga0207678_10041808
471 Ga0207702_10468058
472 Ga0207641_10434594
473 Ga0207648_10120250
474 Ga0207648_10872454
475 Ga0207676_10006149
476 Ga0207676_10058467
477 Ga0207675_100003939
478 Ga0207683_10152227
479 Ga0207683_10306161
480 Ga0209974_10007775
481 Ga0268265_10010848
482 Ga0268265_10041561
483 Ga0268265_10304598
484 Ga0268265_10975279
485 Ga0268265_11732499
486 Ga0268264_10740595
487 Ga0268264_10865149
488 Ga0316182_1241446
489 Ga0307408_100387080
490 Ga0307408_100943813
491 Ga0307405_10060769
492 Ga0307405_10351312
493 Ga0307405_10416706
494 Ga0307405_10559329
495 Ga0307405_10692424
496 Ga0307405_10909414
497 Ga0307405_11007367
498 Ga0307413_10025802
499 Ga0307413_10043343
500 Ga0307413_10067204
501 Ga0307413_10067946
502 Ga0307413_10154929
503 Ga0307413_10250991
504 Ga0307413_11493456
505 Ga0307410_10006235
506 Ga0307410_10030449
507 Ga0307410_10051207
508 Ga0307410_10115071
509 Ga0307410_10138810
510 Ga0307410_10152124
511 Ga0307410_10196800
512 Ga0307410_10833398
513 Ga0307410_11220729
514 Ga0307406_10067115
515 Ga0307406_10149012
516 Ga0307406_10367835
517 Ga0307406_10811825
518 Ga0307407_10021430
519 Ga0307407_10022579
520 Ga0307407_10042612
521 Ga0307407_10060830
522 Ga0307407_10126672
523 Ga0307412_10068170
524 Ga0307412_10139976
525 Ga0307412_10306420
526 Ga0307412_10406846
527 Ga0307412_12043828
528 Ga0307409_100018285
529 Ga0307409_100046242
530 Ga0307409_100052531
531 Ga0307409_100089124
532 Ga0307409_100116005
533 Ga0307409_100138129
534 Ga0307409_100551583
535 Ga0307409_100988551
536 Ga0307409_101223345
537 Ga0307409_101533657
538 Ga0307416_100033999
539 Ga0307416_100112485
540 Ga0307416_100205941
541 Ga0307416_100270201
542 Ga0307416_100281363
543 Ga0307416_100333725
544 Ga0307416_100480033
545 Ga0307416_101117632
546 Ga0307414_10020509
547 Ga0307414_10059073
548 Ga0307414_10069466
549 Ga0307414_10146376
550 Ga0307414_10212848
551 Ga0307414_10253407
552 Ga0307414_10358813
553 Ga0307414_10378569
554 Ga0307414_10907136
555 Ga0307411_10053928
556 Ga0307411_10072633
557 Ga0307411_10141541
558 Ga0307411_10183208
559 Ga0307411_10187338
560 Ga0307411_10207649
561 Ga0307411_10214203
562 Ga0307411_10270955
563 Ga0307411_10861105
564 Ga0307415_100003404
565 Ga0307415_100154860
566 Ga0307415_100177751
567 Ga0307415_100334865
568 Ga0307415_100614826
569 Ga0307415_100838911
570 Ga0395899_0090373
571 Ga0395899_0112240
572 Ga0395900_0000336
573 Ga0395900_0014927
574 Ga0395900_1249333
575 Ga0395898_0201402
576 Ga0395905_0207558
577 Ga0395901_0002173
578 Ga0395901_0042338
579 Ga0439449_0013779
580 Ga0439450_017611
581 Ga0450914_002394
582 Ga0450920_033228
583 Ga0450892_015584
584 Ga0439446_0149093
585 Ga0439434_0147662
586 Ga0439464_0017031
587 Ga0439460_0361523
588 Ga0450916_051011
589 Ga0466963_0266418
590 Ga0466963_0635664
591 Ga0466957_0024259
592 Ga0466957_0099978
593 Ga0466958_0010858
594 Ga0466958_0626284
595 Ga0466967_0004438
596 Ga0466967_0021364
597 Ga0466967_0035005
598 Ga0466967_0496108
599 Ga0466967_0678090
600 Ga0466967_1134074
601 Ga0466967_1530652
602 Ga0495596_0322604
603 Ga0495583_0251291
604 Ga0495663_0004740
605 Ga0495663_0011162
606 Ga0495663_0029544
607 Ga0495663_0042571
608 Ga0495663_0083423
609 Ga0495598_0030811
610 Ga0495621_0000052
611 Ga0495621_0001674
612 Ga0495621_0266956
613 Ga0495669_0602905
614 Ga0495670_0011890
615 Ga0495670_0129202
616 Ga0495677_0006241
617 Ga0495677_0039772
618 Ga0495677_0094204
619 Ga0495677_0111449
620 Ga0496102_0851257
621 Ga0496107_0302741
622 Ga0496107_0622428
623 Ga0496108_0186294
624 Ga0496109_0388714
625 Ga0496109_0919581
626 Ga0496110_0605151
627 Ga0496111_0506045
628 Ga0496112_0063029
629 Ga0501067_0287332
630 Ga0501070_0435999
631 Ga0501071_0727475
632 Ga0501073_0919875
633 Ga0501074_0321610
634 Ga0501198_100188
635 Ga0501199_008851
636 Ga0501209_075161
637 Ga0501217_009052
638 Ga0501235_011560
639 Ga0501236_020566
640 Ga0501242_010973
641 Ga0501242_011781
642 Ga0501247_012026
643 Ga0501249_050844
644 Ga0501258_039005
645 Ga0501259_055135
646 Ga0501221_030356
647 Ga0501225_0009307
648 Ga0501229_006587
649 Ga0501262_004600
650 Ga0501268_012267
651 Ga0501270_074022
652 Ga0501271_027778
653 Ga0501273_010968
654 Ga0501045_0509345

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

8

117

0.92

PF13474

SnoaL_3

SnoaL-like domain

8

127

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r4i-assembly1.cif.gz_B crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution 0.9006 6 125
3fsd-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function in nutrient uptake (yp_427473.1) from rhodospirillum rubrum atcc 11170 at 1.70 a resolution 0.888 8 126
3fsd-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function in nutrient uptake (yp_427473.1) from rhodospirillum rubrum atcc 11170 at 1.70 a resolution 0.8677 8 126
2r4i-assembly1.cif.gz_B crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution 0.8658 6 125
3ksp-assembly1.cif.gz_A-2 crystal structure of a putative ca/calmodulin-dependent kinase ii association domain (exig_1688) from exiguobacterium sibiricum 255-15 at 2.59 a resolution 0.8642 8 126
ID Description Score Start End Superfamily
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8918 3 125 3.10.450.50
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8849 3 125 3.10.450.50
3fsdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8831 8 126 3.10.450.50
3fsdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8628 8 126 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.817 8 126 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A6J4S4W9-F1-model_v4 DUF4440 domain-containing protein 0.9777 1 142
AF-A0A316JZQ3-F1-model_v4 DUF4440 domain-containing protein 0.9749 17 142
AF-A0A848YJV3-F1-model_v4 Nuclear transport factor 2 family protein 0.9733 1 142
AF-A0A6J4S4W9-F1-model_v4 DUF4440 domain-containing protein 0.9709 1 142
AF-A0A848YJV3-F1-model_v4 Nuclear transport factor 2 family protein 0.9666 1 142

Map