F408839

General Info

Members Datasets Scaffolds Average Seq Length
327 193 654 357

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10083192|Ga0265338_100831924
Length 403
Sequence MGRKVRIGCGAVDRVLLWFSRRLLSANSARRVFPTASNERNWIMTQIAQLLGDKADFLLNFKNAKISKDRLHLPGPDFVDRIFSVSDRNNRVLGNLQRLFGHGRLGGTGYVSILPVDQGIEHSAGASFAKNPDYFDAENIVKLAIEGGCNAVASTYGVLGAVARKYAHKIPFLVKINHNELLTYPNKADQIMFGTLKEAADMGCAAVGATIYFGSDNSGRQIVEVAQAFAHAHELGMATVLWCYLRNNAFKIKGADGKTTDYHVSADLTGQANHLGVTIQADIIKQKLPENNGGFKALNTGSSSYGKLDERIYTELTSDHPIDLCRYQVANCYMGRAGLINSGGESKGQGDLEQAVATAVINKRAGGMGLISGRKAFQRPMNEGIGLLNAIQDVYLSKEITVA

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
103 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
109 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
121 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0
Rhizoplane 1.53
Rhizosphere 95.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10083192 3300028800 Bacteria 2678
2 JGI25406J46586_10000491 3300003203 Bacteria 18498
3 Ga0070658_10067024 3300005327 Bacteria 2933
4 Ga0070658_10245454 3300005327 Bacteria 1518
5 Ga0070683_100371004 3300005329 Bacteria 1363
6 Ga0070690_100142307 3300005330 Bacteria 1629
7 Ga0068869_100074550 3300005334 Bacteria 2519
8 Ga0070666_10012590 3300005335 Bacteria 5341
9 Ga0070682_100001610 3300005337 Bacteria 12575
10 Ga0070689_100064008 3300005340 Bacteria 2862
11 Ga0070689_100093800 3300005340 Bacteria 2369
12 Ga0070669_100023292 3300005353 Bacteria 4434
13 Ga0070669_100085156 3300005353 Bacteria 2360
14 Ga0070675_100262151 3300005354 Bacteria 1515
15 Ga0070675_100292786 3300005354 Bacteria 1433
16 Ga0070667_100092603 3300005367 Bacteria 2601
17 Ga0070709_10018495 3300005434 Bacteria 4014
18 Ga0070709_10024761 3300005434 Bacteria 3537
19 Ga0070709_10064467 3300005434 Bacteria 2343
20 Ga0070713_100054592 3300005436 Bacteria 3315
21 Ga0070710_10107903 3300005437 Bacteria 1668
22 Ga0070711_100001310 3300005439 Bacteria 13536
23 Ga0070711_100012449 3300005439 Bacteria 5315
24 Ga0070711_100116359 3300005439 Bacteria 1970
25 Ga0070705_100000809 3300005440 Bacteria 17643
26 Ga0070694_100003444 3300005444 Bacteria 9478
27 Ga0070694_100053379 3300005444 Bacteria 2735
28 Ga0070708_100001390 3300005445 Bacteria 18506
29 Ga0070681_10098441 3300005458 Bacteria 2871
30 Ga0070685_10045814 3300005466 Bacteria 2509
31 Ga0070685_10052555 3300005466 Bacteria 2358
32 Ga0070706_100005742 3300005467 Bacteria 11796
33 Ga0070706_100023120 3300005467 Bacteria 5724
34 Ga0070707_100001445 3300005468 Bacteria 23270
35 Ga0070707_100132002 3300005468 Bacteria 2429
36 Ga0070707_100209083 3300005468 Bacteria 1902
37 Ga0070698_100009647 3300005471 Bacteria 10327
38 Ga0070698_100016768 3300005471 Bacteria 7727
39 Ga0070698_100141057 3300005471 Bacteria 2361
40 Ga0070699_100003987 3300005518 Bacteria 13044
41 Ga0070699_100033311 3300005518 Bacteria 4451
42 Ga0070699_100036476 3300005518 Bacteria 4253
43 Ga0070679_100039500 3300005530 Bacteria 4690
44 Ga0070697_100000970 3300005536 Bacteria 21656
45 Ga0070697_100023960 3300005536 Bacteria 4857
46 Ga0070697_100123401 3300005536 Bacteria 2168
47 Ga0070695_100027224 3300005545 Bacteria 3540
48 Ga0070696_100001149 3300005546 Bacteria 17168
49 Ga0070693_100000054 3300005547 Bacteria 43910
50 Ga0070665_100000646 3300005548 Bacteria 47132
51 Ga0070665_100001280 3300005548 Bacteria 30114
52 Ga0070704_100001852 3300005549 Bacteria 11659
53 Ga0070704_100350500 3300005549 Bacteria 1246
54 Ga0068855_100228826 3300005563 Bacteria 2083
55 Ga0068852_100225491 3300005616 Bacteria 1784
56 Ga0068859_100008465 3300005617 Bacteria 10412
57 Ga0068859_100036346 3300005617 Bacteria 4945
58 Ga0068864_100187623 3300005618 Bacteria 1894
59 Ga0068863_100000904 3300005841 Bacteria 29860
60 Ga0068858_100044787 3300005842 Bacteria 4101
61 Ga0068860_100007339 3300005843 Bacteria 11018
62 Ga0068860_100078644 3300005843 Bacteria 3136
63 Ga0068862_100000277 3300005844 Bacteria 57064
64 Ga0068862_100004902 3300005844 Bacteria 11273
65 Ga0075368_10002975 3300006042 Bacteria 5595
66 Ga0070716_100000535 3300006173 Bacteria 15881
67 Ga0070716_100000571 3300006173 Bacteria 15416
68 Ga0070716_100050863 3300006173 Bacteria 2354
69 Ga0070716_100056299 3300006173 Bacteria 2254
70 Ga0075367_10000891 3300006178 Bacteria 12009
71 Ga0075428_100011793 3300006844 Bacteria 9729
72 Ga0075428_100206543 3300006844 Bacteria 2123
73 Ga0075431_100000713 3300006847 Bacteria 28662
74 Ga0075431_100056172 3300006847 Bacteria 4061
75 Ga0075433_10098590 3300006852 Bacteria 2587
76 Ga0075434_100029665 3300006871 Bacteria 5383
77 Ga0075434_100053239 3300006871 Bacteria 4022
78 Ga0075434_100244385 3300006871 Bacteria 1815
79 Ga0075429_100018034 3300006880 Bacteria 6105
80 Ga0075436_100022103 3300006914 Bacteria 4369
81 Ga0097620_100008465 3300006931 Bacteria 10412
82 Ga0097620_100036346 3300006931 Bacteria 4945
83 Ga0097620_100055662 3300006931 Bacteria 3979
84 Ga0075435_100157449 3300007076 Bacteria 1912
85 Ga0075435_100256314 3300007076 Bacteria 1490
86 Ga0099794_10050573 3300007265 Bacteria 1999
87 Ga0099794_10056433 3300007265 Bacteria 1900
88 Ga0099794_10071432 3300007265 Bacteria 1701
89 Ga0099794_10096379 3300007265 Bacteria 1473
90 Ga0099795_10003772 3300007788 Bacteria 3806
91 Ga0099795_10033658 3300007788 Bacteria 1781
92 Ga0099795_10050020 3300007788 Bacteria 1518
93 Ga0105240_10007044 3300009093 Bacteria 16399
94 Ga0105240_10025455 3300009093 Bacteria 7775
95 Ga0105240_10064244 3300009093 Bacteria 4561
96 Ga0111539_10035231 3300009094 Bacteria 6062
97 Ga0105245_10241414 3300009098 Bacteria 1751
98 Ga0114129_10004747 3300009147 Bacteria 19200
99 Ga0114129_10009011 3300009147 Bacteria 14229
100 Ga0114129_10011070 3300009147 Bacteria 12851
101 Ga0114129_10086468 3300009147 Bacteria 4349
102 Ga0105248_10072079 3300009177 Bacteria 3882
103 Ga0105237_10195156 3300009545 Bacteria 2024
104 Ga0105238_10105935 3300009551 Bacteria 2793
105 Ga0105249_10169134 3300009553 Bacteria 2118
106 Ga0105249_10242848 3300009553 Bacteria 1781
107 Ga0099796_10002206 3300010159 Bacteria 4217
108 Ga0099796_10015951 3300010159 Bacteria 2209
109 Ga0157378_10000056 3300013297 Bacteria 96875
110 Ga0163162_10102691 3300013306 Bacteria 2953
111 Ga0157372_10125235 3300013307 Bacteria 2954
112 Ga0157375_10021188 3300013308 Bacteria 5954
113 Ga0157380_10208123 3300014326 Bacteria 1741
114 Ga0157379_10159428 3300014968 Bacteria 2036
115 Ga0157376_10002225 3300014969 Bacteria 13072
116 Ga0207653_10001631 3300025885 Bacteria 7220
117 Ga0207692_10069797 3300025898 Bacteria 1847
118 Ga0207699_10002047 3300025906 Bacteria 9525
119 Ga0207699_10117307 3300025906 Bacteria 1716
120 Ga0207645_10013326 3300025907 Bacteria 5546
121 Ga0207705_10059411 3300025909 Bacteria 2759
122 Ga0207705_10071117 3300025909 Bacteria 2522
123 Ga0207684_10006155 3300025910 Bacteria 10973
124 Ga0207684_10017954 3300025910 Bacteria 6062
125 Ga0207684_10027616 3300025910 Bacteria 4834
126 Ga0207695_10004758 3300025913 Bacteria 18358
127 Ga0207695_10049912 3300025913 Bacteria 4404
128 Ga0207671_10339552 3300025914 Bacteria 1190
129 Ga0207663_10001378 3300025916 Bacteria 11273
130 Ga0207646_10000842 3300025922 Bacteria 39742
131 Ga0207646_10068162 3300025922 Bacteria 3178
132 Ga0207646_10128341 3300025922 Bacteria 2281
133 Ga0207646_10369001 3300025922 Bacteria 1297
134 Ga0207681_10006376 3300025923 Bacteria 7242
135 Ga0207681_10112229 3300025923 Bacteria 1985
136 Ga0207694_10004623 3300025924 Bacteria 10723
137 Ga0207659_10230832 3300025926 Bacteria 1492
138 Ga0207700_10084816 3300025928 Bacteria 2485
139 Ga0207664_10178890 3300025929 Bacteria 1820
140 Ga0207665_10000043 3300025939 Bacteria 82623
141 Ga0207665_10000439 3300025939 Bacteria 28569
142 Ga0207665_10014044 3300025939 Bacteria 5269
143 Ga0207665_10060572 3300025939 Bacteria 2563
144 Ga0207665_10075349 3300025939 Bacteria 2311
145 Ga0207665_10158600 3300025939 Bacteria 1626
146 Ga0207691_10208761 3300025940 Bacteria 1697
147 Ga0207689_10039896 3300025942 Bacteria 3886
148 Ga0207689_10107768 3300025942 Bacteria 2289
149 Ga0207667_10189093 3300025949 Bacteria 2113
150 Ga0207703_10021562 3300026035 Bacteria 5044
151 Ga0207703_10049400 3300026035 Bacteria 3401
152 Ga0207702_10216169 3300026078 Bacteria 1784
153 Ga0207641_10010594 3300026088 Bacteria 7564
154 Ga0207641_10013975 3300026088 Bacteria 6583
155 Ga0207648_10131608 3300026089 Bacteria 2202
156 Ga0207675_100220643 3300026118 Bacteria 1827
157 Ga0209588_1025496 3300027671 Bacteria 1872
158 Ga0209813_10000709 3300027866 Bacteria 7619
159 Ga0209974_10045975 3300027876 Bacteria 1459
160 Ga0207428_10058697 3300027907 Bacteria 3052
161 Ga0265354_1000190 3300028016 Bacteria 11325
162 Ga0265354_1001956 3300028016 Bacteria 2730
163 Ga0268266_10000349 3300028379 Bacteria 71878
164 Ga0268266_10000525 3300028379 Bacteria 53447
165 Ga0268265_10001004 3300028380 Bacteria 25512
166 Ga0268265_10112118 3300028380 Bacteria 2229
167 Ga0268265_10130555 3300028380 Bacteria 2087
168 Ga0268265_10276926 3300028380 Bacteria 1499
169 Ga0268264_10003663 3300028381 Bacteria 13205
170 Ga0268264_10070728 3300028381 Bacteria 2954
171 Ga0268264_10117741 3300028381 Bacteria 2337
172 Ga0265337_1000675 3300028556 Bacteria 18031
173 Ga0265337_1000877 3300028556 Bacteria 15789
174 Ga0265337_1003494 3300028556 Bacteria 6789
175 Ga0265337_1005334 3300028556 Bacteria 5126
176 Ga0265319_1000007 3300028563 Bacteria 217194
177 Ga0265319_1014577 3300028563 Bacteria 3080
178 Ga0265319_1030817 3300028563 Bacteria 1872
179 Ga0265334_10004410 3300028573 Bacteria 6247
180 Ga0265334_10008230 3300028573 Bacteria 4440
181 Ga0265318_10015768 3300028577 Bacteria 3135
182 Ga0265336_10003665 3300028666 Bacteria 5971
183 Ga0265338_10000210 3300028800 Bacteria 107885
184 Ga0265338_10000338 3300028800 Bacteria 85407
185 Ga0265338_10000723 3300028800 Bacteria 56376
186 Ga0265338_10001741 3300028800 Bacteria 34419
187 Ga0265338_10005003 3300028800 Bacteria 17529
188 Ga0265338_10009072 3300028800 Bacteria 11963
189 Ga0265338_10032883 3300028800 Bacteria 5048
190 Ga0265338_10032988 3300028800 Bacteria 5038
191 Ga0265338_10088160 3300028800 Bacteria 2576
192 Ga0265338_10148633 3300028800 Bacteria 1823
193 Ga0265338_10150687 3300028800 Bacteria 1807
194 Ga0265324_10050877 3300029957 Bacteria 1424
195 Ga0307512_10003367 3300030522 Bacteria 18716
196 Ga0265765_1001267 3300030879 Bacteria 2297
197 Ga0265332_10012198 3300031238 Bacteria 3813
198 Ga0265332_10082983 3300031238 Bacteria 1359
199 Ga0265328_10031612 3300031239 Bacteria 1968
200 Ga0265320_10000443 3300031240 Bacteria 32427
201 Ga0265320_10000666 3300031240 Bacteria 26164
202 Ga0265339_10136723 3300031249 Bacteria 1250
203 Ga0265313_10002635 3300031595 Bacteria 15263
204 Ga0316576_10016120 3300031727 Bacteria 5039
205 Ga0316576_10075901 3300031727 Bacteria 2486
206 Ga0316578_10087490 3300031728 Bacteria 1858
207 Ga0307409_100075221 3300031995 Bacteria 2703
208 Ga0307416_100022340 3300032002 Bacteria 4565
209 Ga0307415_100071227 3300032126 Bacteria 2444
210 Ga0316212_1009318 3300033547 Bacteria 1410
211 Ga0373926_0002835 3300035083 Bacteria 5547
212 Ga0373945_0050801 3300035116 Bacteria 1525
213 Ga0373946_0019606 3300035171 Bacteria 2607
214 Ga0373955_0009521 3300035172 Bacteria 4555
215 Ga0373927_0005762 3300035695 Bacteria 8505
216 Ga0373947_0042454 3300035725 Bacteria 2714
217 Ga0316582_0038153 3300036647 Bacteria 2984
218 Ga0316582_0051361 3300036647 Bacteria 2616
219 Ga0373925_0000819 3300037068 Bacteria 28676
220 Ga0395899_0002852 3300037312 Bacteria 13915
221 Ga0436365_1816299 3300039437 Bacteria 1389
222 Ga0451577_0010656 3300042876 Bacteria 8757
223 Ga0453684_0042409 3300044712 Bacteria 6134
224 Ga0453684_0237013 3300044712 Bacteria 2103
225 Ga0451576_0210743 3300045051 Bacteria 2029
226 Ga0495603_0007730 3300046455 Bacteria 6479
227 Ga0495629_0002486 3300046459 Bacteria 14132
228 Ga0495580_0002194 3300046472 Bacteria 17081
229 Ga0495580_0027706 3300046472 Bacteria 4122
230 Ga0495580_0063959 3300046472 Bacteria 2579
231 Ga0495580_0067546 3300046472 Bacteria 2501
232 Ga0495580_0091460 3300046472 Bacteria 2118
233 Ga0495582_0000436 3300046473 Bacteria 22770
234 Ga0495582_0002394 3300046473 Bacteria 10479
235 Ga0495582_0009553 3300046473 Bacteria 5341
236 Ga0495639_0002971 3300046475 Bacteria 7380
237 Ga0495662_0082915 3300046476 Bacteria 1560
238 Ga0495594_0029415 3300046499 Bacteria 2969
239 Ga0495594_0074754 3300046499 Bacteria 1888
240 Ga0495608_0001286 3300046511 Bacteria 17822
241 Ga0495628_0019383 3300046516 Bacteria 5625
242 Ga0495630_0000192 3300046517 Bacteria 47913
243 Ga0495630_0036206 3300046517 Bacteria 3689
244 Ga0495630_0041820 3300046517 Bacteria 3422
245 Ga0495666_0004303 3300046526 Bacteria 7187
246 Ga0495666_0028641 3300046526 Bacteria 2740
247 Ga0495665_0046490 3300046531 Bacteria 2304
248 Ga0495640_0017581 3300046533 Bacteria 5323
249 Ga0495640_0068544 3300046533 Bacteria 2387
250 Ga0495640_0137660 3300046533 Bacteria 1576
251 Ga0495586_0000115 3300046535 Bacteria 47977
252 Ga0495586_0055939 3300046535 Bacteria 2139
253 Ga0495586_0065892 3300046535 Bacteria 1974
254 Ga0495645_0048524 3300046543 Bacteria 3092
255 Ga0495622_0031329 3300046557 Bacteria 2486
256 Ga0495667_0061397 3300046559 Bacteria 2464
257 Ga0495634_0029041 3300046642 Bacteria 3832
258 Ga0495634_0056250 3300046642 Bacteria 2629
259 Ga0495634_0073136 3300046642 Bacteria 2254
260 Ga0495635_0004201 3300046663 Bacteria 9989
261 Ga0495647_0000807 3300046681 Bacteria 9362
262 Ga0495658_0000417 3300046683 Bacteria 23934
263 Ga0495658_0011841 3300046683 Bacteria 4399
264 Ga0495658_0025957 3300046683 Bacteria 3135
265 Ga0495658_0034408 3300046683 Bacteria 2780
266 Ga0495613_0001458 3300046689 Bacteria 18046
267 Ga0495613_0014778 3300046689 Bacteria 5794
268 Ga0495613_0175242 3300046689 Bacteria 1520
269 Ga0495624_0076540 3300046690 Bacteria 2076
270 Ga0495624_0144884 3300046690 Bacteria 1454
271 Ga0495581_0008387 3300047315 Bacteria 5990
272 Ga0495581_0059845 3300047315 Bacteria 2201
273 Ga0495581_0204350 3300047315 Bacteria 1155
274 Ga0495604_0048391 3300047317 Bacteria 3307
275 Ga0495674_0005174 3300047319 Bacteria 12527
276 Ga0495674_0007208 3300047319 Bacteria 10634
277 Ga0495674_0111306 3300047319 Bacteria 2321
278 Ga0495676_0008402 3300047321 Bacteria 9464
279 Ga0495676_0042538 3300047321 Bacteria 3728
280 Ga0495676_0103118 3300047321 Bacteria 2107
281 Ga0495680_0002227 3300047322 Bacteria 20011
282 Ga0495680_0065926 3300047322 Bacteria 2772
283 Ga0495680_0204220 3300047322 Bacteria 1416
284 Ga0495675_0079641 3300047444 Bacteria 2063
285 Ga0495684_0011656 3300047471 Bacteria 6787
286 Ga0495593_0114499 3300047673 Bacteria 1375
287 Ga0495614_0000836 3300048089 Bacteria 13021
288 Ga0495614_0018574 3300048089 Bacteria 3012
289 Ga0495615_0017912 3300048090 Bacteria 1551
290 Ga0496102_0025271 3300048905 Bacteria 5286
291 Ga0496103_0041327 3300048906 Bacteria 2835
292 Ga0496106_0228617 3300048909 Bacteria 1485
293 Ga0496115_0008485 3300048918 Bacteria 7601
294 Ga0496115_0143388 3300048918 Bacteria 1971
295 Ga0496116_0053888 3300048919 Bacteria 2654
296 Ga0496126_0273639 3300048929 Bacteria 1401
297 Ga0501039_0154250 3300049575 Bacteria 1804
298 Ga0501042_0036209 3300049578 Bacteria 3501
299 Ga0501046_0133903 3300049580 Bacteria 1878
300 Ga0501071_0074221 3300049587 Bacteria 2482
301 Ga0501072_0074333 3300049588 Bacteria 2687
302 Ga0501073_0015557 3300049589 Bacteria 5519
303 Ga0501076_0005909 3300049592 Bacteria 8832
304 Ga0501077_0193056 3300049593 Bacteria 1294
305 Ga0501081_0046064 3300049743 Bacteria 2996
306 Ga0501083_0014361 3300049744 Bacteria 5538
307 Ga0501083_0093501 3300049744 Bacteria 1985
308 Ga0501045_0034286 3300049824 Bacteria 3684
309 nmdc:mga06z11_1626_c1 3300050494 Bacteria 8407
310 nmdc:mga04h51_666_c1 3300050495 Bacteria 7981
311 nmdc:mga05p37_177461_c1 3300050507 Bacteria 2594
312 nmdc:mga05p37_25382_c1 3300050507 Bacteria 7206
313 nmdc:mga05p37_28099_c1 3300050507 Bacteria 6855
314 nmdc:mga08y16_219540_c1 3300050511 Bacteria 1968
315 nmdc:mga08y16_28087_c1 3300050511 Bacteria 5931
316 nmdc:mga08y16_67937_c1 3300050511 Bacteria 3717
317 nmdc:mga0n895_13994_c1 3300050512 Bacteria 7266
318 nmdc:mga0n895_20095_c1 3300050512 Bacteria 6220
319 nmdc:mga0n895_79555_c1 3300050512 Bacteria 3265
320 nmdc:mga0rr50_114457_c1 3300050513 Bacteria 2139
321 nmdc:mga0rr50_220393_c1 3300050513 Bacteria 1566
322 nmdc:mga08x19_8825_c1 3300050514 Bacteria 6014
323 nmdc:mga0a205_112437_c1 3300050515 Bacteria 2622
324 nmdc:mga0a205_51563_c1 3300050515 Bacteria 3972
325 Ga0495619_0000472 3300053085 Bacteria 27166
326 Ga0495619_0041614 3300053085 Bacteria 3006
327 Ga0530510_0001830 3300061734 Bacteria 14520
328 Ga0265338_10083192
329 JGI25406J46586_10000491
330 Ga0070658_10067024
331 Ga0070658_10245454
332 Ga0070683_100371004
333 Ga0070690_100142307
334 Ga0068869_100074550
335 Ga0070666_10012590
336 Ga0070682_100001610
337 Ga0070689_100064008
338 Ga0070689_100093800
339 Ga0070669_100023292
340 Ga0070669_100085156
341 Ga0070675_100262151
342 Ga0070675_100292786
343 Ga0070667_100092603
344 Ga0070709_10018495
345 Ga0070709_10024761
346 Ga0070709_10064467
347 Ga0070713_100054592
348 Ga0070710_10107903
349 Ga0070711_100001310
350 Ga0070711_100012449
351 Ga0070711_100116359
352 Ga0070705_100000809
353 Ga0070694_100003444
354 Ga0070694_100053379
355 Ga0070708_100001390
356 Ga0070681_10098441
357 Ga0070685_10045814
358 Ga0070685_10052555
359 Ga0070706_100005742
360 Ga0070706_100023120
361 Ga0070707_100001445
362 Ga0070707_100132002
363 Ga0070707_100209083
364 Ga0070698_100009647
365 Ga0070698_100016768
366 Ga0070698_100141057
367 Ga0070699_100003987
368 Ga0070699_100033311
369 Ga0070699_100036476
370 Ga0070679_100039500
371 Ga0070697_100000970
372 Ga0070697_100023960
373 Ga0070697_100123401
374 Ga0070695_100027224
375 Ga0070696_100001149
376 Ga0070693_100000054
377 Ga0070665_100000646
378 Ga0070665_100001280
379 Ga0070704_100001852
380 Ga0070704_100350500
381 Ga0068855_100228826
382 Ga0068852_100225491
383 Ga0068859_100008465
384 Ga0068859_100036346
385 Ga0068864_100187623
386 Ga0068863_100000904
387 Ga0068858_100044787
388 Ga0068860_100007339
389 Ga0068860_100078644
390 Ga0068862_100000277
391 Ga0068862_100004902
392 Ga0075368_10002975
393 Ga0070716_100000535
394 Ga0070716_100000571
395 Ga0070716_100050863
396 Ga0070716_100056299
397 Ga0075367_10000891
398 Ga0075428_100011793
399 Ga0075428_100206543
400 Ga0075431_100000713
401 Ga0075431_100056172
402 Ga0075433_10098590
403 Ga0075434_100029665
404 Ga0075434_100053239
405 Ga0075434_100244385
406 Ga0075429_100018034
407 Ga0075436_100022103
408 Ga0097620_100008465
409 Ga0097620_100036346
410 Ga0097620_100055662
411 Ga0075435_100157449
412 Ga0075435_100256314
413 Ga0099794_10050573
414 Ga0099794_10056433
415 Ga0099794_10071432
416 Ga0099794_10096379
417 Ga0099795_10003772
418 Ga0099795_10033658
419 Ga0099795_10050020
420 Ga0105240_10007044
421 Ga0105240_10025455
422 Ga0105240_10064244
423 Ga0111539_10035231
424 Ga0105245_10241414
425 Ga0114129_10004747
426 Ga0114129_10009011
427 Ga0114129_10011070
428 Ga0114129_10086468
429 Ga0105248_10072079
430 Ga0105237_10195156
431 Ga0105238_10105935
432 Ga0105249_10169134
433 Ga0105249_10242848
434 Ga0099796_10002206
435 Ga0099796_10015951
436 Ga0157378_10000056
437 Ga0163162_10102691
438 Ga0157372_10125235
439 Ga0157375_10021188
440 Ga0157380_10208123
441 Ga0157379_10159428
442 Ga0157376_10002225
443 Ga0207653_10001631
444 Ga0207692_10069797
445 Ga0207699_10002047
446 Ga0207699_10117307
447 Ga0207645_10013326
448 Ga0207705_10059411
449 Ga0207705_10071117
450 Ga0207684_10006155
451 Ga0207684_10017954
452 Ga0207684_10027616
453 Ga0207695_10004758
454 Ga0207695_10049912
455 Ga0207671_10339552
456 Ga0207663_10001378
457 Ga0207646_10000842
458 Ga0207646_10068162
459 Ga0207646_10128341
460 Ga0207646_10369001
461 Ga0207681_10006376
462 Ga0207681_10112229
463 Ga0207694_10004623
464 Ga0207659_10230832
465 Ga0207700_10084816
466 Ga0207664_10178890
467 Ga0207665_10000043
468 Ga0207665_10000439
469 Ga0207665_10014044
470 Ga0207665_10060572
471 Ga0207665_10075349
472 Ga0207665_10158600
473 Ga0207691_10208761
474 Ga0207689_10039896
475 Ga0207689_10107768
476 Ga0207667_10189093
477 Ga0207703_10021562
478 Ga0207703_10049400
479 Ga0207702_10216169
480 Ga0207641_10010594
481 Ga0207641_10013975
482 Ga0207648_10131608
483 Ga0207675_100220643
484 Ga0209588_1025496
485 Ga0209813_10000709
486 Ga0209974_10045975
487 Ga0207428_10058697
488 Ga0265354_1000190
489 Ga0265354_1001956
490 Ga0268266_10000349
491 Ga0268266_10000525
492 Ga0268265_10001004
493 Ga0268265_10112118
494 Ga0268265_10130555
495 Ga0268265_10276926
496 Ga0268264_10003663
497 Ga0268264_10070728
498 Ga0268264_10117741
499 Ga0265337_1000675
500 Ga0265337_1000877
501 Ga0265337_1003494
502 Ga0265337_1005334
503 Ga0265319_1000007
504 Ga0265319_1014577
505 Ga0265319_1030817
506 Ga0265334_10004410
507 Ga0265334_10008230
508 Ga0265318_10015768
509 Ga0265336_10003665
510 Ga0265338_10000210
511 Ga0265338_10000338
512 Ga0265338_10000723
513 Ga0265338_10001741
514 Ga0265338_10005003
515 Ga0265338_10009072
516 Ga0265338_10032883
517 Ga0265338_10032988
518 Ga0265338_10088160
519 Ga0265338_10148633
520 Ga0265338_10150687
521 Ga0265324_10050877
522 Ga0307512_10003367
523 Ga0265765_1001267
524 Ga0265332_10012198
525 Ga0265332_10082983
526 Ga0265328_10031612
527 Ga0265320_10000443
528 Ga0265320_10000666
529 Ga0265339_10136723
530 Ga0265313_10002635
531 Ga0316576_10016120
532 Ga0316576_10075901
533 Ga0316578_10087490
534 Ga0307409_100075221
535 Ga0307416_100022340
536 Ga0307415_100071227
537 Ga0316212_1009318
538 Ga0373926_0002835
539 Ga0373945_0050801
540 Ga0373946_0019606
541 Ga0373955_0009521
542 Ga0373927_0005762
543 Ga0373947_0042454
544 Ga0316582_0038153
545 Ga0316582_0051361
546 Ga0373925_0000819
547 Ga0395899_0002852
548 Ga0436365_1816299
549 Ga0451577_0010656
550 Ga0453684_0042409
551 Ga0453684_0237013
552 Ga0451576_0210743
553 Ga0495603_0007730
554 Ga0495629_0002486
555 Ga0495580_0002194
556 Ga0495580_0027706
557 Ga0495580_0063959
558 Ga0495580_0067546
559 Ga0495580_0091460
560 Ga0495582_0000436
561 Ga0495582_0002394
562 Ga0495582_0009553
563 Ga0495639_0002971
564 Ga0495662_0082915
565 Ga0495594_0029415
566 Ga0495594_0074754
567 Ga0495608_0001286
568 Ga0495628_0019383
569 Ga0495630_0000192
570 Ga0495630_0036206
571 Ga0495630_0041820
572 Ga0495666_0004303
573 Ga0495666_0028641
574 Ga0495665_0046490
575 Ga0495640_0017581
576 Ga0495640_0068544
577 Ga0495640_0137660
578 Ga0495586_0000115
579 Ga0495586_0055939
580 Ga0495586_0065892
581 Ga0495645_0048524
582 Ga0495622_0031329
583 Ga0495667_0061397
584 Ga0495634_0029041
585 Ga0495634_0056250
586 Ga0495634_0073136
587 Ga0495635_0004201
588 Ga0495647_0000807
589 Ga0495658_0000417
590 Ga0495658_0011841
591 Ga0495658_0025957
592 Ga0495658_0034408
593 Ga0495613_0001458
594 Ga0495613_0014778
595 Ga0495613_0175242
596 Ga0495624_0076540
597 Ga0495624_0144884
598 Ga0495581_0008387
599 Ga0495581_0059845
600 Ga0495581_0204350
601 Ga0495604_0048391
602 Ga0495674_0005174
603 Ga0495674_0007208
604 Ga0495674_0111306
605 Ga0495676_0008402
606 Ga0495676_0042538
607 Ga0495676_0103118
608 Ga0495680_0002227
609 Ga0495680_0065926
610 Ga0495680_0204220
611 Ga0495675_0079641
612 Ga0495684_0011656
613 Ga0495593_0114499
614 Ga0495614_0000836
615 Ga0495614_0018574
616 Ga0495615_0017912
617 Ga0496102_0025271
618 Ga0496103_0041327
619 Ga0496106_0228617
620 Ga0496115_0008485
621 Ga0496115_0143388
622 Ga0496116_0053888
623 Ga0496126_0273639
624 Ga0501039_0154250
625 Ga0501042_0036209
626 Ga0501046_0133903
627 Ga0501071_0074221
628 Ga0501072_0074333
629 Ga0501073_0015557
630 Ga0501076_0005909
631 Ga0501077_0193056
632 Ga0501081_0046064
633 Ga0501083_0014361
634 Ga0501083_0093501
635 Ga0501045_0034286
636 nmdc:mga06z11_1626_c1
637 nmdc:mga04h51_666_c1
638 nmdc:mga05p37_177461_c1
639 nmdc:mga05p37_25382_c1
640 nmdc:mga05p37_28099_c1
641 nmdc:mga08y16_219540_c1
642 nmdc:mga08y16_28087_c1
643 nmdc:mga08y16_67937_c1
644 nmdc:mga0n895_13994_c1
645 nmdc:mga0n895_20095_c1
646 nmdc:mga0n895_79555_c1
647 nmdc:mga0rr50_114457_c1
648 nmdc:mga0rr50_220393_c1
649 nmdc:mga08x19_8825_c1
650 nmdc:mga0a205_112437_c1
651 nmdc:mga0a205_51563_c1
652 Ga0495619_0000472
653 Ga0495619_0041614
654 Ga0530510_0001830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01791

DeoC

DeoC/LacD family aldolase

111

379

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yce-assembly1.cif.gz_E structure of an archaeal fructose-1,6-bisphosphate aldolase with the catalytic lys covalently bound to the carbinolamine intermediate of the substrate. 0.8887 69 362
2qjg-assembly2.cif.gz_T m. jannaschii adh synthase complexed with f1,6p 0.8872 56 360
2qjg-assembly2.cif.gz_S m. jannaschii adh synthase complexed with f1,6p 0.8828 56 359
2qjg-assembly2.cif.gz_H m. jannaschii adh synthase complexed with f1,6p 0.8824 56 360
2qjg-assembly2.cif.gz_R m. jannaschii adh synthase complexed with f1,6p 0.8801 55 358
ID Description Score Start End Superfamily
af_P0A991_40_348_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9786 58 365 3.20.20.70
af_P0A991_40_348_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9724 58 365 3.20.20.70
1ok6A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8628 69 362 3.20.20.70
2qjgK00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8562 56 366 3.20.20.70
1ok6A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8502 69 362 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6D0IF93-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9912 169 367 GO:0004332
AF-A0A6M1YQ15-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9889 171 367 GO:0016829
AF-A0A656K908-F1-model_v4 deleted 0.9887 103 367
AF-A0A2X3GNQ0-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9883 215 367 GO:0004332
AF-A0A6D0IF93-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9863 169 367 GO:0004332

Map