F408754

General Info

Members Datasets Scaffolds Average Seq Length
327 219 318 235

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10406392|Ga0111539_104063922
Length 274
Sequence VGAPLMTERPTAVGPELEVLELEVLPAWAQPRDHGRPRSPADRLSVRALDVRYGRRMAVLDVDLRVGPGEVVALIGHNGCGKTSTLRAIFGLHPTDRGEVLVNGVETAGDGRAVGRPGMAMVLASRTVFAELTVRENLGLGARHELEAVVAERLAGVLSLFPGLEASLERRAGDVSGGEQRMVGVGIALMSEPSVLLLDEPTRFLAPAAARQVLDTVRRLADERGTGVLLADVNVAAALSIADRVYVMANGRIRSQHDPAELRAAGPTTWWHLF

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2738543013 Variovorax sp. BT01 Isolate Unclassified
9 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
146 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
147 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
150 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
151 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
152 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
153 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
201 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
202 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
203 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
206 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
207 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
208 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 0
Isolates 2.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.51
Nodule 0.31
Rhizoplane 0.92
Rhizosphere 75.84
Stem 0
Stem Tuber 0
Unclassified 6.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002162 3300002773 Bacteria 7704
2 JGI25150J39212_1003203 3300002774 Bacteria 3877
3 JGI25151J46595_10050629 3300003187 Bacteria 1413
4 JGI25153J46596_10001286 3300003215 Bacteria 15041
5 JGI25153J46596_10003485 3300003215 Bacteria 8798
6 Ga0055526_1001550 3300003771 Bacteria 16263
7 Ga0055530_10008972 3300003791 Bacteria 3913
8 Ga0065165_1000832 3300005262 Bacteria 40569
9 Ga0065715_10143528 3300005293 Bacteria 1819
10 Ga0070658_10139982 3300005327 Bacteria 2021
11 Ga0070676_10002086 3300005328 Bacteria 10168
12 Ga0070690_100026013 3300005330 Bacteria 3607
13 Ga0070690_100069062 3300005330 Bacteria 2293
14 Ga0070690_100127647 3300005330 Bacteria 1714
15 Ga0070670_100028336 3300005331 Bacteria 4820
16 Ga0070670_100113044 3300005331 Bacteria 2340
17 Ga0070677_10047208 3300005333 Bacteria 1725
18 Ga0068869_100034581 3300005334 Bacteria 3576
19 Ga0070666_10001955 3300005335 Bacteria 12545
20 Ga0068868_100003101 3300005338 Bacteria 11564
21 Ga0070689_100132339 3300005340 Bacteria 2000
22 Ga0070687_100105292 3300005343 Bacteria 1587
23 Ga0070687_100184503 3300005343 Bacteria 1252
24 Ga0070661_100502639 3300005344 Bacteria 970
25 Ga0070668_100001274 3300005347 Bacteria 18003
26 Ga0070668_100365753 3300005347 Bacteria 1224
27 Ga0070669_100000411 3300005353 Bacteria 32862
28 Ga0070675_100006740 3300005354 Bacteria 8833
29 Ga0070671_100103255 3300005355 Bacteria 2391
30 Ga0070674_100004011 3300005356 Bacteria 8342
31 Ga0070674_100031197 3300005356 Bacteria 3529
32 Ga0070673_100001471 3300005364 Bacteria 13789
33 Ga0070688_100095553 3300005365 Bacteria 1951
34 Ga0070667_100002084 3300005367 Bacteria 17667
35 Ga0070667_100086380 3300005367 Bacteria 2691
36 Ga0070700_100012347 3300005441 Bacteria 4763
37 Ga0070678_100000948 3300005456 Bacteria 14931
38 Ga0070678_100159257 3300005456 Bacteria 1827
39 Ga0070662_100433613 3300005457 Bacteria 1089
40 Ga0068867_100002629 3300005459 Bacteria 12667
41 Ga0068867_100007510 3300005459 Bacteria 7708
42 Ga0070685_10145490 3300005466 Bacteria 1497
43 Ga0070672_100013826 3300005543 Bacteria 5707
44 Ga0070672_100037180 3300005543 Bacteria 3713
45 Ga0070686_100529202 3300005544 Bacteria 919
46 Ga0070665_100223542 3300005548 Bacteria 1883
47 Ga0068859_100035816 3300005617 Bacteria 4980
48 Ga0068859_100053433 3300005617 Bacteria 4063
49 Ga0068864_100029185 3300005618 Bacteria 4668
50 Ga0068864_100035078 3300005618 Bacteria 4269
51 Ga0068861_100161386 3300005719 Bacteria 1849
52 Ga0068851_10091277 3300005834 Bacteria 1603
53 Ga0068870_10006343 3300005840 Bacteria 5207
54 Ga0068863_100027975 3300005841 Bacteria 5381
55 Ga0068863_100095896 3300005841 Bacteria 2816
56 Ga0068858_100051530 3300005842 Bacteria 3808
57 Ga0068858_100187211 3300005842 Bacteria 1955
58 Ga0068858_100257762 3300005842 Bacteria 1657
59 Ga0068860_100001387 3300005843 Bacteria 26293
60 Ga0068860_100004646 3300005843 Bacteria 14021
61 Ga0068860_100005311 3300005843 Bacteria 13077
62 Ga0068860_100220712 3300005843 Bacteria 1841
63 Ga0068862_100009604 3300005844 Bacteria 7996
64 Ga0068862_100010800 3300005844 Bacteria 7541
65 Ga0068862_100041663 3300005844 Bacteria 3908
66 Ga0075365_10053623 3300006038 Bacteria 2671
67 Ga0075363_100185327 3300006048 Bacteria 1185
68 Ga0075362_10063872 3300006177 Bacteria 1670
69 Ga0075367_10120068 3300006178 Bacteria 1619
70 Ga0075366_10014892 3300006195 Bacteria 4446
71 Ga0075366_10169583 3300006195 Bacteria 1324
72 Ga0097621_100007774 3300006237 Bacteria 7691
73 Ga0075370_10000825 3300006353 Bacteria 12482
74 Ga0075370_10060778 3300006353 Bacteria 2152
75 Ga0068871_100002112 3300006358 Bacteria 13451
76 Ga0068871_100317619 3300006358 Bacteria 1371
77 Ga0075430_100042207 3300006846 Bacteria 3857
78 Ga0075430_100317552 3300006846 Bacteria 1288
79 Ga0075431_100019506 3300006847 Bacteria 6914
80 Ga0075431_100510606 3300006847 Bacteria 1192
81 Ga0075429_100399575 3300006880 Bacteria 1203
82 Ga0068865_100000371 3300006881 Bacteria 24845
83 Ga0068865_100028857 3300006881 Bacteria 3676
84 Ga0097620_100035816 3300006931 Bacteria 4980
85 Ga0097620_100053433 3300006931 Bacteria 4063
86 Ga0097620_100162601 3300006931 Bacteria 2312
87 Ga0111539_10406392 3300009094 Bacteria 1586
88 Ga0105245_10123142 3300009098 Bacteria 2424
89 Ga0105243_10056478 3300009148 Bacteria 3122
90 Ga0105242_10489382 3300009176 Bacteria 1167
91 Ga0105248_10002843 3300009177 Bacteria 19207
92 Ga0105248_10483919 3300009177 Bacteria 1395
93 Ga0105238_10687771 3300009551 Bacteria 1034
94 Ga0105249_10052708 3300009553 Bacteria 3716
95 Ga0105249_10142374 3300009553 Bacteria 2301
96 Ga0157373_10391680 3300013100 Bacteria 995
97 Ga0157374_10014408 3300013296 Bacteria 6920
98 Ga0157378_10010272 3300013297 Bacteria 8174
99 Ga0157378_10153520 3300013297 Bacteria 2147
100 Ga0163162_10004491 3300013306 Bacteria 13443
101 Ga0163162_10012168 3300013306 Bacteria 8399
102 Ga0157375_10011190 3300013308 Bacteria 7915
103 Ga0157380_10212790 3300014326 Bacteria 1724
104 Ga0157379_10010421 3300014968 Bacteria 8100
105 Ga0157376_10003285 3300014969 Bacteria 11132
106 Ga0163161_10022474 3300017792 Bacteria 4442
107 Ga0207425_1000737 3300025245 Bacteria 17182
108 Ga0209129_1000075 3300025258 Bacteria 201273
109 Ga0209130_1003748 3300025284 Bacteria 6208
110 Ga0209675_1001283 3300025291 Bacteria 14924
111 Ga0209676_1030119 3300025292 Bacteria 1664
112 Ga0209025_1000700 3300025294 Bacteria 57239
113 Ga0209564_1000046 3300025295 Bacteria 373787
114 Ga0209758_1000045 3300025297 Bacteria 369174
115 Ga0209758_1000052 3300025297 Bacteria 338962
116 Ga0209050_1000257 3300025298 Bacteria 114186
117 Ga0209257_1024493 3300025304 Bacteria 2088
118 Ga0207697_10040562 3300025315 Bacteria 1912
119 Ga0207656_10064122 3300025321 Bacteria 1619
120 Ga0207682_10021873 3300025893 Bacteria 2517
121 Ga0207682_10093992 3300025893 Bacteria 1304
122 Ga0207680_10132328 3300025903 Bacteria 1645
123 Ga0207645_10000039 3300025907 Bacteria 88205
124 Ga0207705_10192517 3300025909 Bacteria 1543
125 Ga0207649_10319384 3300025920 Bacteria 1140
126 Ga0207681_10061136 3300025923 Bacteria 2588
127 Ga0207681_10218155 3300025923 Bacteria 1474
128 Ga0207659_10023693 3300025926 Bacteria 4101
129 Ga0207644_10152297 3300025931 Bacteria 1790
130 Ga0207709_10044197 3300025935 Bacteria 2690
131 Ga0207669_10008907 3300025937 Bacteria 4742
132 Ga0207669_10008950 3300025937 Bacteria 4733
133 Ga0207704_10008131 3300025938 Bacteria 4995
134 Ga0207704_10088140 3300025938 Bacteria 2029
135 Ga0207704_10108172 3300025938 Bacteria 1872
136 Ga0207691_10000027 3300025940 Bacteria 126502
137 Ga0207691_10118875 3300025940 Bacteria 2344
138 Ga0207711_10016406 3300025941 Bacteria 6157
139 Ga0207711_10523490 3300025941 Bacteria 1106
140 Ga0207689_10020095 3300025942 Bacteria 5623
141 Ga0207651_10102631 3300025960 Bacteria 2126
142 Ga0207712_10057128 3300025961 Bacteria 2752
143 Ga0207668_10010752 3300025972 Bacteria 5540
144 Ga0207668_10096067 3300025972 Bacteria 2189
145 Ga0207658_10000682 3300025986 Bacteria 29584
146 Ga0207658_10128182 3300025986 Bacteria 2034
147 Ga0207677_10252780 3300026023 Bacteria 1432
148 Ga0207703_10029920 3300026035 Bacteria 4300
149 Ga0207703_10098736 3300026035 Bacteria 2470
150 Ga0207708_10018904 3300026075 Bacteria 5189
151 Ga0207641_10004919 3300026088 Bacteria 11477
152 Ga0207641_10052083 3300026088 Bacteria 3466
153 Ga0207648_10000149 3300026089 Bacteria 70199
154 Ga0207648_10011696 3300026089 Bacteria 8258
155 Ga0207676_10019761 3300026095 Bacteria 4919
156 Ga0207676_10337016 3300026095 Bacteria 1390
157 Ga0207675_100009000 3300026118 Bacteria 9369
158 Ga0207675_100109305 3300026118 Bacteria 2608
159 Ga0207683_10000061 3300026121 Bacteria 81399
160 Ga0207683_10164449 3300026121 Bacteria 2007
161 Ga0209969_1003248 3300027360 Bacteria 2244
162 Ga0209967_1006794 3300027364 Bacteria 1558
163 Ga0209968_1006512 3300027526 Bacteria 1759
164 Ga0209999_1003433 3300027543 Bacteria 2833
165 Ga0268266_10009493 3300028379 Bacteria 8559
166 Ga0268265_10027297 3300028380 Bacteria 4073
167 Ga0268264_10011913 3300028381 Bacteria 7163
168 Ga0268264_10021917 3300028381 Bacteria 5214
169 Ga0268264_10288894 3300028381 Bacteria 1539
170 Ga0268264_10292180 3300028381 Bacteria 1531
171 Ga0307517_10091137 3300028786 Bacteria 2493
172 Ga0307517_10093398 3300028786 Bacteria 2439
173 Ga0307515_10003694 3300028794 Bacteria 32127
174 Ga0307515_10062265 3300028794 Bacteria 5273
175 Ga0307515_10226263 3300028794 Bacteria 1675
176 Ga0265327_10000194 3300031251 Bacteria 129264
177 Ga0307513_10016206 3300031456 Bacteria 9001
178 Ga0307513_10083657 3300031456 Bacteria 3281
179 Ga0307513_10175729 3300031456 Bacteria 2012
180 Ga0307513_10283373 3300031456 Bacteria 1433
181 Ga0307509_10394941 3300031507 Bacteria 1092
182 Ga0307408_100031806 3300031548 Bacteria 3676
183 Ga0307408_100201582 3300031548 Bacteria 1611
184 Ga0307408_100346951 3300031548 Bacteria 1258
185 Ga0316576_10134505 3300031727 Bacteria 1861
186 Ga0316578_10219203 3300031728 Bacteria 1144
187 Ga0307516_10002426 3300031730 Bacteria 24923
188 Ga0307516_10004231 3300031730 Bacteria 17873
189 Ga0307516_10005929 3300031730 Bacteria 14458
190 Ga0307516_10027890 3300031730 Bacteria 5720
191 Ga0307405_10129545 3300031731 Bacteria 1741
192 Ga0307413_10115249 3300031824 Bacteria 1808
193 Ga0307413_10260318 3300031824 Bacteria 1293
194 Ga0307410_10365533 3300031852 Bacteria 1157
195 Ga0307412_10494070 3300031911 Bacteria 1017
196 Ga0307416_100115378 3300032002 Bacteria 2378
197 Ga0307416_100517026 3300032002 Bacteria 1261
198 Ga0316574_0072702 3300035398 Bacteria 2174
199 Ga0395905_0155559 3300037471 Bacteria 2150
200 Ga0451789_0450837 3300041443 Bacteria 876
201 Ga0451795_1053407 3300041456 Bacteria 1805
202 Ga0451833_0575700 3300041491 Bacteria 913
203 Ga0451839_1091095 3300041496 Bacteria 1374
204 Ga0451853_3584764 3300041512 Bacteria 1638
205 Ga0439441_002101 3300042001 Bacteria 2748
206 Ga0439443_001990 3300042003 Bacteria 2379
207 Ga0439445_0009037 3300042004 Bacteria 2342
208 Ga0450888_005948 3300042126 Bacteria 1314
209 Ga0450897_010430 3300042128 Bacteria 892
210 Ga0439434_0072308 3300042435 Bacteria 1087
211 Ga0439435_0001172 3300042436 Bacteria 4712
212 Ga0439444_0005291 3300042437 Bacteria 1909
213 Ga0439460_0002976 3300042461 Bacteria 4086
214 Ga0439460_0047157 3300042461 Bacteria 1282
215 Ga0495650_0004691 3300046471 Bacteria 9226
216 Ga0495610_0044523 3300046512 Bacteria 2203
217 Ga0495610_0066833 3300046512 Bacteria 1692
218 Ga0495632_0002042 3300046519 Bacteria 15864
219 Ga0495632_0070884 3300046519 Bacteria 1675
220 Ga0495643_0105313 3300046522 Bacteria 1440
221 Ga0495642_0154037 3300046528 Bacteria 995
222 Ga0495597_0095760 3300046542 Bacteria 1256
223 Ga0495656_0000171 3300046615 Bacteria 22920
224 Ga0495625_0044662 3300046660 Bacteria 3206
225 Ga0495677_0089672 3300047445 Bacteria 1158
226 Ga0495686_0164458 3300047472 Bacteria 1294
227 Ga0496110_0104435 3300048913 Bacteria 2542
228 Ga0501031_0027550 3300049568 Bacteria 3705
229 Ga0501031_0336710 3300049568 Bacteria 977
230 Ga0501033_0103716 3300049570 Bacteria 2074
231 Ga0501039_0027324 3300049575 Bacteria 4388
232 Ga0501039_0092213 3300049575 Bacteria 2361
233 Ga0501039_0361584 3300049575 Bacteria 1140
234 Ga0501040_0042712 3300049576 Bacteria 3089
235 Ga0501040_0322458 3300049576 Bacteria 1105
236 Ga0501041_0075208 3300049577 Bacteria 2076
237 Ga0501041_0202785 3300049577 Bacteria 1244
238 Ga0501042_0039807 3300049578 Bacteria 3342
239 Ga0501042_0247888 3300049578 Bacteria 1285
240 Ga0501042_0391806 3300049578 Bacteria 1006
241 Ga0501043_0125227 3300049579 Bacteria 2015
242 Ga0501046_0124744 3300049580 Bacteria 1957
243 Ga0501046_0337732 3300049580 Bacteria 1095
244 Ga0501046_0408962 3300049580 Bacteria 979
245 Ga0501048_0034017 3300049582 Bacteria 3679
246 Ga0501071_0000191 3300049587 Bacteria 27590
247 Ga0501071_0083938 3300049587 Bacteria 2334
248 Ga0501072_0033091 3300049588 Bacteria 4050
249 Ga0501072_0078898 3300049588 Bacteria 2607
250 Ga0501074_0087082 3300049590 Bacteria 2237
251 Ga0501074_0136749 3300049590 Bacteria 1753
252 Ga0501074_0578509 3300049590 Bacteria 795
253 Ga0501075_0022290 3300049591 Bacteria 4625
254 Ga0501075_0025919 3300049591 Bacteria 4310
255 Ga0501075_0035016 3300049591 Bacteria 3743
256 Ga0501076_0051183 3300049592 Bacteria 3269
257 Ga0501076_0206925 3300049592 Bacteria 1603
258 Ga0501077_0030202 3300049593 Bacteria 3448
259 Ga0501077_0040388 3300049593 Bacteria 2973
260 Ga0501077_0069784 3300049593 Bacteria 2227
261 Ga0501077_0183054 3300049593 Bacteria 1331
262 Ga0501079_0007640 3300049741 Bacteria 8189
263 Ga0501079_0043496 3300049741 Bacteria 3467
264 Ga0501080_0001849 3300049742 Bacteria 18173
265 Ga0501080_0091750 3300049742 Bacteria 2821
266 Ga0501080_0101148 3300049742 Bacteria 2674
267 Ga0501080_0124175 3300049742 Bacteria 2391
268 Ga0501080_0577267 3300049742 Bacteria 1000
269 Ga0501081_0052880 3300049743 Bacteria 2803
270 Ga0501081_0101118 3300049743 Bacteria 2038
271 Ga0501081_0129697 3300049743 Bacteria 1801
272 Ga0501283_009799 3300049779 Bacteria 1402
273 Ga0501035_0383036 3300049822 Bacteria 1173
274 Ga0501045_0033502 3300049824 Bacteria 3725
275 Ga0501045_0098423 3300049824 Bacteria 2164
276 nmdc:mga03683_27046_c2 3300050489 Bacteria 955
277 nmdc:mga03683_43808_c1 3300050489 Bacteria 1848
278 nmdc:mga03n38_180274_c1 3300050490 Bacteria 1082
279 nmdc:mga00v17_3538_c1 3300050491 Bacteria 8070
280 nmdc:mga0yw44_53927_c1 3300050492 Bacteria 2443
281 nmdc:mga0k408_2052_c1 3300050493 Bacteria 10769
282 nmdc:mga0k408_216765_c1 3300050493 Bacteria 1143
283 nmdc:mga0k408_63366_c1 3300050493 Bacteria 2151
284 nmdc:mga0k408_64964_c1 3300050493 Bacteria 2124
285 nmdc:mga07m45_194_c1 3300050496 Bacteria 24053
286 nmdc:mga09592_255581_c1 3300050508 Bacteria 1519
287 nmdc:mga0qj67_20012_c1 3300050509 Bacteria 5121
288 nmdc:mga0qj67_416775_c1 3300050509 Bacteria 1083
289 nmdc:mga06r32_360533_c1 3300050510 Bacteria 1438
290 nmdc:mga06r32_53619_c1 3300050510 Bacteria 3863
291 nmdc:mga0sz30_193732_c1 3300050516 Bacteria 902
292 nmdc:mga0sz30_32502_c1 3300050516 Bacteria 2164
293 Ga0500635_0066765 3300053080 Bacteria 1268
294 Ga0500578_0001274 3300053086 Bacteria 26109
295 Ga0500644_0013050 3300053088 Bacteria 2312
296 Ga0500583_0001275 3300053092 Bacteria 7190
297 Ga0500641_0188462 3300053096 Bacteria 884
298 Ga0500562_001157 3300053108 Bacteria 6495
299 Ga0500562_022313 3300053108 Bacteria 1650
300 Ga0500593_006313 3300053117 Bacteria 4737
301 Ga0500642_0022160 3300053130 Bacteria 2529
302 Ga0500652_000948 3300053131 Bacteria 9611
303 Ga0500658_0030541 3300053134 Bacteria 2102
304 Ga0500559_0053455 3300053136 Bacteria 1788
305 Ga0500568_0023214 3300053139 Bacteria 2640
306 Ga0500622_0000164 3300053156 Bacteria 70630
307 Ga0500587_002291 3300053739 Bacteria 2725
308 Ga0501084_0023221 3300054114 Bacteria 5178
309 Ga0501084_0052006 3300054114 Bacteria 3428
310 Ga0590071_013364 3300059421 Bacteria 1922
311 Ga0590074_019942 3300059423 Bacteria 1152
312 Ga0590075_030387 3300059424 Bacteria 1368
313 Ga0501082_0011090 3300060353 Bacteria 7749
314 Ga0501082_0170801 3300060353 Bacteria 1890
315 Ga0530510_0131038 3300061734 Bacteria 1845
316 Ga0530510_0162384 3300061734 Bacteria 1653
317 Ga0530510_0165510 3300061734 Bacteria 1636
318 Ga0530510_0494238 3300061734 Bacteria 927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028381 Ga0268264_10292180 Ga0268264_102921802 218
2 3300005343 Ga0070687_100105292 Ga0070687_1001052922 223
3 3300006195 Ga0075366_10014892 Ga0075366_100148921 224
4 3300006353 Ga0075370_10000825 Ga0075370_100008255 224
5 3300006931 Ga0097620_100162601 Ga0097620_1001626013 224
6 iso_pu_bacteria 2935760218 2935767069 228
7 3300005330 Ga0070690_100127647 Ga0070690_1001276472 229
8 3300031824 Ga0307413_10115249 Ga0307413_101152492 230
9 3300003187 JGI25151J46595_10050629 JGI25151J46595_100506292 231
10 3300005293 Ga0065715_10143528 Ga0065715_101435282 231
11 3300005328 Ga0070676_10002086 Ga0070676_100020867 231
12 3300005330 Ga0070690_100026013 Ga0070690_1000260133 231
13 3300005331 Ga0070670_100028336 Ga0070670_1000283363 231
14 3300005331 Ga0070670_100113044 Ga0070670_1001130442 231
15 3300005334 Ga0068869_100034581 Ga0068869_1000345814 231
16 3300005335 Ga0070666_10001955 Ga0070666_100019557 231
17 3300005338 Ga0068868_100003101 Ga0068868_1000031018 231
18 3300005340 Ga0070689_100132339 Ga0070689_1001323393 231
19 3300005347 Ga0070668_100001274 Ga0070668_10000127419 231
20 3300005353 Ga0070669_100000411 Ga0070669_1000004114 231
21 3300005354 Ga0070675_100006740 Ga0070675_1000067406 231
22 3300005355 Ga0070671_100103255 Ga0070671_1001032552 231
23 3300005356 Ga0070674_100031197 Ga0070674_1000311973 231
24 3300005364 Ga0070673_100001471 Ga0070673_1000014713 231
25 3300005365 Ga0070688_100095553 Ga0070688_1000955531 231
26 3300005367 Ga0070667_100002084 Ga0070667_1000020843 231
27 3300005456 Ga0070678_100000948 Ga0070678_1000009482 231
28 3300005459 Ga0068867_100007510 Ga0068867_1000075107 231
29 3300005466 Ga0070685_10145490 Ga0070685_101454902 231
30 3300005543 Ga0070672_100013826 Ga0070672_1000138265 231
31 3300005548 Ga0070665_100223542 Ga0070665_1002235422 231
32 3300005617 Ga0068859_100035816 Ga0068859_1000358162 231
33 3300005617 Ga0068859_100053433 Ga0068859_1000534334 231
34 3300005618 Ga0068864_100029185 Ga0068864_1000291852 231
35 3300005618 Ga0068864_100035078 Ga0068864_1000350782 231
36 3300005834 Ga0068851_10091277 Ga0068851_100912772 231
37 3300005840 Ga0068870_10006343 Ga0068870_100063435 231
38 3300005841 Ga0068863_100027975 Ga0068863_1000279752 231
39 3300005841 Ga0068863_100095896 Ga0068863_1000958963 231
40 3300005842 Ga0068858_100051530 Ga0068858_1000515305 231
41 3300005842 Ga0068858_100257762 Ga0068858_1002577622 231
42 3300005843 Ga0068860_100004646 Ga0068860_10000464611 231
43 3300005843 Ga0068860_100005311 Ga0068860_1000053118 231
44 3300005844 Ga0068862_100041663 Ga0068862_1000416634 231
45 3300006237 Ga0097621_100007774 Ga0097621_1000077746 231
46 3300006358 Ga0068871_100002112 Ga0068871_1000021127 231
47 3300006358 Ga0068871_100317619 Ga0068871_1003176192 231
48 3300006846 Ga0075430_100042207 Ga0075430_1000422072 231
49 3300006846 Ga0075430_100317552 Ga0075430_1003175522 231
50 3300006847 Ga0075431_100019506 Ga0075431_1000195066 231
51 3300006880 Ga0075429_100399575 Ga0075429_1003995752 231
52 3300006881 Ga0068865_100028857 Ga0068865_1000288574 231
53 3300006931 Ga0097620_100035816 Ga0097620_1000358164 231
54 3300006931 Ga0097620_100053433 Ga0097620_1000534332 231
55 3300009098 Ga0105245_10123142 Ga0105245_101231422 231
56 3300009177 Ga0105248_10483919 Ga0105248_104839192 231
57 3300013100 Ga0157373_10391680 Ga0157373_103916801 231
58 3300025294 Ga0209025_1000700 Ga0209025_100070020 231
59 3300025315 Ga0207697_10040562 Ga0207697_100405622 231
60 3300025321 Ga0207656_10064122 Ga0207656_100641222 231
61 3300025893 Ga0207682_10021873 Ga0207682_100218733 231
62 3300025903 Ga0207680_10132328 Ga0207680_101323282 231
63 3300025907 Ga0207645_10000039 Ga0207645_1000003971 231
64 3300025923 Ga0207681_10061136 Ga0207681_100611363 231
65 3300025926 Ga0207659_10023693 Ga0207659_100236934 231
66 3300025931 Ga0207644_10152297 Ga0207644_101522972 231
67 3300025937 Ga0207669_10008950 Ga0207669_100089502 231
68 3300025938 Ga0207704_10008131 Ga0207704_100081314 231
69 3300025938 Ga0207704_10108172 Ga0207704_101081722 231
70 3300025940 Ga0207691_10000027 Ga0207691_1000002748 231
71 3300025941 Ga0207711_10016406 Ga0207711_100164065 231
72 3300025941 Ga0207711_10523490 Ga0207711_105234902 231
73 3300025942 Ga0207689_10020095 Ga0207689_100200952 231
74 3300025960 Ga0207651_10102631 Ga0207651_101026312 231
75 3300025972 Ga0207668_10010752 Ga0207668_100107525 231
76 3300025986 Ga0207658_10000682 Ga0207658_100006825 231
77 3300026023 Ga0207677_10252780 Ga0207677_102527802 231
78 3300026035 Ga0207703_10029920 Ga0207703_100299204 231
79 3300026035 Ga0207703_10098736 Ga0207703_100987363 231
80 3300026088 Ga0207641_10004919 Ga0207641_100049195 231
81 3300026088 Ga0207641_10052083 Ga0207641_100520833 231
82 3300026089 Ga0207648_10000149 Ga0207648_1000014938 231
83 3300026095 Ga0207676_10019761 Ga0207676_100197614 231
84 3300026095 Ga0207676_10337016 Ga0207676_103370162 231
85 3300026118 Ga0207675_100109305 Ga0207675_1001093053 231
86 3300026121 Ga0207683_10000061 Ga0207683_1000006175 231
87 3300027364 Ga0209967_1006794 Ga0209967_10067941 231
88 3300028379 Ga0268266_10009493 Ga0268266_100094936 231
89 3300028381 Ga0268264_10011913 Ga0268264_100119132 231
90 3300028381 Ga0268264_10021917 Ga0268264_100219175 231
91 3300031548 Ga0307408_100031806 Ga0307408_1000318063 231
92 3300031548 Ga0307408_100346951 Ga0307408_1003469512 231
93 3300031731 Ga0307405_10129545 Ga0307405_101295453 231
94 3300031824 Ga0307413_10260318 Ga0307413_102603181 231
95 3300031852 Ga0307410_10365533 Ga0307410_103655332 231
96 3300031911 Ga0307412_10494070 Ga0307412_104940702 231
97 3300032002 Ga0307416_100115378 Ga0307416_1001153783 231
98 3300032002 Ga0307416_100517026 Ga0307416_1005170262 231
99 3300037471 Ga0395905_0155559 Ga0395905_0155559_885_1580 231
100 3300041491 Ga0451833_0575700 Ga0451833_0575700_14_709 231
101 3300041496 Ga0451839_1091095 Ga0451839_1091095_465_1160 231
102 3300042001 Ga0439441_002101 Ga0439441_002101_1511_2206 231
103 3300042003 Ga0439443_001990 Ga0439443_001990_495_1190 231
104 3300042126 Ga0450888_005948 Ga0450888_005948_484_1179 231
105 3300042436 Ga0439435_0001172 Ga0439435_0001172_574_1269 231
106 3300042437 Ga0439444_0005291 Ga0439444_0005291_565_1260 231
107 3300042461 Ga0439460_0002976 Ga0439460_0002976_3293_3988 231
108 3300042461 Ga0439460_0047157 Ga0439460_0047157_245_940 231
109 3300046512 Ga0495610_0044523 Ga0495610_0044523_1296_1991 231
110 3300046519 Ga0495632_0070884 Ga0495632_0070884_218_913 231
111 3300046522 Ga0495643_0105313 Ga0495643_0105313_720_1415 231
112 3300047472 Ga0495686_0164458 Ga0495686_0164458_470_1165 231
113 3300049568 Ga0501031_0336710 Ga0501031_0336710_29_724 231
114 3300049575 Ga0501039_0027324 Ga0501039_0027324_2026_2721 231
115 3300049575 Ga0501039_0092213 Ga0501039_0092213_339_1034 231
116 3300049575 Ga0501039_0361584 Ga0501039_0361584_168_863 231
117 3300049576 Ga0501040_0042712 Ga0501040_0042712_1754_2449 231
118 3300049576 Ga0501040_0322458 Ga0501040_0322458_328_1023 231
119 3300049577 Ga0501041_0202785 Ga0501041_0202785_462_1157 231
120 3300049578 Ga0501042_0247888 Ga0501042_0247888_487_1182 231
121 3300049578 Ga0501042_0391806 Ga0501042_0391806_168_863 231
122 3300049580 Ga0501046_0337732 Ga0501046_0337732_208_903 231
123 3300049580 Ga0501046_0408962 Ga0501046_0408962_131_826 231
124 3300049587 Ga0501071_0000191 Ga0501071_0000191_16125_16820 231
125 3300049587 Ga0501071_0083938 Ga0501071_0083938_743_1438 231
126 3300049588 Ga0501072_0078898 Ga0501072_0078898_420_1115 231
127 3300049590 Ga0501074_0136749 Ga0501074_0136749_322_1017 231
128 3300049590 Ga0501074_0578509 Ga0501074_0578509_20_715 231
129 3300049591 Ga0501075_0022290 Ga0501075_0022290_1413_2108 231
130 3300049591 Ga0501075_0025919 Ga0501075_0025919_804_1499 231
131 3300049591 Ga0501075_0035016 Ga0501075_0035016_2719_3414 231
132 3300049592 Ga0501076_0051183 Ga0501076_0051183_642_1337 231
133 3300049592 Ga0501076_0206925 Ga0501076_0206925_106_801 231
134 3300049593 Ga0501077_0040388 Ga0501077_0040388_1201_1896 231
135 3300049593 Ga0501077_0183054 Ga0501077_0183054_268_963 231
136 3300049741 Ga0501079_0043496 Ga0501079_0043496_810_1505 231
137 3300049742 Ga0501080_0001849 Ga0501080_0001849_6772_7467 231
138 3300049742 Ga0501080_0091750 Ga0501080_0091750_250_945 231
139 3300049742 Ga0501080_0577267 Ga0501080_0577267_90_785 231
140 3300049743 Ga0501081_0101118 Ga0501081_0101118_946_1641 231
141 3300049743 Ga0501081_0129697 Ga0501081_0129697_214_909 231
142 3300049779 Ga0501283_009799 Ga0501283_009799_77_772 231
143 3300049822 Ga0501035_0383036 Ga0501035_0383036_438_1133 231
144 3300049824 Ga0501045_0033502 Ga0501045_0033502_2825_3520 231
145 3300049824 Ga0501045_0098423 Ga0501045_0098423_608_1303 231
146 3300050489 nmdc:mga03683_27046_c2 nmdc:mga03683_27046_c2_30_725 231
147 3300050508 nmdc:mga09592_255581_c1 nmdc:mga09592_255581_c1_616_1311 231
148 3300050509 nmdc:mga0qj67_20012_c1 nmdc:mga0qj67_20012_c1_2324_3019 231
149 3300050509 nmdc:mga0qj67_416775_c1 nmdc:mga0qj67_416775_c1_199_894 231
150 3300050510 nmdc:mga06r32_360533_c1 nmdc:mga06r32_360533_c1_111_806 231
151 3300050510 nmdc:mga06r32_53619_c1 nmdc:mga06r32_53619_c1_1757_2452 231
152 3300050516 nmdc:mga0sz30_193732_c1 nmdc:mga0sz30_193732_c1_196_891 231
153 3300053092 Ga0500583_0001275 Ga0500583_0001275_1663_2358 231
154 3300053108 Ga0500562_001157 Ga0500562_001157_3204_3899 231
155 3300053134 Ga0500658_0030541 Ga0500658_0030541_1369_2064 231
156 3300053739 Ga0500587_002291 Ga0500587_002291_1298_1993 231
157 3300054114 Ga0501084_0023221 Ga0501084_0023221_2744_3439 231
158 3300054114 Ga0501084_0052006 Ga0501084_0052006_250_945 231
159 3300059421 Ga0590071_013364 Ga0590071_013364_663_1358 231
160 3300059424 Ga0590075_030387 Ga0590075_030387_332_1027 231
161 3300060353 Ga0501082_0170801 Ga0501082_0170801_815_1510 231
162 3300061734 Ga0530510_0165510 Ga0530510_0165510_611_1306 231
163 3300005327 Ga0070658_10139982 Ga0070658_101399821 232
164 3300005842 Ga0068858_100187211 Ga0068858_1001872112 232
165 3300005843 Ga0068860_100220712 Ga0068860_1002207122 232
166 3300006847 Ga0075431_100510606 Ga0075431_1005106062 232
167 3300009176 Ga0105242_10489382 Ga0105242_104893822 232
168 3300009177 Ga0105248_10002843 Ga0105248_100028437 232
169 3300009551 Ga0105238_10687771 Ga0105238_106877711 232
170 3300009553 Ga0105249_10142374 Ga0105249_101423742 232
171 3300013296 Ga0157374_10014408 Ga0157374_100144082 232
172 3300013297 Ga0157378_10153520 Ga0157378_101535202 232
173 3300013306 Ga0163162_10012168 Ga0163162_100121682 232
174 3300013308 Ga0157375_10011190 Ga0157375_100111906 232
175 3300014968 Ga0157379_10010421 Ga0157379_100104214 232
176 3300014969 Ga0157376_10003285 Ga0157376_100032859 232
177 3300025909 Ga0207705_10192517 Ga0207705_101925172 232
178 3300027360 Ga0209969_1003248 Ga0209969_10032482 232
179 3300027526 Ga0209968_1006512 Ga0209968_10065123 232
180 3300027543 Ga0209999_1003433 Ga0209999_10034333 232
181 3300031548 Ga0307408_100201582 Ga0307408_1002015822 232
182 3300031727 Ga0316576_10134505 Ga0316576_101345052 232
183 3300031728 Ga0316578_10219203 Ga0316578_102192032 232
184 3300035398 Ga0316574_0072702 Ga0316574_0072702_1465_2163 232
185 3300048913 Ga0496110_0104435 Ga0496110_0104435_1111_1809 232
186 3300049568 Ga0501031_0027550 Ga0501031_0027550_1763_2461 232
187 3300049570 Ga0501033_0103716 Ga0501033_0103716_1112_1810 232
188 3300049577 Ga0501041_0075208 Ga0501041_0075208_613_1311 232
189 3300049578 Ga0501042_0039807 Ga0501042_0039807_1153_1851 232
190 3300049579 Ga0501043_0125227 Ga0501043_0125227_181_879 232
191 3300049580 Ga0501046_0124744 Ga0501046_0124744_54_752 232
192 3300049582 Ga0501048_0034017 Ga0501048_0034017_85_783 232
193 3300049588 Ga0501072_0033091 Ga0501072_0033091_2796_3494 232
194 3300049590 Ga0501074_0087082 Ga0501074_0087082_940_1638 232
195 3300049593 Ga0501077_0030202 Ga0501077_0030202_1551_2249 232
196 3300049741 Ga0501079_0007640 Ga0501079_0007640_2817_3515 232
197 3300049742 Ga0501080_0101148 Ga0501080_0101148_725_1426 232
198 3300049742 Ga0501080_0124175 Ga0501080_0124175_54_752 232
199 3300049743 Ga0501081_0052880 Ga0501081_0052880_811_1509 232
200 3300053117 Ga0500593_006313 Ga0500593_006313_2026_2724 232
201 3300060353 Ga0501082_0011090 Ga0501082_0011090_4142_4840 232
202 3300061734 Ga0530510_0131038 Ga0530510_0131038_143_841 232
203 3300061734 Ga0530510_0162384 Ga0530510_0162384_145_846 232
204 3300061734 Ga0530510_0494238 Ga0530510_0494238_88_786 232
205 3300005457 Ga0070662_100433613 Ga0070662_1004336131 234
206 3300005844 Ga0068862_100009604 Ga0068862_1000096047 234
207 3300028380 Ga0268265_10027297 Ga0268265_100272974 234
208 3300031456 Ga0307513_10083657 Ga0307513_100836572 234
209 3300050493 nmdc:mga0k408_2052_c1 nmdc:mga0k408_2052_c1_7455_8195 234
210 3300050496 nmdc:mga07m45_194_c1 nmdc:mga07m45_194_c1_10264_11004 234
211 3300049593 Ga0501077_0069784 Ga0501077_0069784_455_1162 235
212 3300046542 Ga0495597_0095760 Ga0495597_0095760_69_782 236
213 iso_pu_bacteria 2585428057 2587730000 237
214 iso_pu_bacteria 2585428058 2587734874 237
215 iso_pu_bacteria 2585428062 2587757927 237
216 iso_pu_bacteria 2588253510 2588293175 237
217 iso_pu_bacteria 2643221592 2643968405 237
218 iso_pu_bacteria 2643221625 2644141803 237
219 iso_pu_bacteria 2643221648 2644272527 237
220 3300006038 Ga0075365_10053623 Ga0075365_100536232 238
221 3300025284 Ga0209130_1003748 Ga0209130_10037485 238
222 3300025291 Ga0209675_1001283 Ga0209675_10012835 238
223 3300025292 Ga0209676_1030119 Ga0209676_10301193 238
224 3300050493 nmdc:mga0k408_216765_c1 nmdc:mga0k408_216765_c1_225_953 238
225 iso_pu_bacteria 2738543013 2739252128 238
226 3300005544 Ga0070686_100529202 Ga0070686_1005292022 239
227 3300006048 Ga0075363_100185327 Ga0075363_1001853272 239
228 3300006177 Ga0075362_10063872 Ga0075362_100638722 239
229 3300006178 Ga0075367_10120068 Ga0075367_101200682 239
230 3300006195 Ga0075366_10169583 Ga0075366_101695832 239
231 3300009094 Ga0111539_10406392 Ga0111539_104063922 239
232 3300042128 Ga0450897_010430 Ga0450897_010430_122_841 239
233 3300042435 Ga0439434_0072308 Ga0439434_0072308_171_890 239
234 3300050489 nmdc:mga03683_43808_c1 nmdc:mga03683_43808_c1_699_1433 239
235 3300050490 nmdc:mga03n38_180274_c1 nmdc:mga03n38_180274_c1_302_1036 239
236 3300050491 nmdc:mga00v17_3538_c1 nmdc:mga00v17_3538_c1_6959_7693 239
237 3300050492 nmdc:mga0yw44_53927_c1 nmdc:mga0yw44_53927_c1_912_1646 239
238 3300050493 nmdc:mga0k408_63366_c1 nmdc:mga0k408_63366_c1_912_1646 239
239 3300050516 nmdc:mga0sz30_32502_c1 nmdc:mga0sz30_32502_c1_1036_1770 239
240 3300002773 JGI25152J39213_1002162 JGI25152J39213_10021625 241
241 3300002774 JGI25150J39212_1003203 JGI25150J39212_10032034 241
242 3300003215 JGI25153J46596_10001286 JGI25153J46596_100012867 241
243 3300003215 JGI25153J46596_10003485 JGI25153J46596_100034858 241
244 3300003771 Ga0055526_1001550 Ga0055526_10015506 241
245 3300003791 Ga0055530_10008972 Ga0055530_100089725 241
246 3300005262 Ga0065165_1000832 Ga0065165_100083216 241
247 3300005330 Ga0070690_100069062 Ga0070690_1000690622 241
248 3300005333 Ga0070677_10047208 Ga0070677_100472082 241
249 3300005343 Ga0070687_100184503 Ga0070687_1001845032 241
250 3300005344 Ga0070661_100502639 Ga0070661_1005026391 241
251 3300005347 Ga0070668_100365753 Ga0070668_1003657532 241
252 3300005356 Ga0070674_100004011 Ga0070674_1000040116 241
253 3300005367 Ga0070667_100086380 Ga0070667_1000863802 241
254 3300005441 Ga0070700_100012347 Ga0070700_1000123472 241
255 3300005456 Ga0070678_100159257 Ga0070678_1001592572 241
256 3300005459 Ga0068867_100002629 Ga0068867_10000262911 241
257 3300005543 Ga0070672_100037180 Ga0070672_1000371803 241
258 3300005719 Ga0068861_100161386 Ga0068861_1001613862 241
259 3300005843 Ga0068860_100001387 Ga0068860_1000013872 241
260 3300005844 Ga0068862_100010800 Ga0068862_1000108002 241
261 3300006353 Ga0075370_10060778 Ga0075370_100607783 241
262 3300006881 Ga0068865_100000371 Ga0068865_1000003713 241
263 3300009148 Ga0105243_10056478 Ga0105243_100564783 241
264 3300009553 Ga0105249_10052708 Ga0105249_100527083 241
265 3300013297 Ga0157378_10010272 Ga0157378_100102727 241
266 3300013306 Ga0163162_10004491 Ga0163162_100044913 241
267 3300014326 Ga0157380_10212790 Ga0157380_102127902 241
268 3300017792 Ga0163161_10022474 Ga0163161_100224743 241
269 3300025245 Ga0207425_1000737 Ga0207425_10007379 241
270 3300025258 Ga0209129_1000075 Ga0209129_1000075114 241
271 3300025295 Ga0209564_1000046 Ga0209564_1000046278 241
272 3300025297 Ga0209758_1000045 Ga0209758_1000045279 241
273 3300025297 Ga0209758_1000052 Ga0209758_1000052185 241
274 3300025298 Ga0209050_1000257 Ga0209050_100025781 241
275 3300025304 Ga0209257_1024493 Ga0209257_10244932 241
276 3300025893 Ga0207682_10093992 Ga0207682_100939922 241
277 3300025920 Ga0207649_10319384 Ga0207649_103193842 241
278 3300025923 Ga0207681_10218155 Ga0207681_102181552 241
279 3300025935 Ga0207709_10044197 Ga0207709_100441973 241
280 3300025937 Ga0207669_10008907 Ga0207669_100089073 241
281 3300025938 Ga0207704_10088140 Ga0207704_100881402 241
282 3300025940 Ga0207691_10118875 Ga0207691_101188752 241
283 3300025961 Ga0207712_10057128 Ga0207712_100571282 241
284 3300025972 Ga0207668_10096067 Ga0207668_100960672 241
285 3300025986 Ga0207658_10128182 Ga0207658_101281822 241
286 3300026075 Ga0207708_10018904 Ga0207708_100189045 241
287 3300026089 Ga0207648_10011696 Ga0207648_100116967 241
288 3300026118 Ga0207675_100009000 Ga0207675_1000090008 241
289 3300026121 Ga0207683_10164449 Ga0207683_101644492 241
290 3300028381 Ga0268264_10288894 Ga0268264_102888942 241
291 3300028786 Ga0307517_10091137 Ga0307517_100911372 241
292 3300028786 Ga0307517_10093398 Ga0307517_100933982 241
293 3300028794 Ga0307515_10003694 Ga0307515_1000369428 241
294 3300028794 Ga0307515_10062265 Ga0307515_100622654 241
295 3300028794 Ga0307515_10226263 Ga0307515_102262632 241
296 3300031251 Ga0265327_10000194 Ga0265327_1000019454 241
297 3300031456 Ga0307513_10016206 Ga0307513_100162064 241
298 3300031456 Ga0307513_10175729 Ga0307513_101757293 241
299 3300031456 Ga0307513_10283373 Ga0307513_102833732 241
300 3300031507 Ga0307509_10394941 Ga0307509_103949411 241
301 3300031730 Ga0307516_10002426 Ga0307516_100024266 241
302 3300031730 Ga0307516_10004231 Ga0307516_1000423111 241
303 3300031730 Ga0307516_10005929 Ga0307516_1000592911 241
304 3300031730 Ga0307516_10027890 Ga0307516_100278902 241
305 3300041443 Ga0451789_0450837 Ga0451789_0450837_93_830 241
306 3300041456 Ga0451795_1053407 Ga0451795_1053407_578_1315 241
307 3300041512 Ga0451853_3584764 Ga0451853_3584764_88_819 241
308 3300042004 Ga0439445_0009037 Ga0439445_0009037_587_1339 241
309 3300046471 Ga0495650_0004691 Ga0495650_0004691_6585_7331 241
310 3300046512 Ga0495610_0066833 Ga0495610_0066833_80_817 241
311 3300046519 Ga0495632_0002042 Ga0495632_0002042_4184_4921 241
312 3300046528 Ga0495642_0154037 Ga0495642_0154037_37_789 241
313 3300046615 Ga0495656_0000171 Ga0495656_0000171_6445_7197 241
314 3300046660 Ga0495625_0044662 Ga0495625_0044662_2224_2955 241
315 3300047445 Ga0495677_0089672 Ga0495677_0089672_10_762 241
316 3300050493 nmdc:mga0k408_64964_c1 nmdc:mga0k408_64964_c1_720_1451 241
317 3300053080 Ga0500635_0066765 Ga0500635_0066765_402_1169 241
318 3300053086 Ga0500578_0001274 Ga0500578_0001274_882_1619 241
319 3300053088 Ga0500644_0013050 Ga0500644_0013050_1212_1949 241
320 3300053096 Ga0500641_0188462 Ga0500641_0188462_100_837 241
321 3300053108 Ga0500562_022313 Ga0500562_022313_247_972 241
322 3300053130 Ga0500642_0022160 Ga0500642_0022160_1431_2168 241
323 3300053131 Ga0500652_000948 Ga0500652_000948_3945_4682 241
324 3300053136 Ga0500559_0053455 Ga0500559_0053455_257_985 241
325 3300053139 Ga0500568_0023214 Ga0500568_0023214_898_1635 241
326 3300053156 Ga0500622_0000164 Ga0500622_0000164_60912_61649 241
327 3300059423 Ga0590074_019942 Ga0590074_019942_172_912 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

59

203

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.924 10 241
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9152 12 228
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.8944 12 241
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.8925 12 239
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.8906 10 241
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9237 10 75 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9226 8 241 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9164 12 223 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9136 12 240 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9074 8 241 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A160UW17-F1-model_v4 deleted 0.9924 11 241
AF-A0A160UW17-F1-model_v4 deleted 0.9797 11 241
AF-A0A652ZTX6-F1-model_v4 High-affinity branched-chain amino acid transport ATP-binding protein BraG 0.9762 11 241 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1F3ZYT2-F1-model_v4 ABC transporter ATP-binding protein 0.9732 19 241 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A4R3M7V2-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 2 (HAAT family) 0.9695 12 241 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
94.13 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map