F408712

General Info

Members Datasets Scaffolds Average Seq Length
327 221 654 198

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1108433|Ga0081540_11084332
Length 215
Sequence VSTALLVVAGYVLGSMPWGYWLVRLFKHEDIRCQGSGNIGGTNVWRVYGWRLGLPVVVLDTAKGFVPAFVATLTVSHLAGVLAGAAAMLGHWRPLFLKWQRGGKVVATCGGAFLGVAPLVGGIGAGVWIVVFLLFRYASLASMLAALSLPIAAALLSEPWPVIVFASGAAAAVIVLHRANIARLRAGTETKFKFRSLTPKESDPGSSGGTAQPLP

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
129 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
157 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
158 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
180 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.62
Rhizosphere 88.07
Stem 0
Stem Tuber 0
Unclassified 5.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1108433 3300005983 Bacteria 1180
2 Ga0070677_10289672 3300005333 Bacteria 828
3 Ga0068869_100066275 3300005334 Bacteria 2660
4 Ga0070666_10155116 3300005335 Bacteria 1599
5 Ga0070680_100320147 3300005336 Bacteria 1316
6 Ga0070682_100007437 3300005337 Bacteria 6178
7 Ga0070682_100026853 3300005337 Bacteria 3449
8 Ga0068868_100278722 3300005338 Bacteria 1414
9 Ga0070660_100070622 3300005339 Bacteria 2725
10 Ga0070689_100007213 3300005340 Bacteria 7748
11 Ga0070687_100044273 3300005343 Bacteria 2267
12 Ga0070692_10020006 3300005345 Bacteria 3239
13 Ga0070671_100009533 3300005355 Bacteria 7796
14 Ga0070674_100004949 3300005356 Bacteria 7634
15 Ga0070688_100008854 3300005365 Bacteria 5478
16 Ga0070659_100108975 3300005366 Bacteria 2234
17 Ga0070714_100435506 3300005435 Bacteria 1244
18 Ga0070714_100436242 3300005435 Bacteria 1242
19 Ga0070713_100781792 3300005436 Bacteria 914
20 Ga0070710_10018004 3300005437 Bacteria 3627
21 Ga0070711_100013012 3300005439 Bacteria 5216
22 Ga0070711_100145863 3300005439 Bacteria 1780
23 Ga0070700_100016978 3300005441 Bacteria 4155
24 Ga0070694_100040937 3300005444 Bacteria 3089
25 Ga0070694_100147687 3300005444 Bacteria 1714
26 Ga0070708_100311557 3300005445 Bacteria 1482
27 Ga0070708_100430021 3300005445 Bacteria 1245
28 Ga0070708_100609997 3300005445 Bacteria 1029
29 Ga0070663_100007401 3300005455 Bacteria 6679
30 Ga0070663_100270565 3300005455 Bacteria 1351
31 Ga0070678_100012084 3300005456 Bacteria 5352
32 Ga0070678_100015863 3300005456 Bacteria 4800
33 Ga0070662_100478807 3300005457 Bacteria 1036
34 Ga0068867_100058963 3300005459 Bacteria 2844
35 Ga0070685_10022108 3300005466 Bacteria 3463
36 Ga0070706_100008962 3300005467 Bacteria 9318
37 Ga0070706_100625855 3300005467 Bacteria 999
38 Ga0070707_100001390 3300005468 Bacteria 23809
39 Ga0070707_100011304 3300005468 Bacteria 8322
40 Ga0070707_100046410 3300005468 Bacteria 4158
41 Ga0070707_100268298 3300005468 Bacteria 1660
42 Ga0070698_100005322 3300005471 Bacteria 14087
43 Ga0070698_100080180 3300005471 Bacteria 3259
44 Ga0070698_100268237 3300005471 Bacteria 1638
45 Ga0070699_100054167 3300005518 Bacteria 3472
46 Ga0070699_100280789 3300005518 Unclassified 1491
47 Ga0070679_100438152 3300005530 Bacteria 1252
48 Ga0070697_100200390 3300005536 Bacteria 1697
49 Ga0068853_100100678 3300005539 Bacteria 2555
50 Ga0070695_100000072 3300005545 Bacteria 40551
51 Ga0070696_100036750 3300005546 Bacteria 3377
52 Ga0070696_100110647 3300005546 Bacteria 1978
53 Ga0070696_100357979 3300005546 Bacteria 1132
54 Ga0070693_100136824 3300005547 Bacteria 1538
55 Ga0070693_100191218 3300005547 Bacteria 1324
56 Ga0070693_100407554 3300005547 Bacteria 944
57 Ga0068854_100167091 3300005578 Bacteria 1709
58 Ga0068854_100379427 3300005578 Bacteria 1164
59 Ga0068856_100050320 3300005614 Bacteria 4107
60 Ga0070702_100008466 3300005615 Bacteria 4983
61 Ga0068859_100143953 3300005617 Bacteria 2458
62 Ga0068866_10004578 3300005718 Bacteria 5665
63 Ga0068861_100088850 3300005719 Bacteria 2434
64 Ga0068858_100169986 3300005842 Bacteria 2055
65 Ga0068862_100347850 3300005844 Bacteria 1375
66 Ga0081455_10154163 3300005937 Bacteria 1768
67 Ga0070717_10082713 3300006028 Bacteria 2698
68 Ga0070717_10151533 3300006028 Bacteria 2006
69 Ga0070715_10008347 3300006163 Bacteria 3606
70 Ga0070715_10234678 3300006163 Bacteria 951
71 Ga0070716_100050072 3300006173 Bacteria 2369
72 Ga0070712_100011833 3300006175 Bacteria 5543
73 Ga0070712_100046410 3300006175 Bacteria 3003
74 Ga0097621_100085535 3300006237 Bacteria 2630
75 Ga0097621_100137043 3300006237 Bacteria 2088
76 Ga0075428_101313837 3300006844 Bacteria 760
77 Ga0075433_10014274 3300006852 Bacteria 6488
78 Ga0075434_100293959 3300006871 Bacteria 1644
79 Ga0068865_100004034 3300006881 Bacteria 8817
80 Ga0075436_100212803 3300006914 Bacteria 1371
81 Ga0097620_100143959 3300006931 Bacteria 2458
82 Ga0075435_100031675 3300007076 Bacteria 4168
83 Ga0075435_100578205 3300007076 Bacteria 974
84 Ga0105240_10054046 3300009093 Bacteria 5035
85 Ga0111539_11293551 3300009094 Bacteria 846
86 Ga0105245_10054784 3300009098 Bacteria 3581
87 Ga0105245_10816240 3300009098 Bacteria 971
88 Ga0105247_10055599 3300009101 Bacteria 2442
89 Ga0114129_10005843 3300009147 Bacteria 17425
90 Ga0114129_10185248 3300009147 Bacteria 2830
91 Ga0114129_10423027 3300009147 Unclassified 1752
92 Ga0105241_10064109 3300009174 Bacteria 2836
93 Ga0105241_10122210 3300009174 Bacteria 2098
94 Ga0105242_10026685 3300009176 Bacteria 4579
95 Ga0105248_10117597 3300009177 Bacteria 2998
96 Ga0105237_10010187 3300009545 Bacteria 10016
97 Ga0105238_10142058 3300009551 Bacteria 2377
98 Ga0105249_10028798 3300009553 Bacteria 5014
99 Ga0105239_10018124 3300010375 Bacteria 7783
100 Ga0105246_10428191 3300011119 Bacteria 1106
101 Ga0157373_10105119 3300013100 Bacteria 1986
102 Ga0157370_10098873 3300013104 Bacteria 2735
103 Ga0157369_10678937 3300013105 Unclassified 1061
104 Ga0157374_10059051 3300013296 Bacteria 3585
105 Ga0157378_10047988 3300013297 Bacteria 3797
106 Ga0163162_10012177 3300013306 Bacteria 8395
107 Ga0157372_10121400 3300013307 Bacteria 3002
108 Ga0157372_10389450 3300013307 Bacteria 1624
109 Ga0157375_11608666 3300013308 Bacteria 768
110 Ga0157377_10013240 3300014745 Bacteria 4171
111 Ga0157376_10022913 3300014969 Bacteria 4877
112 Ga0157376_10066985 3300014969 Bacteria 3036
113 Ga0163161_10194583 3300017792 Bacteria 1560
114 Ga0207692_10036547 3300025898 Bacteria 2396
115 Ga0207642_10010084 3300025899 Bacteria 3313
116 Ga0207710_10060620 3300025900 Bacteria 1715
117 Ga0207680_10066551 3300025903 Bacteria 2217
118 Ga0207647_10094243 3300025904 Bacteria 1784
119 Ga0207699_10016428 3300025906 Bacteria 3872
120 Ga0207699_10065022 3300025906 Unclassified 2209
121 Ga0207684_10011311 3300025910 Bacteria 7814
122 Ga0207684_10078742 3300025910 Bacteria 2803
123 Ga0207684_10525530 3300025910 Bacteria 1013
124 Ga0207654_10093879 3300025911 Bacteria 1835
125 Ga0207654_10267639 3300025911 Bacteria 1152
126 Ga0207671_10049007 3300025914 Bacteria 3126
127 Ga0207693_10008489 3300025915 Bacteria 8409
128 Ga0207693_10061917 3300025915 Bacteria 2931
129 Ga0207663_10390331 3300025916 Bacteria 1062
130 Ga0207660_10304657 3300025917 Bacteria 1269
131 Ga0207652_10315709 3300025921 Bacteria 1411
132 Ga0207646_10008628 3300025922 Bacteria 10188
133 Ga0207646_10011847 3300025922 Bacteria 8413
134 Ga0207646_10078163 3300025922 Bacteria 2957
135 Ga0207646_10164045 3300025922 Bacteria 2006
136 Ga0207687_10598302 3300025927 Bacteria 929
137 Ga0207700_10479336 3300025928 Bacteria 1099
138 Ga0207664_10042035 3300025929 Bacteria 3565
139 Ga0207644_10066765 3300025931 Bacteria 2620
140 Ga0207690_10176359 3300025932 Bacteria 1605
141 Ga0207706_10292376 3300025933 Bacteria 1420
142 Ga0207686_10054359 3300025934 Bacteria 2508
143 Ga0207709_10001948 3300025935 Bacteria 13509
144 Ga0207670_10076389 3300025936 Bacteria 2330
145 Ga0207669_10001022 3300025937 Bacteria 11950
146 Ga0207704_10000430 3300025938 Bacteria 18740
147 Ga0207665_10140414 3300025939 Bacteria 1722
148 Ga0207665_10257495 3300025939 Bacteria 1291
149 Ga0207691_10025065 3300025940 Bacteria 5603
150 Ga0207689_10078039 3300025942 Bacteria 2721
151 Ga0207712_10007386 3300025961 Bacteria 6937
152 Ga0207640_10196458 3300025981 Bacteria 1525
153 Ga0207640_10301900 3300025981 Bacteria 1267
154 Ga0207677_10775376 3300026023 Bacteria 856
155 Ga0207703_10109697 3300026035 Bacteria 2352
156 Ga0207639_10078833 3300026041 Bacteria 2601
157 Ga0207678_10392948 3300026067 Bacteria 1200
158 Ga0207708_10000352 3300026075 Bacteria 36059
159 Ga0207702_10053447 3300026078 Bacteria 3419
160 Ga0207641_10263860 3300026088 Bacteria 1614
161 Ga0207648_10000454 3300026089 Bacteria 45454
162 Ga0207675_100078193 3300026118 Bacteria 3099
163 Ga0207683_10021532 3300026121 Bacteria 5522
164 Ga0207428_10333803 3300027907 Bacteria 1118
165 Ga0268266_10082617 3300028379 Bacteria 2803
166 Ga0268265_10231026 3300028380 Bacteria 1626
167 Ga0265337_1018565 3300028556 Bacteria 2207
168 Ga0265318_10044734 3300028577 Bacteria 1675
169 Ga0265322_10132147 3300028654 Bacteria 712
170 Ga0265336_10052048 3300028666 Bacteria 1235
171 Ga0265338_10010390 3300028800 Bacteria 10923
172 Ga0265330_10026883 3300031235 Bacteria 2601
173 Ga0265332_10046286 3300031238 Bacteria 1873
174 Ga0265320_10109465 3300031240 Unclassified 1266
175 Ga0265325_10082195 3300031241 Bacteria 1599
176 Ga0265325_10181097 3300031241 Bacteria 981
177 Ga0265339_10004875 3300031249 Bacteria 9055
178 Ga0265331_10110749 3300031250 Bacteria 1259
179 Ga0265327_10043846 3300031251 Bacteria 2390
180 Ga0265327_10085086 3300031251 Unclassified 1553
181 Ga0265316_10069749 3300031344 Bacteria 2712
182 Ga0265316_10152388 3300031344 Bacteria 1731
183 Ga0265313_10018867 3300031595 Bacteria 3859
184 Ga0265314_10037774 3300031711 Bacteria 3496
185 Ga0265342_10072211 3300031712 Bacteria 2010
186 Ga0307409_100133265 3300031995 Bacteria 2127
187 Ga0307416_101270894 3300032002 Bacteria 842
188 Ga0373928_0027950 3300035084 Bacteria 1231
189 Ga0373932_0085582 3300035112 Bacteria 1003
190 Ga0373942_0038274 3300035207 Bacteria 1300
191 Ga0373962_0026229 3300035242 Bacteria 1569
192 Ga0373931_0076962 3300035691 Bacteria 1833
193 Ga0373925_0108832 3300037068 Bacteria 2139
194 Ga0395899_0005507 3300037312 Bacteria 9807
195 Ga0395899_0013850 3300037312 Bacteria 6161
196 Ga0395900_0009982 3300037418 Bacteria 9718
197 Ga0395900_0020346 3300037418 Bacteria 6774
198 Ga0395900_0021716 3300037418 Bacteria 6562
199 Ga0395900_0067621 3300037418 Bacteria 3671
200 Ga0395900_0143138 3300037418 Bacteria 2447
201 Ga0395900_0350301 3300037418 Bacteria 1450
202 Ga0395900_0712644 3300037418 Bacteria 936
203 Ga0395900_1124237 3300037418 Unclassified 702
204 Ga0395898_0001631 3300037466 Bacteria 30388
205 Ga0395898_0010273 3300037466 Bacteria 9799
206 Ga0395898_0032301 3300037466 Bacteria 5224
207 Ga0395898_0032496 3300037466 Bacteria 5209
208 Ga0395898_0128148 3300037466 Bacteria 2431
209 Ga0395898_0478671 3300037466 Bacteria 1185
210 Ga0395898_0859393 3300037466 Bacteria 846
211 Ga0395905_0009450 3300037471 Bacteria 9528
212 Ga0395905_0010819 3300037471 Bacteria 8838
213 Ga0395905_0050982 3300037471 Bacteria 3876
214 Ga0395905_0052814 3300037471 Bacteria 3804
215 Ga0395905_0134619 3300037471 Bacteria 2324
216 Ga0395901_0000370 3300038443 Bacteria 54012
217 Ga0395901_0020386 3300038443 Bacteria 6786
218 Ga0395901_0028123 3300038443 Bacteria 5783
219 Ga0395901_0032491 3300038443 Bacteria 5384
220 Ga0395901_0034393 3300038443 Bacteria 5233
221 Ga0395901_0348044 3300038443 Bacteria 1530
222 Ga0436363_0331802 3300039450 Bacteria 785
223 Ga0439453_0000543 3300041408 Bacteria 4207
224 Ga0439451_009684 3300042009 Bacteria 1948
225 Ga0439454_002129 3300042011 Bacteria 2039
226 Ga0466972_0109918 3300044658 Bacteria 1303
227 Ga0466965_0310169 3300044683 Bacteria 858
228 Ga0466961_0046163 3300044693 Bacteria 2787
229 Ga0466963_0001427 3300044694 Bacteria 12874
230 Ga0466963_0002884 3300044694 Bacteria 9716
231 Ga0466964_0000233 3300044706 Bacteria 15978
232 Ga0466971_0267939 3300044719 Bacteria 816
233 Ga0466968_0002266 3300044735 Bacteria 7030
234 Ga0466968_0024396 3300044735 Bacteria 2470
235 Ga0466968_0059952 3300044735 Bacteria 1640
236 Ga0466970_0029914 3300044765 Bacteria 2871
237 Ga0466957_0038964 3300044842 Bacteria 2866
238 Ga0466957_0133141 3300044842 Bacteria 1595
239 Ga0466960_0148824 3300044901 Bacteria 1249
240 Ga0466967_0059395 3300045976 Bacteria 3385
241 Ga0466967_0113120 3300045976 Bacteria 2496
242 Ga0466967_0132671 3300045976 Bacteria 2314
243 Ga0466967_0718066 3300045976 Bacteria 990
244 Ga0495603_0011881 3300046455 Bacteria 5269
245 Ga0495603_0211175 3300046455 Unclassified 1121
246 Ga0495629_0119007 3300046459 Unclassified 1840
247 Ga0495629_0189459 3300046459 Bacteria 1424
248 Ga0495641_0048714 3300046461 Bacteria 1942
249 Ga0495580_0476982 3300046472 Bacteria 835
250 Ga0495582_0099037 3300046473 Bacteria 1631
251 Ga0495582_0324750 3300046473 Bacteria 885
252 Ga0495605_0042261 3300046474 Bacteria 2267
253 Ga0495639_0200498 3300046475 Unclassified 977
254 Ga0495662_0071454 3300046476 Unclassified 1682
255 Ga0495585_0236589 3300046492 Bacteria 916
256 Ga0495596_0031802 3300046500 Bacteria 2106
257 Ga0495607_0115761 3300046501 Bacteria 1415
258 Ga0495630_0306865 3300046517 Bacteria 1213
259 Ga0495631_0010814 3300046518 Bacteria 4508
260 Ga0495644_0047334 3300046523 Bacteria 1616
261 Ga0495663_0014503 3300046525 Bacteria 2210
262 Ga0495642_0097728 3300046528 Bacteria 1247
263 Ga0495665_0032743 3300046531 Bacteria 2781
264 Ga0495659_0018036 3300046664 Bacteria 2347
265 Ga0495588_0049460 3300046674 Bacteria 2162
266 Ga0495658_0082981 3300046683 Bacteria 1884
267 Ga0495613_0118433 3300046689 Unclassified 1903
268 Ga0495613_0335845 3300046689 Bacteria 1040
269 Ga0495670_0467591 3300046691 Unclassified 684
270 Ga0495589_0059544 3300046794 Unclassified 1877
271 Ga0495589_0063833 3300046794 Unclassified 1806
272 Ga0495589_0094783 3300046794 Bacteria 1448
273 Ga0495581_0026455 3300047315 Bacteria 3363
274 Ga0495614_0268195 3300048089 Bacteria 784
275 Ga0496100_0022678 3300048903 Bacteria 3801
276 Ga0496100_0044218 3300048903 Bacteria 2851
277 Ga0496101_0021654 3300048904 Bacteria 4417
278 Ga0496101_0107550 3300048904 Bacteria 2095
279 Ga0496101_0250884 3300048904 Bacteria 1379
280 Ga0496102_0036831 3300048905 Bacteria 4409
281 Ga0496102_0316792 3300048905 Unclassified 1469
282 Ga0496102_0689922 3300048905 Bacteria 944
283 Ga0496103_0002452 3300048906 Bacteria 11663
284 Ga0496103_0019732 3300048906 Bacteria 4046
285 Ga0496103_0172597 3300048906 Bacteria 1388
286 Ga0496104_0109760 3300048907 Bacteria 2644
287 Ga0496104_0293123 3300048907 Bacteria 1539
288 Ga0496105_0004171 3300048908 Bacteria 10852
289 Ga0496105_0129158 3300048908 Bacteria 2084
290 Ga0496106_0003849 3300048909 Bacteria 11188
291 Ga0496106_0091562 3300048909 Unclassified 2348
292 Ga0496106_0133886 3300048909 Bacteria 1945
293 Ga0496106_0320646 3300048909 Bacteria 1244
294 Ga0496107_0091401 3300048910 Bacteria 2224
295 Ga0496107_0257301 3300048910 Bacteria 1299
296 Ga0496108_0002184 3300048911 Bacteria 15701
297 Ga0496108_0302269 3300048911 Bacteria 1394
298 Ga0496109_0006032 3300048912 Bacteria 10183
299 Ga0496109_0019767 3300048912 Bacteria 5941
300 Ga0496109_0276534 3300048912 Bacteria 1582
301 Ga0496110_0080639 3300048913 Bacteria 2900
302 Ga0496111_0053296 3300048914 Bacteria 2922
303 Ga0496111_0230081 3300048914 Bacteria 1377
304 Ga0496112_0040108 3300048915 Bacteria 4577
305 Ga0496112_0040149 3300048915 Bacteria 4575
306 Ga0496112_0624076 3300048915 Bacteria 1009
307 Ga0496113_0082172 3300048916 Bacteria 2470
308 Ga0496114_0003888 3300048917 Bacteria 11517
309 Ga0496114_0081498 3300048917 Bacteria 2733
310 Ga0496114_0475530 3300048917 Bacteria 1105
311 Ga0496115_0015946 3300048918 Bacteria 5712
312 Ga0496115_0100147 3300048918 Bacteria 2375
313 Ga0501069_0010254 3300049585 Bacteria 4958
314 Ga0501045_0290881 3300049824 Bacteria 1216
315 nmdc:mga05p37_127566_c1 3300050507 Bacteria 3123
316 nmdc:mga05p37_91702_c1 3300050507 Bacteria 3744
317 nmdc:mga0n895_109126_c1 3300050512 Bacteria 2783
318 nmdc:mga0n895_417958_c1 3300050512 Unclassified 1355
319 nmdc:mga0rr50_1104_c1 3300050513 Bacteria 14644
320 nmdc:mga0rr50_12626_c1 3300050513 Bacteria 5468
321 nmdc:mga08x19_19984_c1 3300050514 Bacteria 4120
322 nmdc:mga08x19_63446_c1 3300050514 Bacteria 2397
323 nmdc:mga0a205_110429_c1 3300050515 Bacteria 2649
324 Ga0495619_0196700 3300053085 Bacteria 1396
325 Ga0501084_0489130 3300054114 Bacteria 1040
326 Ga0466962_0035085 3300061719 Bacteria 2401
327 Ga0530510_0160885 3300061734 Bacteria 1661
328 Ga0081540_1108433
329 Ga0070677_10289672
330 Ga0068869_100066275
331 Ga0070666_10155116
332 Ga0070680_100320147
333 Ga0070682_100007437
334 Ga0070682_100026853
335 Ga0068868_100278722
336 Ga0070660_100070622
337 Ga0070689_100007213
338 Ga0070687_100044273
339 Ga0070692_10020006
340 Ga0070671_100009533
341 Ga0070674_100004949
342 Ga0070688_100008854
343 Ga0070659_100108975
344 Ga0070714_100435506
345 Ga0070714_100436242
346 Ga0070713_100781792
347 Ga0070710_10018004
348 Ga0070711_100013012
349 Ga0070711_100145863
350 Ga0070700_100016978
351 Ga0070694_100040937
352 Ga0070694_100147687
353 Ga0070708_100311557
354 Ga0070708_100430021
355 Ga0070708_100609997
356 Ga0070663_100007401
357 Ga0070663_100270565
358 Ga0070678_100012084
359 Ga0070678_100015863
360 Ga0070662_100478807
361 Ga0068867_100058963
362 Ga0070685_10022108
363 Ga0070706_100008962
364 Ga0070706_100625855
365 Ga0070707_100001390
366 Ga0070707_100011304
367 Ga0070707_100046410
368 Ga0070707_100268298
369 Ga0070698_100005322
370 Ga0070698_100080180
371 Ga0070698_100268237
372 Ga0070699_100054167
373 Ga0070699_100280789
374 Ga0070679_100438152
375 Ga0070697_100200390
376 Ga0068853_100100678
377 Ga0070695_100000072
378 Ga0070696_100036750
379 Ga0070696_100110647
380 Ga0070696_100357979
381 Ga0070693_100136824
382 Ga0070693_100191218
383 Ga0070693_100407554
384 Ga0068854_100167091
385 Ga0068854_100379427
386 Ga0068856_100050320
387 Ga0070702_100008466
388 Ga0068859_100143953
389 Ga0068866_10004578
390 Ga0068861_100088850
391 Ga0068858_100169986
392 Ga0068862_100347850
393 Ga0081455_10154163
394 Ga0070717_10082713
395 Ga0070717_10151533
396 Ga0070715_10008347
397 Ga0070715_10234678
398 Ga0070716_100050072
399 Ga0070712_100011833
400 Ga0070712_100046410
401 Ga0097621_100085535
402 Ga0097621_100137043
403 Ga0075428_101313837
404 Ga0075433_10014274
405 Ga0075434_100293959
406 Ga0068865_100004034
407 Ga0075436_100212803
408 Ga0097620_100143959
409 Ga0075435_100031675
410 Ga0075435_100578205
411 Ga0105240_10054046
412 Ga0111539_11293551
413 Ga0105245_10054784
414 Ga0105245_10816240
415 Ga0105247_10055599
416 Ga0114129_10005843
417 Ga0114129_10185248
418 Ga0114129_10423027
419 Ga0105241_10064109
420 Ga0105241_10122210
421 Ga0105242_10026685
422 Ga0105248_10117597
423 Ga0105237_10010187
424 Ga0105238_10142058
425 Ga0105249_10028798
426 Ga0105239_10018124
427 Ga0105246_10428191
428 Ga0157373_10105119
429 Ga0157370_10098873
430 Ga0157369_10678937
431 Ga0157374_10059051
432 Ga0157378_10047988
433 Ga0163162_10012177
434 Ga0157372_10121400
435 Ga0157372_10389450
436 Ga0157375_11608666
437 Ga0157377_10013240
438 Ga0157376_10022913
439 Ga0157376_10066985
440 Ga0163161_10194583
441 Ga0207692_10036547
442 Ga0207642_10010084
443 Ga0207710_10060620
444 Ga0207680_10066551
445 Ga0207647_10094243
446 Ga0207699_10016428
447 Ga0207699_10065022
448 Ga0207684_10011311
449 Ga0207684_10078742
450 Ga0207684_10525530
451 Ga0207654_10093879
452 Ga0207654_10267639
453 Ga0207671_10049007
454 Ga0207693_10008489
455 Ga0207693_10061917
456 Ga0207663_10390331
457 Ga0207660_10304657
458 Ga0207652_10315709
459 Ga0207646_10008628
460 Ga0207646_10011847
461 Ga0207646_10078163
462 Ga0207646_10164045
463 Ga0207687_10598302
464 Ga0207700_10479336
465 Ga0207664_10042035
466 Ga0207644_10066765
467 Ga0207690_10176359
468 Ga0207706_10292376
469 Ga0207686_10054359
470 Ga0207709_10001948
471 Ga0207670_10076389
472 Ga0207669_10001022
473 Ga0207704_10000430
474 Ga0207665_10140414
475 Ga0207665_10257495
476 Ga0207691_10025065
477 Ga0207689_10078039
478 Ga0207712_10007386
479 Ga0207640_10196458
480 Ga0207640_10301900
481 Ga0207677_10775376
482 Ga0207703_10109697
483 Ga0207639_10078833
484 Ga0207678_10392948
485 Ga0207708_10000352
486 Ga0207702_10053447
487 Ga0207641_10263860
488 Ga0207648_10000454
489 Ga0207675_100078193
490 Ga0207683_10021532
491 Ga0207428_10333803
492 Ga0268266_10082617
493 Ga0268265_10231026
494 Ga0265337_1018565
495 Ga0265318_10044734
496 Ga0265322_10132147
497 Ga0265336_10052048
498 Ga0265338_10010390
499 Ga0265330_10026883
500 Ga0265332_10046286
501 Ga0265320_10109465
502 Ga0265325_10082195
503 Ga0265325_10181097
504 Ga0265339_10004875
505 Ga0265331_10110749
506 Ga0265327_10043846
507 Ga0265327_10085086
508 Ga0265316_10069749
509 Ga0265316_10152388
510 Ga0265313_10018867
511 Ga0265314_10037774
512 Ga0265342_10072211
513 Ga0307409_100133265
514 Ga0307416_101270894
515 Ga0373928_0027950
516 Ga0373932_0085582
517 Ga0373942_0038274
518 Ga0373962_0026229
519 Ga0373931_0076962
520 Ga0373925_0108832
521 Ga0395899_0005507
522 Ga0395899_0013850
523 Ga0395900_0009982
524 Ga0395900_0020346
525 Ga0395900_0021716
526 Ga0395900_0067621
527 Ga0395900_0143138
528 Ga0395900_0350301
529 Ga0395900_0712644
530 Ga0395900_1124237
531 Ga0395898_0001631
532 Ga0395898_0010273
533 Ga0395898_0032301
534 Ga0395898_0032496
535 Ga0395898_0128148
536 Ga0395898_0478671
537 Ga0395898_0859393
538 Ga0395905_0009450
539 Ga0395905_0010819
540 Ga0395905_0050982
541 Ga0395905_0052814
542 Ga0395905_0134619
543 Ga0395901_0000370
544 Ga0395901_0020386
545 Ga0395901_0028123
546 Ga0395901_0032491
547 Ga0395901_0034393
548 Ga0395901_0348044
549 Ga0436363_0331802
550 Ga0439453_0000543
551 Ga0439451_009684
552 Ga0439454_002129
553 Ga0466972_0109918
554 Ga0466965_0310169
555 Ga0466961_0046163
556 Ga0466963_0001427
557 Ga0466963_0002884
558 Ga0466964_0000233
559 Ga0466971_0267939
560 Ga0466968_0002266
561 Ga0466968_0024396
562 Ga0466968_0059952
563 Ga0466970_0029914
564 Ga0466957_0038964
565 Ga0466957_0133141
566 Ga0466960_0148824
567 Ga0466967_0059395
568 Ga0466967_0113120
569 Ga0466967_0132671
570 Ga0466967_0718066
571 Ga0495603_0011881
572 Ga0495603_0211175
573 Ga0495629_0119007
574 Ga0495629_0189459
575 Ga0495641_0048714
576 Ga0495580_0476982
577 Ga0495582_0099037
578 Ga0495582_0324750
579 Ga0495605_0042261
580 Ga0495639_0200498
581 Ga0495662_0071454
582 Ga0495585_0236589
583 Ga0495596_0031802
584 Ga0495607_0115761
585 Ga0495630_0306865
586 Ga0495631_0010814
587 Ga0495644_0047334
588 Ga0495663_0014503
589 Ga0495642_0097728
590 Ga0495665_0032743
591 Ga0495659_0018036
592 Ga0495588_0049460
593 Ga0495658_0082981
594 Ga0495613_0118433
595 Ga0495613_0335845
596 Ga0495670_0467591
597 Ga0495589_0059544
598 Ga0495589_0063833
599 Ga0495589_0094783
600 Ga0495581_0026455
601 Ga0495614_0268195
602 Ga0496100_0022678
603 Ga0496100_0044218
604 Ga0496101_0021654
605 Ga0496101_0107550
606 Ga0496101_0250884
607 Ga0496102_0036831
608 Ga0496102_0316792
609 Ga0496102_0689922
610 Ga0496103_0002452
611 Ga0496103_0019732
612 Ga0496103_0172597
613 Ga0496104_0109760
614 Ga0496104_0293123
615 Ga0496105_0004171
616 Ga0496105_0129158
617 Ga0496106_0003849
618 Ga0496106_0091562
619 Ga0496106_0133886
620 Ga0496106_0320646
621 Ga0496107_0091401
622 Ga0496107_0257301
623 Ga0496108_0002184
624 Ga0496108_0302269
625 Ga0496109_0006032
626 Ga0496109_0019767
627 Ga0496109_0276534
628 Ga0496110_0080639
629 Ga0496111_0053296
630 Ga0496111_0230081
631 Ga0496112_0040108
632 Ga0496112_0040149
633 Ga0496112_0624076
634 Ga0496113_0082172
635 Ga0496114_0003888
636 Ga0496114_0081498
637 Ga0496114_0475530
638 Ga0496115_0015946
639 Ga0496115_0100147
640 Ga0501069_0010254
641 Ga0501045_0290881
642 nmdc:mga05p37_127566_c1
643 nmdc:mga05p37_91702_c1
644 nmdc:mga0n895_109126_c1
645 nmdc:mga0n895_417958_c1
646 nmdc:mga0rr50_1104_c1
647 nmdc:mga0rr50_12626_c1
648 nmdc:mga08x19_19984_c1
649 nmdc:mga08x19_63446_c1
650 nmdc:mga0a205_110429_c1
651 Ga0495619_0196700
652 Ga0501084_0489130
653 Ga0466962_0035085
654 Ga0530510_0160885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

9

184

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.8167 2 180
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.7981 1 180
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.7645 2 180
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.7513 1 180
6qf5-assembly1.cif.gz_D x-ray structure of human aquaporin 2 crystallized on a silicon chip 0.4488 1 97
ID Description Score Start End Superfamily
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.813 10 171 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7992 10 171 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7559 10 171 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.711 10 171 1.10.1760.20
2b6oA00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.4226 3 91 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A7V9RAQ3-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9775 2 97 GO:0005886
GO:0008654
GO:0043772
AF-A0A6B1GKM5-F1-model_v4 Acyl-phosphate glycerol 3-phosphate acyltransferase 0.9511 1 113 GO:0005886
GO:0008654
GO:0043772
AF-A0A2M7D752-F1-model_v4 Acyl-phosphate glycerol 3-phosphate acyltransferase 0.9491 2 115 GO:0005886
GO:0008654
GO:0043772
AF-A0A5N9DPH7-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9476 8 158 GO:0005886
GO:0008654
GO:0043772
AF-A0A351X766-F1-model_v4 Acyl-phosphate glycerol 3-phosphate acyltransferase 0.9462 3 157 GO:0005886
GO:0008654
GO:0043772

Map