F408557

General Info

Members Datasets Scaffolds Average Seq Length
326 159 652 469

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_168266_c1|nmdc:mga0a205_168266_c1_512_2038
Length 508
Sequence MAEKAQRNSWKTQLMPDKKARLPINPYIFLRLASLTWVVFLASLTVNGQEITWPQFRGPDSNPVEAHARLAERWSKTENVEWSKEIPGRGWSSPIVTGGKVFVTTATTDGKSKPPQIGTEYSNEYVAELQKQGLSMEQILERVTARDIELPKEVRLHYFLYCLNLKSGKVEWQKEFHTGQPPGGRHRKNSFVSESPVTDGKFVYVYVANLGLWAFDLQGKLAWTTSLEANPIYLDFGTGSSPALAGNLLVIVNDNEKQQYIAAFDKQTGKQVWRTNRDIGGKAQPVQRSGWVTPFVWRNSLRTEIVTIGPGEAISYDLAGKELWRLSGMAATPIPMPFAYDGLLYVDGGRGKPLYAVRPGASGDISLGKDESSNAYVVWSQARAGTYLPSPVAYDGGLYVLTETGILSRFESRTGKLTYRTRIDPAAAAFTTSPWVHNGKLFCLSEEGQTFVIATGEKFQLLHVNELDDIALASPALVGERLLIRTEHRLYSIRRQKSARQRSASSTY

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
130 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
142 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
143 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
144 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
148 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
149 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
150 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
158 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 1.53
Rhizosphere 97.85
Stem 0
Stem Tuber 0
Unclassified 19.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_168266_c1 3300050515 Unclassified 2087
2 MBSR1b_contig_1547598 2162886012 Unclassified 2970
3 JGI24751J29686_10000111 3300002459 Bacteria 42772
4 JGI25406J46586_10007096 3300003203 Bacteria 5132
5 Ga0065714_10064441 3300005288 Bacteria 101256
6 Ga0065704_10130797 3300005289 Bacteria 1631
7 Ga0065712_10000007 3300005290 Bacteria 101903
8 Ga0065712_10071375 3300005290 Bacteria 5308
9 Ga0065712_10078666 3300005290 Unclassified 3315
10 Ga0065712_10085746 3300005290 Unclassified 2676
11 Ga0065715_10015366 3300005293 Bacteria 2497
12 Ga0065715_10094469 3300005293 Bacteria 4330
13 Ga0065715_10096522 3300005293 Unclassified 3865
14 Ga0065715_10100796 3300005293 Bacteria 3236
15 Ga0065707_10008772 3300005295 Bacteria 2378
16 Ga0065707_10089624 3300005295 Bacteria 4317
17 Ga0065707_10092927 3300005295 Bacteria 3697
18 Ga0065707_10100010 3300005295 Bacteria 2962
19 Ga0070690_100011689 3300005330 Bacteria 5143
20 Ga0070690_100109223 3300005330 Unclassified 1843
21 Ga0070670_100000216 3300005331 Bacteria 53372
22 Ga0070670_100100789 3300005331 Bacteria 2486
23 Ga0068869_100008896 3300005334 Bacteria 6497
24 Ga0070680_100000433 3300005336 Bacteria 28525
25 Ga0070682_100000056 3300005337 Bacteria 108991
26 Ga0068868_100048156 3300005338 Unclassified 3343
27 Ga0070689_100001408 3300005340 Bacteria 15342
28 Ga0070692_10021297 3300005345 Bacteria 3152
29 Ga0070692_10032816 3300005345 Bacteria 2613
30 Ga0070671_100021640 3300005355 Bacteria 5253
31 Ga0070674_100024292 3300005356 Bacteria 3933
32 Ga0070674_100172297 3300005356 Unclassified 1651
33 Ga0070673_100006138 3300005364 Bacteria 7788
34 Ga0070673_100117468 3300005364 Bacteria 2213
35 Ga0070688_100074390 3300005365 Bacteria 2182
36 Ga0070659_100017741 3300005366 Bacteria 5360
37 Ga0070659_100136573 3300005366 Unclassified 1994
38 Ga0070703_10001163 3300005406 Bacteria 8118
39 Ga0070705_100000014 3300005440 Bacteria 94384
40 Ga0070705_100022843 3300005440 Bacteria 3348
41 Ga0070700_100031683 3300005441 Bacteria 3171
42 Ga0070694_100010769 3300005444 Bacteria 5655
43 Ga0070694_100021341 3300005444 Bacteria 4137
44 Ga0070694_100023641 3300005444 Bacteria 3956
45 Ga0070694_100112602 3300005444 Bacteria 1940
46 Ga0070694_100162441 3300005444 Bacteria 1640
47 Ga0070708_100064701 3300005445 Bacteria 3277
48 Ga0070662_100098522 3300005457 Unclassified 2208
49 Ga0070681_10000065 3300005458 Bacteria 76633
50 Ga0070681_10000383 3300005458 Bacteria 35789
51 Ga0070681_10003871 3300005458 Bacteria 14083
52 Ga0068867_100026458 3300005459 Bacteria 4166
53 Ga0070706_100000075 3300005467 Bacteria 114725
54 Ga0070706_100000131 3300005467 Bacteria 92723
55 Ga0070707_100231867 3300005468 Bacteria 1797
56 Ga0070698_100000672 3300005471 Bacteria 36516
57 Ga0070698_100009820 3300005471 Bacteria 10229
58 Ga0070698_100040657 3300005471 Unclassified 4777
59 Ga0070699_100000009 3300005518 Bacteria 272902
60 Ga0070699_100001232 3300005518 Bacteria 23609
61 Ga0070679_100000013 3300005530 Bacteria 151602
62 Ga0070679_100062973 3300005530 Bacteria 3697
63 Ga0070697_100000508 3300005536 Bacteria 29411
64 Ga0070686_100036547 3300005544 Unclassified 3042
65 Ga0070686_100080008 3300005544 Bacteria 2161
66 Ga0070695_100017731 3300005545 Bacteria 4320
67 Ga0070695_100083863 3300005545 Bacteria 2113
68 Ga0070696_100000136 3300005546 Bacteria 39907
69 Ga0070696_100052044 3300005546 Unclassified 2848
70 Ga0070696_100157555 3300005546 Unclassified 1671
71 Ga0070693_100000687 3300005547 Bacteria 14990
72 Ga0070693_100008731 3300005547 Bacteria 5016
73 Ga0070704_100036794 3300005549 Unclassified 3338
74 Ga0070704_100048893 3300005549 Bacteria 2963
75 Ga0070704_100062191 3300005549 Bacteria 2675
76 Ga0070664_100011733 3300005564 Bacteria 7114
77 Ga0068857_100002893 3300005577 Bacteria 14130
78 Ga0068857_100047761 3300005577 Unclassified 3801
79 Ga0068857_100075759 3300005577 Bacteria 3000
80 Ga0068854_100066286 3300005578 Bacteria 2628
81 Ga0068856_100022465 3300005614 Bacteria 6133
82 Ga0070702_100004925 3300005615 Bacteria 6154
83 Ga0070702_100068253 3300005615 Bacteria 2092
84 Ga0068859_100010747 3300005617 Bacteria 9213
85 Ga0068859_100013511 3300005617 Bacteria 8188
86 Ga0068859_100017519 3300005617 Bacteria 7200
87 Ga0068859_100111504 3300005617 Bacteria 2798
88 Ga0068859_100215647 3300005617 Unclassified 2007
89 Ga0068859_100248085 3300005617 Bacteria 1870
90 Ga0068864_100026103 3300005618 Bacteria 4924
91 Ga0068864_100041513 3300005618 Bacteria 3935
92 Ga0068864_100266912 3300005618 Bacteria 1594
93 Ga0068866_10037855 3300005718 Unclassified 2372
94 Ga0068861_100002186 3300005719 Bacteria 12692
95 Ga0068861_100051189 3300005719 Bacteria 3134
96 Ga0068861_100068476 3300005719 Bacteria 2743
97 Ga0068870_10037935 3300005840 Bacteria 2486
98 Ga0068863_100044325 3300005841 Bacteria 4223
99 Ga0068863_100179141 3300005841 Bacteria 2034
100 Ga0068858_100010326 3300005842 Bacteria 8848
101 Ga0068858_100089472 3300005842 Bacteria 2865
102 Ga0068858_100275166 3300005842 Unclassified 1602
103 Ga0068860_100013462 3300005843 Bacteria 8021
104 Ga0068860_100047055 3300005843 Unclassified 4111
105 Ga0068860_100100559 3300005843 Bacteria 2759
106 Ga0068862_100030753 3300005844 Unclassified 4526
107 Ga0068862_100051830 3300005844 Bacteria 3510
108 Ga0081455_10004041 3300005937 Bacteria 16628
109 Ga0081455_10022245 3300005937 Bacteria 5930
110 Ga0081539_10003440 3300005985 Bacteria 19453
111 Ga0081539_10011099 3300005985 Bacteria 7192
112 Ga0081539_10019229 3300005985 Unclassified 4686
113 Ga0097621_100017396 3300006237 Bacteria 5458
114 Ga0097621_100027579 3300006237 Bacteria 4468
115 Ga0068871_100007971 3300006358 Bacteria 7598
116 Ga0068871_100034340 3300006358 Bacteria 4024
117 Ga0068871_100109999 3300006358 Archaea 2317
118 Ga0075428_100003651 3300006844 Bacteria 16870
119 Ga0075428_100120866 3300006844 Bacteria 2852
120 Ga0075430_100026937 3300006846 Unclassified 4889
121 Ga0075430_100035719 3300006846 Bacteria 4215
122 Ga0075430_100089364 3300006846 Bacteria 2577
123 Ga0075431_100018562 3300006847 Bacteria 7085
124 Ga0075431_100035142 3300006847 Bacteria 5161
125 Ga0075431_100065712 3300006847 Bacteria 3745
126 Ga0075431_100142739 3300006847 Bacteria 2468
127 Ga0075433_10003229 3300006852 Bacteria 12584
128 Ga0075433_10015832 3300006852 Bacteria 6200
129 Ga0075433_10032759 3300006852 Bacteria 4453
130 Ga0075433_10107678 3300006852 Bacteria 2471
131 Ga0075433_10115828 3300006852 Bacteria 2378
132 Ga0075433_10134023 3300006852 Bacteria 2201
133 Ga0075434_100006039 3300006871 Bacteria 11074
134 Ga0075434_100069072 3300006871 Bacteria 3522
135 Ga0075429_100196280 3300006880 Bacteria 1768
136 Ga0068865_100130426 3300006881 Unclassified 1882
137 Ga0068865_100144229 3300006881 Bacteria 1799
138 Ga0097620_100010747 3300006931 Bacteria 9213
139 Ga0097620_100013511 3300006931 Bacteria 8188
140 Ga0097620_100017519 3300006931 Bacteria 7200
141 Ga0097620_100111507 3300006931 Bacteria 2798
142 Ga0097620_100215641 3300006931 Unclassified 2007
143 Ga0097620_100248093 3300006931 Bacteria 1870
144 Ga0075435_100059013 3300007076 Bacteria 3109
145 Ga0111539_10008770 3300009094 Bacteria 12822
146 Ga0111539_10029409 3300009094 Bacteria 6691
147 Ga0111539_10072467 3300009094 Bacteria 4062
148 Ga0111539_10078071 3300009094 Bacteria 3896
149 Ga0111539_10082339 3300009094 Unclassified 3785
150 Ga0111539_10101286 3300009094 Bacteria 3382
151 Ga0111539_10134969 3300009094 Bacteria 2890
152 Ga0111539_10290894 3300009094 Bacteria 1901
153 Ga0105245_10041490 3300009098 Unclassified 4102
154 Ga0105247_10003435 3300009101 Bacteria 10333
155 Ga0105247_10062306 3300009101 Bacteria 2313
156 Ga0114129_10008114 3300009147 Bacteria 14964
157 Ga0114129_10031818 3300009147 Bacteria 7458
158 Ga0114129_10087104 3300009147 Bacteria 4331
159 Ga0105241_10031893 3300009174 Bacteria 3946
160 Ga0105242_10040433 3300009176 Archaea 3758
161 Ga0105242_10142555 3300009176 Bacteria 2081
162 Ga0105248_10000697 3300009177 Bacteria 37919
163 Ga0105248_10005968 3300009177 Bacteria 13379
164 Ga0105248_10052979 3300009177 Unclassified 4553
165 Ga0105248_10060414 3300009177 Unclassified 4255
166 Ga0105248_10156727 3300009177 Bacteria 2570
167 Ga0105248_10348307 3300009177 Unclassified 1668
168 Ga0105237_10000199 3300009545 Bacteria 85277
169 Ga0105237_10115203 3300009545 Bacteria 2681
170 Ga0105238_10005932 3300009551 Bacteria 12107
171 Ga0105238_10041014 3300009551 Bacteria 4689
172 Ga0105249_10062152 3300009553 Bacteria 3428
173 Ga0105249_10157398 3300009553 Bacteria 2192
174 Ga0105249_10290208 3300009553 Unclassified 1637
175 Ga0105239_10038455 3300010375 Bacteria 5243
176 Ga0105239_10048333 3300010375 Unclassified 4665
177 Ga0105246_10036651 3300011119 Bacteria 3287
178 Ga0105246_10074003 3300011119 Bacteria 2407
179 Ga0157373_10036009 3300013100 Bacteria 3553
180 Ga0157373_10127165 3300013100 Bacteria 1792
181 Ga0157378_10003434 3300013297 Bacteria 14057
182 Ga0157378_10038882 3300013297 Bacteria 4218
183 Ga0157378_10040416 3300013297 Unclassified 4136
184 Ga0157378_10068260 3300013297 Bacteria 3188
185 Ga0157378_10179586 3300013297 Bacteria 1990
186 Ga0163162_10111470 3300013306 Unclassified 2833
187 Ga0163162_10180946 3300013306 Bacteria 2234
188 Ga0157372_10042048 3300013307 Bacteria 5053
189 Ga0157375_10280935 3300013308 Unclassified 1828
190 Ga0163163_10000250 3300014325 Bacteria 54990
191 Ga0163163_10072980 3300014325 Unclassified 3422
192 Ga0163163_10173988 3300014325 Bacteria 2199
193 Ga0163163_10215226 3300014325 Bacteria 1970
194 Ga0157380_10002963 3300014326 Bacteria 11554
195 Ga0157380_10004414 3300014326 Bacteria 9749
196 Ga0157380_10054564 3300014326 Bacteria 3171
197 Ga0157380_10112149 3300014326 Bacteria 2294
198 Ga0157377_10017652 3300014745 Unclassified 3694
199 Ga0157377_10060308 3300014745 Bacteria 2165
200 Ga0157377_10061239 3300014745 Bacteria 2150
201 Ga0157377_10062086 3300014745 Unclassified 2137
202 Ga0157376_10060251 3300014969 Bacteria 3187
203 Ga0157376_10090311 3300014969 Bacteria 2651
204 Ga0207653_10000070 3300025885 Bacteria 76652
205 Ga0207710_10000432 3300025900 Bacteria 27447
206 Ga0207647_10012283 3300025904 Bacteria 5966
207 Ga0207643_10003009 3300025908 Bacteria 9088
208 Ga0207643_10038397 3300025908 Unclassified 2689
209 Ga0207684_10000093 3300025910 Bacteria 166136
210 Ga0207684_10000102 3300025910 Bacteria 162120
211 Ga0207707_10000004 3300025912 Bacteria 391281
212 Ga0207707_10011887 3300025912 Bacteria 7574
213 Ga0207671_10001534 3300025914 Bacteria 26491
214 Ga0207671_10177809 3300025914 Bacteria 1655
215 Ga0207660_10000663 3300025917 Bacteria 23050
216 Ga0207662_10021238 3300025918 Unclassified 3709
217 Ga0207662_10039860 3300025918 Unclassified 2758
218 Ga0207652_10000122 3300025921 Bacteria 85075
219 Ga0207694_10020334 3300025924 Bacteria 5021
220 Ga0207650_10000269 3300025925 Bacteria 54998
221 Ga0207650_10032954 3300025925 Bacteria 3750
222 Ga0207650_10126969 3300025925 Bacteria 1992
223 Ga0207687_10042191 3300025927 Unclassified 3137
224 Ga0207644_10013694 3300025931 Bacteria 5414
225 Ga0207690_10025570 3300025932 Bacteria 3709
226 Ga0207690_10094390 3300025932 Bacteria 2122
227 Ga0207670_10001532 3300025936 Bacteria 12158
228 Ga0207704_10007506 3300025938 Bacteria 5156
229 Ga0207711_10020067 3300025941 Bacteria 5570
230 Ga0207711_10022311 3300025941 Bacteria 5293
231 Ga0207689_10014985 3300025942 Bacteria 6575
232 Ga0207689_10018302 3300025942 Bacteria 5913
233 Ga0207689_10078962 3300025942 Bacteria 2705
234 Ga0207689_10080278 3300025942 Unclassified 2681
235 Ga0207651_10106358 3300025960 Unclassified 2095
236 Ga0207651_10108471 3300025960 Bacteria 2078
237 Ga0207712_10007283 3300025961 Bacteria 6977
238 Ga0207712_10014339 3300025961 Bacteria 5097
239 Ga0207677_10041297 3300026023 Bacteria 3049
240 Ga0207703_10045364 3300026035 Unclassified 3536
241 Ga0207639_10030962 3300026041 Bacteria 3930
242 Ga0207708_10000031 3300026075 Bacteria 155478
243 Ga0207708_10002245 3300026075 Bacteria 14228
244 Ga0207708_10004021 3300026075 Bacteria 10817
245 Ga0207708_10174197 3300026075 Unclassified 1705
246 Ga0207641_10015478 3300026088 Bacteria 6250
247 Ga0207648_10074500 3300026089 Bacteria 2958
248 Ga0207648_10204156 3300026089 Unclassified 1754
249 Ga0207676_10014870 3300026095 Bacteria 5606
250 Ga0207676_10091607 3300026095 Bacteria 2498
251 Ga0207674_10001135 3300026116 Bacteria 34563
252 Ga0207674_10072071 3300026116 Bacteria 3471
253 Ga0207674_10098522 3300026116 Bacteria 2907
254 Ga0207674_10135913 3300026116 Bacteria 2420
255 Ga0207674_10229477 3300026116 Unclassified 1804
256 Ga0207675_100002751 3300026118 Bacteria 17290
257 Ga0207675_100054096 3300026118 Bacteria 3745
258 Ga0207675_100084127 3300026118 Bacteria 2985
259 Ga0207675_100236723 3300026118 Unclassified 1763
260 Ga0207428_10011974 3300027907 Bacteria 7635
261 Ga0207428_10036917 3300027907 Bacteria 3980
262 Ga0207428_10044823 3300027907 Unclassified 3566
263 Ga0268265_10015130 3300028380 Archaea 5273
264 Ga0268265_10047105 3300028380 Bacteria 3228
265 Ga0268265_10091291 3300028380 Bacteria 2435
266 Ga0268264_10016521 3300028381 Bacteria 6042
267 Ga0268264_10028587 3300028381 Unclassified 4561
268 Ga0268264_10066395 3300028381 Bacteria 3042
269 Ga0268264_10116390 3300028381 Unclassified 2349
270 Ga0268264_10238477 3300028381 Unclassified 1683
271 Ga0307413_10087193 3300031824 Bacteria 2021
272 Ga0307416_100261403 3300032002 Bacteria 1692
273 Ga0307414_10095203 3300032004 Bacteria 2225
274 Ga0307415_100187830 3300032126 Bacteria 1628
275 Ga0373955_0054850 3300035172 Bacteria 2181
276 Ga0395900_0082708 3300037418 Unclassified 3299
277 Ga0242422_00454 3300038699 Bacteria 2581
278 Ga0439458_0001887 3300042157 Bacteria 5190
279 Ga0451577_0060082 3300042876 Bacteria 3389
280 Ga0453684_0127620 3300044712 Bacteria 3058
281 Ga0495610_0032925 3300046512 Bacteria 2686
282 Ga0495663_0000089 3300046525 Bacteria 40248
283 Ga0495598_0000099 3300046537 Bacteria 13864
284 Ga0495621_0000070 3300046539 Bacteria 20267
285 Ga0495672_0029453 3300047320 Bacteria 3458
286 Ga0496104_0106744 3300048907 Bacteria 2684
287 Ga0496109_0000079 3300048912 Bacteria 102182
288 Ga0496109_0000325 3300048912 Bacteria 44562
289 Ga0496112_0254201 3300048915 Unclassified 1708
290 Ga0496112_0266534 3300048915 Bacteria 1662
291 Ga0501292_001314 3300049515 Unclassified 3057
292 Ga0501296_000277 3300049519 Bacteria 5280
293 Ga0501298_002631 3300049521 Bacteria 2733
294 Ga0501298_007394 3300049521 Bacteria 1820
295 Ga0501299_000575 3300049522 Unclassified 4392
296 Ga0501038_0001386 3300049574 Bacteria 22156
297 Ga0501076_0020262 3300049592 Bacteria 5089
298 Ga0501216_006654 3300049660 Bacteria 1779
299 Ga0501217_008339 3300049661 Bacteria 2236
300 Ga0501217_014522 3300049661 Bacteria 1781
301 Ga0501235_001420 3300049669 Bacteria 5109
302 Ga0501235_012753 3300049669 Bacteria 1850
303 Ga0501283_001101 3300049779 Unclassified 3564
304 Ga0501045_0032901 3300049824 Bacteria 3759
305 nmdc:mga05p37_168243_c1 3300050507 Bacteria 2674
306 nmdc:mga05p37_54210_c1 3300050507 Unclassified 4933
307 nmdc:mga09592_162338_c1 3300050508 Unclassified 1930
308 nmdc:mga09592_187131_c1 3300050508 Bacteria 1792
309 nmdc:mga0qj67_210650_c1 3300050509 Unclassified 1579
310 nmdc:mga0qj67_22981_c1 3300050509 Unclassified 4791
311 nmdc:mga0qj67_28967_c1 3300050509 Bacteria 4299
312 nmdc:mga08y16_103520_c1 3300050511 Bacteria 2964
313 nmdc:mga08y16_36054_c1 3300050511 Bacteria 5194
314 nmdc:mga08y16_47553_c1 3300050511 Bacteria 4491
315 nmdc:mga08y16_50998_c1 3300050511 Bacteria 4329
316 nmdc:mga08y16_51581_c1 3300050511 Bacteria 4304
317 nmdc:mga08y16_80419_c1 3300050511 Bacteria 3398
318 nmdc:mga0n895_22792_c1 3300050512 Bacteria 5875
319 nmdc:mga0n895_8528_c1 3300050512 Bacteria 8881
320 nmdc:mga0a205_140929_c1 3300050515 Unclassified 2311
321 nmdc:mga0a205_62188_c1 3300050515 Bacteria 3607
322 nmdc:mga0a205_8977_c1 3300050515 Bacteria 9112
323 Ga0500641_0017381 3300053096 Bacteria 2689
324 Ga0500555_019365 3300053103 Bacteria 1960
325 Ga0501084_0051928 3300054114 Bacteria 3431
326 Ga0501084_0128926 3300054114 Unclassified 2129
327 nmdc:mga0a205_168266_c1
328 MBSR1b_contig_1547598
329 JGI24751J29686_10000111
330 JGI25406J46586_10007096
331 Ga0065714_10064441
332 Ga0065704_10130797
333 Ga0065712_10000007
334 Ga0065712_10071375
335 Ga0065712_10078666
336 Ga0065712_10085746
337 Ga0065715_10015366
338 Ga0065715_10094469
339 Ga0065715_10096522
340 Ga0065715_10100796
341 Ga0065707_10008772
342 Ga0065707_10089624
343 Ga0065707_10092927
344 Ga0065707_10100010
345 Ga0070690_100011689
346 Ga0070690_100109223
347 Ga0070670_100000216
348 Ga0070670_100100789
349 Ga0068869_100008896
350 Ga0070680_100000433
351 Ga0070682_100000056
352 Ga0068868_100048156
353 Ga0070689_100001408
354 Ga0070692_10021297
355 Ga0070692_10032816
356 Ga0070671_100021640
357 Ga0070674_100024292
358 Ga0070674_100172297
359 Ga0070673_100006138
360 Ga0070673_100117468
361 Ga0070688_100074390
362 Ga0070659_100017741
363 Ga0070659_100136573
364 Ga0070703_10001163
365 Ga0070705_100000014
366 Ga0070705_100022843
367 Ga0070700_100031683
368 Ga0070694_100010769
369 Ga0070694_100021341
370 Ga0070694_100023641
371 Ga0070694_100112602
372 Ga0070694_100162441
373 Ga0070708_100064701
374 Ga0070662_100098522
375 Ga0070681_10000065
376 Ga0070681_10000383
377 Ga0070681_10003871
378 Ga0068867_100026458
379 Ga0070706_100000075
380 Ga0070706_100000131
381 Ga0070707_100231867
382 Ga0070698_100000672
383 Ga0070698_100009820
384 Ga0070698_100040657
385 Ga0070699_100000009
386 Ga0070699_100001232
387 Ga0070679_100000013
388 Ga0070679_100062973
389 Ga0070697_100000508
390 Ga0070686_100036547
391 Ga0070686_100080008
392 Ga0070695_100017731
393 Ga0070695_100083863
394 Ga0070696_100000136
395 Ga0070696_100052044
396 Ga0070696_100157555
397 Ga0070693_100000687
398 Ga0070693_100008731
399 Ga0070704_100036794
400 Ga0070704_100048893
401 Ga0070704_100062191
402 Ga0070664_100011733
403 Ga0068857_100002893
404 Ga0068857_100047761
405 Ga0068857_100075759
406 Ga0068854_100066286
407 Ga0068856_100022465
408 Ga0070702_100004925
409 Ga0070702_100068253
410 Ga0068859_100010747
411 Ga0068859_100013511
412 Ga0068859_100017519
413 Ga0068859_100111504
414 Ga0068859_100215647
415 Ga0068859_100248085
416 Ga0068864_100026103
417 Ga0068864_100041513
418 Ga0068864_100266912
419 Ga0068866_10037855
420 Ga0068861_100002186
421 Ga0068861_100051189
422 Ga0068861_100068476
423 Ga0068870_10037935
424 Ga0068863_100044325
425 Ga0068863_100179141
426 Ga0068858_100010326
427 Ga0068858_100089472
428 Ga0068858_100275166
429 Ga0068860_100013462
430 Ga0068860_100047055
431 Ga0068860_100100559
432 Ga0068862_100030753
433 Ga0068862_100051830
434 Ga0081455_10004041
435 Ga0081455_10022245
436 Ga0081539_10003440
437 Ga0081539_10011099
438 Ga0081539_10019229
439 Ga0097621_100017396
440 Ga0097621_100027579
441 Ga0068871_100007971
442 Ga0068871_100034340
443 Ga0068871_100109999
444 Ga0075428_100003651
445 Ga0075428_100120866
446 Ga0075430_100026937
447 Ga0075430_100035719
448 Ga0075430_100089364
449 Ga0075431_100018562
450 Ga0075431_100035142
451 Ga0075431_100065712
452 Ga0075431_100142739
453 Ga0075433_10003229
454 Ga0075433_10015832
455 Ga0075433_10032759
456 Ga0075433_10107678
457 Ga0075433_10115828
458 Ga0075433_10134023
459 Ga0075434_100006039
460 Ga0075434_100069072
461 Ga0075429_100196280
462 Ga0068865_100130426
463 Ga0068865_100144229
464 Ga0097620_100010747
465 Ga0097620_100013511
466 Ga0097620_100017519
467 Ga0097620_100111507
468 Ga0097620_100215641
469 Ga0097620_100248093
470 Ga0075435_100059013
471 Ga0111539_10008770
472 Ga0111539_10029409
473 Ga0111539_10072467
474 Ga0111539_10078071
475 Ga0111539_10082339
476 Ga0111539_10101286
477 Ga0111539_10134969
478 Ga0111539_10290894
479 Ga0105245_10041490
480 Ga0105247_10003435
481 Ga0105247_10062306
482 Ga0114129_10008114
483 Ga0114129_10031818
484 Ga0114129_10087104
485 Ga0105241_10031893
486 Ga0105242_10040433
487 Ga0105242_10142555
488 Ga0105248_10000697
489 Ga0105248_10005968
490 Ga0105248_10052979
491 Ga0105248_10060414
492 Ga0105248_10156727
493 Ga0105248_10348307
494 Ga0105237_10000199
495 Ga0105237_10115203
496 Ga0105238_10005932
497 Ga0105238_10041014
498 Ga0105249_10062152
499 Ga0105249_10157398
500 Ga0105249_10290208
501 Ga0105239_10038455
502 Ga0105239_10048333
503 Ga0105246_10036651
504 Ga0105246_10074003
505 Ga0157373_10036009
506 Ga0157373_10127165
507 Ga0157378_10003434
508 Ga0157378_10038882
509 Ga0157378_10040416
510 Ga0157378_10068260
511 Ga0157378_10179586
512 Ga0163162_10111470
513 Ga0163162_10180946
514 Ga0157372_10042048
515 Ga0157375_10280935
516 Ga0163163_10000250
517 Ga0163163_10072980
518 Ga0163163_10173988
519 Ga0163163_10215226
520 Ga0157380_10002963
521 Ga0157380_10004414
522 Ga0157380_10054564
523 Ga0157380_10112149
524 Ga0157377_10017652
525 Ga0157377_10060308
526 Ga0157377_10061239
527 Ga0157377_10062086
528 Ga0157376_10060251
529 Ga0157376_10090311
530 Ga0207653_10000070
531 Ga0207710_10000432
532 Ga0207647_10012283
533 Ga0207643_10003009
534 Ga0207643_10038397
535 Ga0207684_10000093
536 Ga0207684_10000102
537 Ga0207707_10000004
538 Ga0207707_10011887
539 Ga0207671_10001534
540 Ga0207671_10177809
541 Ga0207660_10000663
542 Ga0207662_10021238
543 Ga0207662_10039860
544 Ga0207652_10000122
545 Ga0207694_10020334
546 Ga0207650_10000269
547 Ga0207650_10032954
548 Ga0207650_10126969
549 Ga0207687_10042191
550 Ga0207644_10013694
551 Ga0207690_10025570
552 Ga0207690_10094390
553 Ga0207670_10001532
554 Ga0207704_10007506
555 Ga0207711_10020067
556 Ga0207711_10022311
557 Ga0207689_10014985
558 Ga0207689_10018302
559 Ga0207689_10078962
560 Ga0207689_10080278
561 Ga0207651_10106358
562 Ga0207651_10108471
563 Ga0207712_10007283
564 Ga0207712_10014339
565 Ga0207677_10041297
566 Ga0207703_10045364
567 Ga0207639_10030962
568 Ga0207708_10000031
569 Ga0207708_10002245
570 Ga0207708_10004021
571 Ga0207708_10174197
572 Ga0207641_10015478
573 Ga0207648_10074500
574 Ga0207648_10204156
575 Ga0207676_10014870
576 Ga0207676_10091607
577 Ga0207674_10001135
578 Ga0207674_10072071
579 Ga0207674_10098522
580 Ga0207674_10135913
581 Ga0207674_10229477
582 Ga0207675_100002751
583 Ga0207675_100054096
584 Ga0207675_100084127
585 Ga0207675_100236723
586 Ga0207428_10011974
587 Ga0207428_10036917
588 Ga0207428_10044823
589 Ga0268265_10015130
590 Ga0268265_10047105
591 Ga0268265_10091291
592 Ga0268264_10016521
593 Ga0268264_10028587
594 Ga0268264_10066395
595 Ga0268264_10116390
596 Ga0268264_10238477
597 Ga0307413_10087193
598 Ga0307416_100261403
599 Ga0307414_10095203
600 Ga0307415_100187830
601 Ga0373955_0054850
602 Ga0395900_0082708
603 Ga0242422_00454
604 Ga0439458_0001887
605 Ga0451577_0060082
606 Ga0453684_0127620
607 Ga0495610_0032925
608 Ga0495663_0000089
609 Ga0495598_0000099
610 Ga0495621_0000070
611 Ga0495672_0029453
612 Ga0496104_0106744
613 Ga0496109_0000079
614 Ga0496109_0000325
615 Ga0496112_0254201
616 Ga0496112_0266534
617 Ga0501292_001314
618 Ga0501296_000277
619 Ga0501298_002631
620 Ga0501298_007394
621 Ga0501299_000575
622 Ga0501038_0001386
623 Ga0501076_0020262
624 Ga0501216_006654
625 Ga0501217_008339
626 Ga0501217_014522
627 Ga0501235_001420
628 Ga0501235_012753
629 Ga0501283_001101
630 Ga0501045_0032901
631 nmdc:mga05p37_168243_c1
632 nmdc:mga05p37_54210_c1
633 nmdc:mga09592_162338_c1
634 nmdc:mga09592_187131_c1
635 nmdc:mga0qj67_210650_c1
636 nmdc:mga0qj67_22981_c1
637 nmdc:mga0qj67_28967_c1
638 nmdc:mga08y16_103520_c1
639 nmdc:mga08y16_36054_c1
640 nmdc:mga08y16_47553_c1
641 nmdc:mga08y16_50998_c1
642 nmdc:mga08y16_51581_c1
643 nmdc:mga08y16_80419_c1
644 nmdc:mga0n895_22792_c1
645 nmdc:mga0n895_8528_c1
646 nmdc:mga0a205_140929_c1
647 nmdc:mga0a205_62188_c1
648 nmdc:mga0a205_8977_c1
649 Ga0500641_0017381
650 Ga0500555_019365
651 Ga0501084_0051928
652 Ga0501084_0128926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13570

PQQ_3

PQQ-like domain

79

111

0.91

PF13360

PQQ_2

PQQ-like domain

257

504

0.71

PF13360

PQQ_2

PQQ-like domain

159

357

0.5

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yms-assembly1.cif.gz_A structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.844 395 528
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8393 259 339
6tjg-assembly1.cif.gz_A crystal structure of the computationally designed cake8 protein 0.8167 143 554
2yms-assembly1.cif.gz_A structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8124 395 528
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.808 259 339
ID Description Score Start End Superfamily
af_Q60259_9_76_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8608 453 524 2.40.10.480
2ymsA00 Mainly Beta;Beta Barrel;Lipocalin; 0.844 395 528 2.40.128.630
2ymsB00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8393 259 339 2.40.10.480
af_Q60259_9_76_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8386 453 524 2.40.10.480
af_Q5RG49_936_1023_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8376 222 309 2.40.128.630
ID Description Score Start End GO Terms
AF-A0A3D1IH43-F1-model_v4 Serine/threonine protein kinase 0.9705 351 555 GO:0004674
AF-A0A2V8UPT5-F1-model_v4 Serine/threonine protein kinase 0.9663 260 557
AF-A0A3E0NM88-F1-model_v4 Serine/threonine protein kinase 0.9655 153 556
AF-A0A2D6CVM7-F1-model_v4 Pyrrolo-quinoline quinone 0.9648 412 555
AF-A0A3A0BV46-F1-model_v4 Uncharacterized protein 0.9632 395 557

Map