F408321

General Info

Members Datasets Scaffolds Average Seq Length
326 207 326 130

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10644205|Ga0157377_106442051
Length 151
Sequence MTAGEEEDLFSTGESWNASEEVDAVLLDTHVVHWWSAEPKRVSAPARKILEEADELVVAAISWYELAWLARHDRIVVNVPIRSWLQGLAEQLRTIGVTPAIADTAAALPSSFPGDPADRLIYATAIEHGFGLVTKDRVIRDHDRPRSLTIW

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
79 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
112 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
115 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
116 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
117 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
118 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
119 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
120 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
121 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 1.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 5.83
Rhizosphere 92.02
Stem 0
Stem Tuber 0
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000010 3300001977 Bacteria 18578
2 JGI25407J50210_10006500 3300003373 Bacteria 2912
3 JGI25407J50210_10021998 3300003373 Bacteria 1658
4 JGI25407J50210_10101948 3300003373 Unclassified 709
5 Ga0070658_10007065 3300005327 Bacteria 9060
6 Ga0070683_100057328 3300005329 Bacteria 3619
7 Ga0070690_100174241 3300005330 Bacteria 1482
8 Ga0070680_100130738 3300005336 Bacteria 2100
9 Ga0070682_100657284 3300005337 Bacteria 835
10 Ga0070682_100964750 3300005337 Unclassified 705
11 Ga0068868_100001165 3300005338 Bacteria 18004
12 Ga0070692_10214095 3300005345 Bacteria 1135
13 Ga0070674_100000002 3300005356 Bacteria 271088
14 Ga0070674_100000241 3300005356 Bacteria 27097
15 Ga0070673_100545966 3300005364 Bacteria 1052
16 Ga0070711_100031016 3300005439 Bacteria 3545
17 Ga0070711_100611969 3300005439 Bacteria 910
18 Ga0070681_10035936 3300005458 Bacteria 4977
19 Ga0070706_100513782 3300005467 Unclassified 1114
20 Ga0070706_100525016 3300005467 Bacteria 1101
21 Ga0070679_100324431 3300005530 Bacteria 1489
22 Ga0070679_100412874 3300005530 Unclassified 1295
23 Ga0070684_100015411 3300005535 Bacteria 6226
24 Ga0070697_102002612 3300005536 Bacteria 518
25 Ga0070693_100436958 3300005547 Unclassified 915
26 Ga0070704_100141133 3300005549 Unclassified 1881
27 Ga0070704_102004289 3300005549 Unclassified 537
28 Ga0068855_100423349 3300005563 Bacteria 1456
29 Ga0068855_100959322 3300005563 Bacteria 900
30 Ga0068856_100041764 3300005614 Bacteria 4509
31 Ga0068852_100000104 3300005616 Bacteria 56243
32 Ga0068866_10000575 3300005718 Bacteria 16721
33 Ga0068866_10000600 3300005718 Bacteria 16403
34 Ga0068861_100095638 3300005719 Bacteria 2353
35 Ga0068851_10007094 3300005834 Bacteria 5132
36 Ga0068870_10248601 3300005840 Unclassified 1101
37 Ga0068863_100009454 3300005841 Bacteria 9511
38 Ga0068860_100003597 3300005843 Bacteria 15930
39 Ga0081455_11039556 3300005937 Bacteria 506
40 Ga0081538_10005519 3300005981 Bacteria 11359
41 Ga0081538_10010996 3300005981 Bacteria 7368
42 Ga0081538_10011153 3300005981 Bacteria 7300
43 Ga0081538_10020661 3300005981 Bacteria 4836
44 Ga0081538_10058734 3300005981 Bacteria 2228
45 Ga0081540_1015551 3300005983 Bacteria 4813
46 Ga0081539_10018669 3300005985 Bacteria 4797
47 Ga0081539_10146240 3300005985 Bacteria 1142
48 Ga0070717_10581756 3300006028 Unclassified 1015
49 Ga0070715_10000008 3300006163 Bacteria 189899
50 Ga0075431_100583687 3300006847 Bacteria 1103
51 Ga0111539_10413010 3300009094 Bacteria 1572
52 Ga0111539_11741238 3300009094 Bacteria 723
53 Ga0105245_10000117 3300009098 Bacteria 76863
54 Ga0105242_10035255 3300009176 Bacteria 4012
55 Ga0105248_10000037 3300009177 Bacteria 180751
56 Ga0105237_10002855 3300009545 Bacteria 21010
57 Ga0157370_10083061 3300013104 Bacteria 3012
58 Ga0157369_10000051 3300013105 Bacteria 165672
59 Ga0157374_10003614 3300013296 Bacteria 13023
60 Ga0163162_10193867 3300013306 Bacteria 2160
61 Ga0157375_10352197 3300013308 Bacteria 1638
62 Ga0157375_10725639 3300013308 Unclassified 1146
63 Ga0163163_10148946 3300014325 Bacteria 2385
64 Ga0157380_10252213 3300014326 Bacteria 1598
65 Ga0157380_10356805 3300014326 Bacteria 1370
66 Ga0182008_10229501 3300014497 Bacteria 952
67 Ga0157377_10644205 3300014745 Bacteria 762
68 Ga0197907_10108656 3300020069 Unclassified 1783
69 Ga0206354_10857453 3300020081 Unclassified 1890
70 Ga0206353_11593059 3300020082 Bacteria 1744
71 Ga0154015_1134837 3300020610 Bacteria 860
72 Ga0207642_10000108 3300025899 Bacteria 22373
73 Ga0207642_10000227 3300025899 Bacteria 16602
74 Ga0207685_10000012 3300025905 Bacteria 189900
75 Ga0207705_10861420 3300025909 Bacteria 702
76 Ga0207684_10593520 3300025910 Bacteria 946
77 Ga0207707_10206821 3300025912 Bacteria 1710
78 Ga0207707_10657068 3300025912 Bacteria 883
79 Ga0207671_10000406 3300025914 Bacteria 60268
80 Ga0207663_10006102 3300025916 Bacteria 6133
81 Ga0207663_10372457 3300025916 Bacteria 1086
82 Ga0207660_10077080 3300025917 Unclassified 2439
83 Ga0207652_10226323 3300025921 Unclassified 1686
84 Ga0207652_11283797 3300025921 Unclassified 635
85 Ga0207646_10405546 3300025922 Bacteria 1231
86 Ga0207687_10000070 3300025927 Bacteria 77432
87 Ga0207686_10075562 3300025934 Bacteria 2181
88 Ga0207669_10000003 3300025937 Bacteria 252239
89 Ga0207669_10000014 3300025937 Bacteria 129145
90 Ga0207711_10000011 3300025941 Bacteria 518817
91 Ga0207667_10366051 3300025949 Bacteria 1470
92 Ga0207667_10968609 3300025949 Bacteria 839
93 Ga0207651_10446376 3300025960 Bacteria 1109
94 Ga0207677_10005215 3300026023 Bacteria 7032
95 Ga0207708_10014365 3300026075 Bacteria 5925
96 Ga0207702_10000202 3300026078 Bacteria 70333
97 Ga0207702_10028659 3300026078 Bacteria 4629
98 Ga0207641_10003078 3300026088 Bacteria 15029
99 Ga0207675_100132209 3300026118 Bacteria 2366
100 Ga0207683_10179935 3300026121 Bacteria 1917
101 Ga0207698_10000015 3300026142 Bacteria 207368
102 Ga0268264_10002647 3300028381 Bacteria 15644
103 Ga0265326_10025820 3300028558 Unclassified 1675
104 Ga0265319_1000020 3300028563 Bacteria 153921
105 Ga0265319_1059245 3300028563 Unclassified 1245
106 Ga0265334_10022069 3300028573 Unclassified 2598
107 Ga0265338_10000222 3300028800 Bacteria 105765
108 Ga0265338_10093657 3300028800 Bacteria 2474
109 Ga0265324_10046705 3300029957 Unclassified 1490
110 Ga0265320_10136331 3300031240 Unclassified 1113
111 Ga0265325_10017278 3300031241 Bacteria 4011
112 Ga0265340_10123965 3300031247 Unclassified 1187
113 Ga0265339_10123020 3300031249 Unclassified 1332
114 Ga0265331_10318526 3300031250 Unclassified 696
115 Ga0265331_10432867 3300031250 Bacteria 591
116 Ga0265316_10162263 3300031344 Unclassified 1670
117 Ga0265316_10948241 3300031344 Unclassified 600
118 Ga0307513_10319239 3300031456 Bacteria 1312
119 Ga0307408_100016716 3300031548 Bacteria 4904
120 Ga0307408_100184107 3300031548 Bacteria 1677
121 Ga0307408_100206295 3300031548 Bacteria 1594
122 Ga0265314_10138501 3300031711 Unclassified 1508
123 Ga0265342_10170982 3300031712 Unclassified 1195
124 Ga0307405_10009750 3300031731 Bacteria 4938
125 Ga0307405_10038705 3300031731 Bacteria 2877
126 Ga0307405_10066503 3300031731 Bacteria 2298
127 Ga0307413_10003204 3300031824 Bacteria 6847
128 Ga0307413_10006024 3300031824 Bacteria 5490
129 Ga0307413_10851114 3300031824 Bacteria 770
130 Ga0307410_10000513 3300031852 Bacteria 15726
131 Ga0307410_10011358 3300031852 Bacteria 5090
132 Ga0307410_10015456 3300031852 Bacteria 4528
133 Ga0307410_11937798 3300031852 Unclassified 525
134 Ga0307406_10000219 3300031901 Bacteria 34661
135 Ga0307406_10003563 3300031901 Bacteria 8488
136 Ga0307406_10014150 3300031901 Bacteria 4584
137 Ga0307407_10002623 3300031903 Bacteria 7108
138 Ga0307407_10007277 3300031903 Bacteria 5003
139 Ga0307407_10023279 3300031903 Bacteria 3230
140 Ga0307412_10209767 3300031911 Unclassified 1485
141 Ga0307412_10538742 3300031911 Bacteria 978
142 Ga0307412_11689209 3300031911 Unclassified 580
143 Ga0307409_100000594 3300031995 Bacteria 15787
144 Ga0307409_100002712 3300031995 Bacteria 9346
145 Ga0307409_100027542 3300031995 Bacteria 4029
146 Ga0307409_100203611 3300031995 Bacteria 1773
147 Ga0307409_102741323 3300031995 Unclassified 521
148 Ga0307416_100000297 3300032002 Bacteria 25889
149 Ga0307416_100045411 3300032002 Bacteria 3459
150 Ga0307414_10003969 3300032004 Bacteria 7980
151 Ga0307414_10020640 3300032004 Bacteria 4111
152 Ga0307411_10018504 3300032005 Bacteria 3998
153 Ga0307411_10904103 3300032005 Bacteria 784
154 Ga0307415_100001395 3300032126 Bacteria 11528
155 Ga0307415_100021916 3300032126 Bacteria 3935
156 Ga0307415_100039917 3300032126 Bacteria 3106
157 Ga0307415_100085977 3300032126 Unclassified 2261
158 Ga0395899_0759032 3300037312 Bacteria 603
159 Ga0395900_0069174 3300037418 Bacteria 3628
160 Ga0395900_1261468 3300037418 Bacteria 653
161 Ga0395898_0072590 3300037466 Bacteria 3325
162 Ga0395898_0176175 3300037466 Bacteria 2044
163 Ga0395898_0834517 3300037466 Bacteria 861
164 Ga0395905_0008247 3300037471 Bacteria 10289
165 Ga0395905_0292922 3300037471 Unclassified 1514
166 Ga0395905_0783954 3300037471 Unclassified 856
167 Ga0436364_1030110 3300037853 Unclassified 1387
168 Ga0395901_0049448 3300038443 Bacteria 4368
169 Ga0395901_0574054 3300038443 Bacteria 1140
170 Ga0395901_0747383 3300038443 Unclassified 971
171 Ga0436365_0133759 3300039437 Bacteria 1448
172 Ga0436365_0338100 3300039437 Bacteria 1539
173 Ga0451800_0326761 3300041459 Bacteria 621
174 Ga0451849_1576500 3300041505 Bacteria 1091
175 Ga0439448_0140264 3300042005 Unclassified 836
176 Ga0439448_0174744 3300042005 Bacteria 750
177 Ga0439455_0039777 3300042012 Unclassified 1200
178 Ga0439457_109835 3300042014 Unclassified 647
179 Ga0439463_155428 3300042016 Bacteria 593
180 Ga0450914_040453 3300042118 Bacteria 590
181 Ga0450917_031644 3300042120 Bacteria 508
182 Ga0439458_0051689 3300042157 Unclassified 1015
183 Ga0439459_0055332 3300042438 Bacteria 883
184 Ga0439440_0059465 3300042993 Unclassified 973
185 Ga0495603_0000087 3300046455 Bacteria 41407
186 Ga0495629_0000674 3300046459 Bacteria 27697
187 Ga0495629_0221600 3300046459 Bacteria 1305
188 Ga0495641_0058602 3300046461 Bacteria 1742
189 Ga0495653_0005823 3300046463 Bacteria 10088
190 Ga0495653_0334311 3300046463 Unclassified 978
191 Ga0495605_0068459 3300046474 Unclassified 1682
192 Ga0495584_0012341 3300046491 Bacteria 4361
193 Ga0495585_0157566 3300046492 Bacteria 1180
194 Ga0495608_0043825 3300046511 Bacteria 2989
195 Ga0495620_0000041 3300046515 Bacteria 112605
196 Ga0495620_0059920 3300046515 Bacteria 1589
197 Ga0495628_0032156 3300046516 Plasmid 4238
198 Ga0495630_0003541 3300046517 Bacteria 10873
199 Ga0495630_0172761 3300046517 Unclassified 1647
200 Ga0495631_0074787 3300046518 Bacteria 1462
201 Ga0495637_0181078 3300046520 Unclassified 781
202 Ga0495637_0341762 3300046520 Unclassified 526
203 Ga0495644_0025372 3300046523 Bacteria 2250
204 Ga0495652_0000171 3300046529 Bacteria 74097
205 Ga0495640_0011620 3300046533 Bacteria 6764
206 Ga0495586_0000254 3300046535 Bacteria 35015
207 Ga0495621_0000872 3300046539 Bacteria 7702
208 Ga0495645_0067874 3300046543 Bacteria 2575
209 Ga0495656_0001348 3300046615 Bacteria 8010
210 Ga0495634_0331776 3300046642 Bacteria 914
211 Ga0495635_0052791 3300046663 Bacteria 2800
212 Ga0495659_0018308 3300046664 Bacteria 2333
213 Ga0495599_0016108 3300046678 Bacteria 4639
214 Ga0495658_0742249 3300046683 Bacteria 629
215 Ga0495624_0000013 3300046690 Bacteria 115278
216 Ga0495624_0000123 3300046690 Bacteria 54291
217 Ga0495589_0049013 3300046794 Unclassified 2090
218 Ga0495604_0281527 3300047317 Bacteria 1123
219 Ga0495636_0030403 3300047318 Unclassified 2208
220 Ga0495676_0335354 3300047321 Unclassified 1013
221 Ga0495685_094847 3300047447 Unclassified 987
222 Ga0495602_0518571 3300048088 Bacteria 830
223 Ga0496105_0894393 3300048908 Unclassified 670
224 Ga0496106_0000013 3300048909 Bacteria 202263
225 Ga0496106_0000307 3300048909 Bacteria 34433
226 Ga0496106_0184947 3300048909 Bacteria 1655
227 Ga0496107_0041652 3300048910 Bacteria 3298
228 Ga0496107_0106039 3300048910 Bacteria 2063
229 Ga0496107_0533945 3300048910 Bacteria 869
230 Ga0496108_0012230 3300048911 Bacteria 6982
231 Ga0496110_0017966 3300048913 Bacteria 5924
232 Ga0496111_0130377 3300048914 Unclassified 1860
233 Ga0496111_0251791 3300048914 Bacteria 1311
234 Ga0496112_0000002 3300048915 Bacteria 782039
235 Ga0496113_0031568 3300048916 Bacteria 3845
236 Ga0496114_0000080 3300048917 Bacteria 68701
237 Ga0496114_0035358 3300048917 Bacteria 4125
238 Ga0496115_0000006 3300048918 Bacteria 252944
239 Ga0496115_0000064 3300048918 Bacteria 99309
240 Ga0496115_0000104 3300048918 Bacteria 79824
241 Ga0496124_0197932 3300048927 Unclassified 1531
242 Ga0501031_0000634 3300049568 Bacteria 20782
243 Ga0501031_0015790 3300049568 Bacteria 4903
244 Ga0501032_0001623 3300049569 Bacteria 17925
245 Ga0501032_0021806 3300049569 Bacteria 4449
246 Ga0501033_0004632 3300049570 Bacteria 11006
247 Ga0501033_0011271 3300049570 Bacteria 6843
248 Ga0501034_0089472 3300049571 Bacteria 3076
249 Ga0501034_0544067 3300049571 Unclassified 1071
250 Ga0501036_0002639 3300049572 Bacteria 14137
251 Ga0501036_0003720 3300049572 Bacteria 12228
252 Ga0501036_0274696 3300049572 Unclassified 1411
253 Ga0501037_0007652 3300049573 Bacteria 7910
254 Ga0501038_0001045 3300049574 Bacteria 25011
255 Ga0501038_0003380 3300049574 Bacteria 14878
256 Ga0501039_0011493 3300049575 Bacteria 6739
257 Ga0501039_0019841 3300049575 Bacteria 5152
258 Ga0501039_1079658 3300049575 Unclassified 622
259 Ga0501040_0002587 3300049576 Bacteria 11671
260 Ga0501040_0020350 3300049576 Bacteria 4420
261 Ga0501040_0092854 3300049576 Unclassified 2099
262 Ga0501040_0100420 3300049576 Bacteria 2017
263 Ga0501041_0001015 3300049577 Bacteria 15334
264 Ga0501042_0016093 3300049578 Bacteria 5132
265 Ga0501042_0044217 3300049578 Bacteria 3172
266 Ga0501042_0419083 3300049578 Bacteria 970
267 Ga0501043_0001921 3300049579 Bacteria 17790
268 Ga0501043_0187340 3300049579 Bacteria 1610
269 Ga0501046_0003728 3300049580 Bacteria 13948
270 Ga0501046_0004942 3300049580 Bacteria 11982
271 Ga0501047_0004891 3300049581 Bacteria 12585
272 Ga0501048_0003976 3300049582 Bacteria 11228
273 Ga0501048_0007040 3300049582 Bacteria 8541
274 Ga0501067_0120093 3300049583 Bacteria 1462
275 Ga0501068_0035393 3300049584 Bacteria 2980
276 Ga0501068_0068252 3300049584 Bacteria 2167
277 Ga0501068_0109488 3300049584 Unclassified 1717
278 Ga0501069_0157630 3300049585 Bacteria 1306
279 Ga0501070_0003576 3300049586 Bacteria 13442
280 Ga0501070_0312773 3300049586 Bacteria 1278
281 Ga0501070_0377227 3300049586 Bacteria 1149
282 Ga0501071_0006785 3300049587 Bacteria 7456
283 Ga0501071_0008677 3300049587 Bacteria 6724
284 Ga0501071_0850220 3300049587 Unclassified 704
285 Ga0501072_0002888 3300049588 Bacteria 12930
286 Ga0501073_0004093 3300049589 Bacteria 10940
287 Ga0501073_0384107 3300049589 Bacteria 970
288 Ga0501074_0008602 3300049590 Bacteria 7393
289 Ga0501074_0199141 3300049590 Bacteria 1427
290 Ga0501075_0012631 3300049591 Bacteria 6006
291 Ga0501075_0461491 3300049591 Bacteria 969
292 Ga0501076_0017201 3300049592 Bacteria 5491
293 Ga0501076_0194796 3300049592 Bacteria 1654
294 Ga0501077_0255270 3300049593 Bacteria 1115
295 Ga0501079_0010534 3300049741 Bacteria 7030
296 Ga0501079_0123906 3300049741 Bacteria 2010
297 Ga0501079_0470152 3300049741 Bacteria 988
298 Ga0501079_1460056 3300049741 Unclassified 538
299 Ga0501080_0031754 3300049742 Bacteria 4921
300 Ga0501080_0040307 3300049742 Bacteria 4356
301 Ga0501080_0383072 3300049742 Unclassified 1267
302 Ga0501081_0004550 3300049743 Bacteria 8905
303 Ga0501083_0025050 3300049744 Bacteria 4132
304 Ga0501035_0004356 3300049822 Bacteria 13442
305 Ga0501035_0932094 3300049822 Bacteria 686
306 Ga0501044_0005926 3300049823 Bacteria 13542
307 Ga0501045_0003311 3300049824 Bacteria 11014
308 Ga0501045_0017532 3300049824 Bacteria 5085
309 Ga0501045_0251991 3300049824 Bacteria 1314
310 Ga0501045_1140503 3300049824 Unclassified 570
311 nmdc:mga0qj67_1305131_c1 3300050509 Unclassified 562
312 nmdc:mga06r32_801989_c1 3300050510 Bacteria 902
313 nmdc:mga08y16_1527529_c1 3300050511 Bacteria 627
314 nmdc:mga0a205_5571_c1 3300050515 Bacteria 11344
315 Ga0495601_0001597 3300053077 Bacteria 12512
316 Ga0495601_0057565 3300053077 Bacteria 2462
317 Ga0495612_0000058 3300053078 Bacteria 49549
318 Ga0500566_0000785 3300053094 Bacteria 18011
319 Ga0501084_0004034 3300054114 Bacteria 11960
320 Ga0501084_0219432 3300054114 Bacteria 1604
321 Ga0501084_0659660 3300054114 Unclassified 883
322 Ga0501084_0820486 3300054114 Bacteria 783
323 Ga0501082_0005667 3300060353 Bacteria 10839
324 Ga0501082_0010661 3300060353 Bacteria 7911
325 Ga0501082_0490561 3300060353 Unclassified 1074
326 Ga0530510_0001730 3300061734 Bacteria 14843

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0334311 Ga0495653_0334311_228_581 114
2 3300005536 Ga0070697_102002612 Ga0070697_1020026121 123
3 3300047317 Ga0495604_0281527 Ga0495604_0281527_86_463 125
4 3300049742 Ga0501080_0383072 Ga0501080_0383072_138_530 125
5 3300005329 Ga0070683_100057328 Ga0070683_1000573284 126
6 3300005356 Ga0070674_100000241 Ga0070674_10000024111 126
7 3300005439 Ga0070711_100031016 Ga0070711_1000310164 126
8 3300005535 Ga0070684_100015411 Ga0070684_1000154113 126
9 3300005718 Ga0068866_10000575 Ga0068866_1000057512 126
10 3300005840 Ga0068870_10248601 Ga0068870_102486013 126
11 3300005841 Ga0068863_100009454 Ga0068863_1000094549 126
12 3300009176 Ga0105242_10035255 Ga0105242_100352553 126
13 3300013308 Ga0157375_10725639 Ga0157375_107256393 126
14 3300025899 Ga0207642_10000227 Ga0207642_1000022712 126
15 3300025916 Ga0207663_10006102 Ga0207663_100061028 126
16 3300025934 Ga0207686_10075562 Ga0207686_100755621 126
17 3300025937 Ga0207669_10000014 Ga0207669_10000014122 126
18 3300026088 Ga0207641_10003078 Ga0207641_100030788 126
19 3300042118 Ga0450914_040453 Ga0450914_040453_130_510 126
20 3300046455 Ga0495603_0000087 Ga0495603_0000087_26440_26829 126
21 3300046511 Ga0495608_0043825 Ga0495608_0043825_205_594 126
22 3300046663 Ga0495635_0052791 Ga0495635_0052791_1971_2360 126
23 3300046678 Ga0495599_0016108 Ga0495599_0016108_2793_3182 126
24 3300046690 Ga0495624_0000013 Ga0495624_0000013_112500_112889 126
25 3300048909 Ga0496106_0000013 Ga0496106_0000013_192764_193153 126
26 3300048910 Ga0496107_0041652 Ga0496107_0041652_220_609 126
27 3300048911 Ga0496108_0012230 Ga0496108_0012230_442_831 126
28 3300048913 Ga0496110_0017966 Ga0496110_0017966_5331_5720 126
29 3300048914 Ga0496111_0251791 Ga0496111_0251791_604_993 126
30 3300048915 Ga0496112_0000002 Ga0496112_0000002_656040_656429 126
31 3300048917 Ga0496114_0035358 Ga0496114_0035358_3592_3981 126
32 3300053094 Ga0500566_0000785 Ga0500566_0000785_6949_7338 126
33 3300048908 Ga0496105_0894393 Ga0496105_0894393_55_438 127
34 3300049824 Ga0501045_1140503 Ga0501045_1140503_51_434 127
35 3300013296 Ga0157374_10003614 Ga0157374_1000361414 128
36 3300031712 Ga0265342_10170982 Ga0265342_101709823 128
37 3300041505 Ga0451849_1576500 Ga0451849_1576500_318_704 128
38 3300048917 Ga0496114_0000080 Ga0496114_0000080_18866_19252 128
39 3300048918 Ga0496115_0000104 Ga0496115_0000104_61089_61475 128
40 3300049741 Ga0501079_0470152 Ga0501079_0470152_190_576 128
41 3300049822 Ga0501035_0932094 Ga0501035_0932094_25_411 128
42 3300054114 Ga0501084_0820486 Ga0501084_0820486_277_663 128
43 3300049741 Ga0501079_1460056 Ga0501079_1460056_114_503 129
44 3300001977 JGI24746J21847_1000010 JGI24746J21847_100001013 130
45 3300003373 JGI25407J50210_10006500 JGI25407J50210_100065006 130
46 3300003373 JGI25407J50210_10021998 JGI25407J50210_100219981 130
47 3300003373 JGI25407J50210_10101948 JGI25407J50210_101019482 130
48 3300005327 Ga0070658_10007065 Ga0070658_100070655 130
49 3300005330 Ga0070690_100174241 Ga0070690_1001742413 130
50 3300005336 Ga0070680_100130738 Ga0070680_1001307383 130
51 3300005337 Ga0070682_100657284 Ga0070682_1006572842 130
52 3300005337 Ga0070682_100964750 Ga0070682_1009647502 130
53 3300005338 Ga0068868_100001165 Ga0068868_10000116518 130
54 3300005345 Ga0070692_10214095 Ga0070692_102140952 130
55 3300005356 Ga0070674_100000002 Ga0070674_10000000275 130
56 3300005364 Ga0070673_100545966 Ga0070673_1005459662 130
57 3300005439 Ga0070711_100611969 Ga0070711_1006119692 130
58 3300005458 Ga0070681_10035936 Ga0070681_100359366 130
59 3300005467 Ga0070706_100513782 Ga0070706_1005137822 130
60 3300005467 Ga0070706_100525016 Ga0070706_1005250162 130
61 3300005530 Ga0070679_100324431 Ga0070679_1003244312 130
62 3300005530 Ga0070679_100412874 Ga0070679_1004128742 130
63 3300005547 Ga0070693_100436958 Ga0070693_1004369582 130
64 3300005549 Ga0070704_100141133 Ga0070704_1001411333 130
65 3300005549 Ga0070704_102004289 Ga0070704_1020042891 130
66 3300005563 Ga0068855_100423349 Ga0068855_1004233493 130
67 3300005563 Ga0068855_100959322 Ga0068855_1009593222 130
68 3300005614 Ga0068856_100041764 Ga0068856_1000417646 130
69 3300005616 Ga0068852_100000104 Ga0068852_1000001049 130
70 3300005718 Ga0068866_10000600 Ga0068866_1000060019 130
71 3300005719 Ga0068861_100095638 Ga0068861_1000956385 130
72 3300005834 Ga0068851_10007094 Ga0068851_100070942 130
73 3300005843 Ga0068860_100003597 Ga0068860_1000035974 130
74 3300005937 Ga0081455_11039556 Ga0081455_110395562 130
75 3300005981 Ga0081538_10005519 Ga0081538_100055192 130
76 3300005981 Ga0081538_10010996 Ga0081538_100109964 130
77 3300005981 Ga0081538_10011153 Ga0081538_100111536 130
78 3300005981 Ga0081538_10020661 Ga0081538_100206613 130
79 3300005981 Ga0081538_10058734 Ga0081538_100587342 130
80 3300005983 Ga0081540_1015551 Ga0081540_10155515 130
81 3300005985 Ga0081539_10018669 Ga0081539_100186692 130
82 3300005985 Ga0081539_10146240 Ga0081539_101462403 130
83 3300006028 Ga0070717_10581756 Ga0070717_105817562 130
84 3300006163 Ga0070715_10000008 Ga0070715_1000000811 130
85 3300006847 Ga0075431_100583687 Ga0075431_1005836873 130
86 3300009094 Ga0111539_10413010 Ga0111539_104130104 130
87 3300009094 Ga0111539_11741238 Ga0111539_117412382 130
88 3300009098 Ga0105245_10000117 Ga0105245_1000011737 130
89 3300009177 Ga0105248_10000037 Ga0105248_10000037128 130
90 3300009545 Ga0105237_10002855 Ga0105237_1000285511 130
91 3300013104 Ga0157370_10083061 Ga0157370_100830613 130
92 3300013105 Ga0157369_10000051 Ga0157369_10000051141 130
93 3300013306 Ga0163162_10193867 Ga0163162_101938671 130
94 3300013308 Ga0157375_10352197 Ga0157375_103521974 130
95 3300014325 Ga0163163_10148946 Ga0163163_101489465 130
96 3300014326 Ga0157380_10252213 Ga0157380_102522132 130
97 3300014326 Ga0157380_10356805 Ga0157380_103568054 130
98 3300014497 Ga0182008_10229501 Ga0182008_102295012 130
99 3300014745 Ga0157377_10644205 Ga0157377_106442051 130
100 3300020069 Ga0197907_10108656 Ga0197907_101086563 130
101 3300020081 Ga0206354_10857453 Ga0206354_108574533 130
102 3300020082 Ga0206353_11593059 Ga0206353_115930593 130
103 3300020610 Ga0154015_1134837 Ga0154015_11348372 130
104 3300025899 Ga0207642_10000108 Ga0207642_1000010818 130
105 3300025905 Ga0207685_10000012 Ga0207685_1000001211 130
106 3300025909 Ga0207705_10861420 Ga0207705_108614201 130
107 3300025910 Ga0207684_10593520 Ga0207684_105935202 130
108 3300025912 Ga0207707_10206821 Ga0207707_102068212 130
109 3300025912 Ga0207707_10657068 Ga0207707_106570683 130
110 3300025914 Ga0207671_10000406 Ga0207671_1000040655 130
111 3300025916 Ga0207663_10372457 Ga0207663_103724571 130
112 3300025917 Ga0207660_10077080 Ga0207660_100770803 130
113 3300025921 Ga0207652_10226323 Ga0207652_102263233 130
114 3300025921 Ga0207652_11283797 Ga0207652_112837972 130
115 3300025922 Ga0207646_10405546 Ga0207646_104055462 130
116 3300025927 Ga0207687_10000070 Ga0207687_1000007058 130
117 3300025937 Ga0207669_10000003 Ga0207669_10000003219 130
118 3300025941 Ga0207711_10000011 Ga0207711_10000011415 130
119 3300025949 Ga0207667_10366051 Ga0207667_103660513 130
120 3300025949 Ga0207667_10968609 Ga0207667_109686092 130
121 3300025960 Ga0207651_10446376 Ga0207651_104463763 130
122 3300026023 Ga0207677_10005215 Ga0207677_100052155 130
123 3300026075 Ga0207708_10014365 Ga0207708_100143652 130
124 3300026078 Ga0207702_10000202 Ga0207702_1000020267 130
125 3300026078 Ga0207702_10028659 Ga0207702_100286595 130
126 3300026118 Ga0207675_100132209 Ga0207675_1001322095 130
127 3300026121 Ga0207683_10179935 Ga0207683_101799352 130
128 3300026142 Ga0207698_10000015 Ga0207698_1000001574 130
129 3300028381 Ga0268264_10002647 Ga0268264_1000264716 130
130 3300028558 Ga0265326_10025820 Ga0265326_100258202 130
131 3300028563 Ga0265319_1000020 Ga0265319_100002098 130
132 3300028563 Ga0265319_1059245 Ga0265319_10592452 130
133 3300028573 Ga0265334_10022069 Ga0265334_100220692 130
134 3300028800 Ga0265338_10000222 Ga0265338_1000022288 130
135 3300028800 Ga0265338_10093657 Ga0265338_100936574 130
136 3300029957 Ga0265324_10046705 Ga0265324_100467052 130
137 3300031240 Ga0265320_10136331 Ga0265320_101363312 130
138 3300031241 Ga0265325_10017278 Ga0265325_100172782 130
139 3300031247 Ga0265340_10123965 Ga0265340_101239652 130
140 3300031249 Ga0265339_10123020 Ga0265339_101230202 130
141 3300031250 Ga0265331_10318526 Ga0265331_103185262 130
142 3300031250 Ga0265331_10432867 Ga0265331_104328672 130
143 3300031344 Ga0265316_10162263 Ga0265316_101622632 130
144 3300031344 Ga0265316_10948241 Ga0265316_109482412 130
145 3300031456 Ga0307513_10319239 Ga0307513_103192392 130
146 3300031548 Ga0307408_100016716 Ga0307408_1000167165 130
147 3300031548 Ga0307408_100184107 Ga0307408_1001841073 130
148 3300031548 Ga0307408_100206295 Ga0307408_1002062953 130
149 3300031711 Ga0265314_10138501 Ga0265314_101385012 130
150 3300031731 Ga0307405_10009750 Ga0307405_100097502 130
151 3300031731 Ga0307405_10038705 Ga0307405_100387053 130
152 3300031731 Ga0307405_10066503 Ga0307405_100665032 130
153 3300031824 Ga0307413_10003204 Ga0307413_100032044 130
154 3300031824 Ga0307413_10006024 Ga0307413_100060246 130
155 3300031824 Ga0307413_10851114 Ga0307413_108511142 130
156 3300031852 Ga0307410_10000513 Ga0307410_100005136 130
157 3300031852 Ga0307410_10011358 Ga0307410_100113583 130
158 3300031852 Ga0307410_10015456 Ga0307410_100154563 130
159 3300031852 Ga0307410_11937798 Ga0307410_119377981 130
160 3300031901 Ga0307406_10000219 Ga0307406_1000021931 130
161 3300031901 Ga0307406_10003563 Ga0307406_100035637 130
162 3300031901 Ga0307406_10014150 Ga0307406_100141505 130
163 3300031903 Ga0307407_10002623 Ga0307407_100026237 130
164 3300031903 Ga0307407_10007277 Ga0307407_100072773 130
165 3300031903 Ga0307407_10023279 Ga0307407_100232794 130
166 3300031911 Ga0307412_10209767 Ga0307412_102097672 130
167 3300031911 Ga0307412_10538742 Ga0307412_105387422 130
168 3300031911 Ga0307412_11689209 Ga0307412_116892091 130
169 3300031995 Ga0307409_100000594 Ga0307409_10000059417 130
170 3300031995 Ga0307409_100002712 Ga0307409_1000027125 130
171 3300031995 Ga0307409_100027542 Ga0307409_1000275424 130
172 3300031995 Ga0307409_100203611 Ga0307409_1002036112 130
173 3300031995 Ga0307409_102741323 Ga0307409_1027413232 130
174 3300032002 Ga0307416_100000297 Ga0307416_1000002973 130
175 3300032002 Ga0307416_100045411 Ga0307416_1000454113 130
176 3300032004 Ga0307414_10003969 Ga0307414_100039698 130
177 3300032004 Ga0307414_10020640 Ga0307414_100206403 130
178 3300032005 Ga0307411_10018504 Ga0307411_100185043 130
179 3300032005 Ga0307411_10904103 Ga0307411_109041031 130
180 3300032126 Ga0307415_100001395 Ga0307415_1000013959 130
181 3300032126 Ga0307415_100021916 Ga0307415_1000219161 130
182 3300032126 Ga0307415_100039917 Ga0307415_1000399174 130
183 3300032126 Ga0307415_100085977 Ga0307415_1000859773 130
184 3300037312 Ga0395899_0759032 Ga0395899_0759032_14_406 130
185 3300037418 Ga0395900_0069174 Ga0395900_0069174_1731_2123 130
186 3300037418 Ga0395900_1261468 Ga0395900_1261468_58_450 130
187 3300037466 Ga0395898_0072590 Ga0395898_0072590_453_845 130
188 3300037466 Ga0395898_0176175 Ga0395898_0176175_950_1342 130
189 3300037466 Ga0395898_0834517 Ga0395898_0834517_21_413 130
190 3300037471 Ga0395905_0008247 Ga0395905_0008247_8572_8964 130
191 3300037471 Ga0395905_0292922 Ga0395905_0292922_193_585 130
192 3300037471 Ga0395905_0783954 Ga0395905_0783954_229_621 130
193 3300037853 Ga0436364_1030110 Ga0436364_1030110_967_1359 130
194 3300038443 Ga0395901_0049448 Ga0395901_0049448_291_683 130
195 3300038443 Ga0395901_0574054 Ga0395901_0574054_543_935 130
196 3300038443 Ga0395901_0747383 Ga0395901_0747383_151_543 130
197 3300039437 Ga0436365_0133759 Ga0436365_0133759_402_794 130
198 3300039437 Ga0436365_0338100 Ga0436365_0338100_240_632 130
199 3300041459 Ga0451800_0326761 Ga0451800_0326761_57_449 130
200 3300042005 Ga0439448_0140264 Ga0439448_0140264_299_691 130
201 3300042005 Ga0439448_0174744 Ga0439448_0174744_195_587 130
202 3300042012 Ga0439455_0039777 Ga0439455_0039777_666_1058 130
203 3300042014 Ga0439457_109835 Ga0439457_109835_227_619 130
204 3300042016 Ga0439463_155428 Ga0439463_155428_116_508 130
205 3300042120 Ga0450917_031644 Ga0450917_031644_91_483 130
206 3300042157 Ga0439458_0051689 Ga0439458_0051689_550_942 130
207 3300042438 Ga0439459_0055332 Ga0439459_0055332_202_594 130
208 3300042993 Ga0439440_0059465 Ga0439440_0059465_405_797 130
209 3300046459 Ga0495629_0000674 Ga0495629_0000674_26071_26463 130
210 3300046459 Ga0495629_0221600 Ga0495629_0221600_382_774 130
211 3300046461 Ga0495641_0058602 Ga0495641_0058602_325_717 130
212 3300046463 Ga0495653_0005823 Ga0495653_0005823_1238_1630 130
213 3300046474 Ga0495605_0068459 Ga0495605_0068459_869_1261 130
214 3300046491 Ga0495584_0012341 Ga0495584_0012341_817_1209 130
215 3300046492 Ga0495585_0157566 Ga0495585_0157566_332_724 130
216 3300046515 Ga0495620_0000041 Ga0495620_0000041_66152_66562 130
217 3300046515 Ga0495620_0059920 Ga0495620_0059920_295_687 130
218 3300046516 Ga0495628_0032156 Ga0495628_0032156_2628_3020 130
219 3300046517 Ga0495630_0003541 Ga0495630_0003541_1272_1682 130
220 3300046517 Ga0495630_0172761 Ga0495630_0172761_80_472 130
221 3300046518 Ga0495631_0074787 Ga0495631_0074787_624_1016 130
222 3300046520 Ga0495637_0181078 Ga0495637_0181078_166_558 130
223 3300046520 Ga0495637_0341762 Ga0495637_0341762_89_481 130
224 3300046523 Ga0495644_0025372 Ga0495644_0025372_1524_1916 130
225 3300046529 Ga0495652_0000171 Ga0495652_0000171_61460_61852 130
226 3300046533 Ga0495640_0011620 Ga0495640_0011620_5800_6192 130
227 3300046535 Ga0495586_0000254 Ga0495586_0000254_31141_31533 130
228 3300046539 Ga0495621_0000872 Ga0495621_0000872_3097_3489 130
229 3300046543 Ga0495645_0067874 Ga0495645_0067874_490_882 130
230 3300046615 Ga0495656_0001348 Ga0495656_0001348_1166_1558 130
231 3300046642 Ga0495634_0331776 Ga0495634_0331776_460_852 130
232 3300046664 Ga0495659_0018308 Ga0495659_0018308_869_1261 130
233 3300046683 Ga0495658_0742249 Ga0495658_0742249_152_556 130
234 3300046690 Ga0495624_0000123 Ga0495624_0000123_30631_31023 130
235 3300046794 Ga0495589_0049013 Ga0495589_0049013_1326_1718 130
236 3300047318 Ga0495636_0030403 Ga0495636_0030403_100_492 130
237 3300047321 Ga0495676_0335354 Ga0495676_0335354_533_925 130
238 3300047447 Ga0495685_094847 Ga0495685_094847_54_446 130
239 3300048088 Ga0495602_0518571 Ga0495602_0518571_131_523 130
240 3300048909 Ga0496106_0000307 Ga0496106_0000307_18663_19055 130
241 3300048909 Ga0496106_0184947 Ga0496106_0184947_388_792 130
242 3300048910 Ga0496107_0106039 Ga0496107_0106039_257_649 130
243 3300048910 Ga0496107_0533945 Ga0496107_0533945_345_749 130
244 3300048914 Ga0496111_0130377 Ga0496111_0130377_987_1379 130
245 3300048916 Ga0496113_0031568 Ga0496113_0031568_2039_2431 130
246 3300048918 Ga0496115_0000006 Ga0496115_0000006_243735_244127 130
247 3300048918 Ga0496115_0000064 Ga0496115_0000064_83842_84234 130
248 3300048927 Ga0496124_0197932 Ga0496124_0197932_801_1193 130
249 3300049568 Ga0501031_0000634 Ga0501031_0000634_11900_12292 130
250 3300049568 Ga0501031_0015790 Ga0501031_0015790_2589_2981 130
251 3300049569 Ga0501032_0001623 Ga0501032_0001623_5633_6025 130
252 3300049569 Ga0501032_0021806 Ga0501032_0021806_70_462 130
253 3300049570 Ga0501033_0004632 Ga0501033_0004632_5563_5955 130
254 3300049570 Ga0501033_0011271 Ga0501033_0011271_5302_5694 130
255 3300049571 Ga0501034_0089472 Ga0501034_0089472_1150_1542 130
256 3300049571 Ga0501034_0544067 Ga0501034_0544067_326_718 130
257 3300049572 Ga0501036_0002639 Ga0501036_0002639_5253_5645 130
258 3300049572 Ga0501036_0003720 Ga0501036_0003720_2355_2747 130
259 3300049572 Ga0501036_0274696 Ga0501036_0274696_189_581 130
260 3300049573 Ga0501037_0007652 Ga0501037_0007652_2223_2615 130
261 3300049574 Ga0501038_0001045 Ga0501038_0001045_11873_12265 130
262 3300049574 Ga0501038_0003380 Ga0501038_0003380_9390_9782 130
263 3300049575 Ga0501039_0011493 Ga0501039_0011493_2003_2395 130
264 3300049575 Ga0501039_0019841 Ga0501039_0019841_1456_1848 130
265 3300049575 Ga0501039_1079658 Ga0501039_1079658_128_520 130
266 3300049576 Ga0501040_0002587 Ga0501040_0002587_2186_2578 130
267 3300049576 Ga0501040_0020350 Ga0501040_0020350_2413_2805 130
268 3300049576 Ga0501040_0092854 Ga0501040_0092854_412_804 130
269 3300049576 Ga0501040_0100420 Ga0501040_0100420_107_499 130
270 3300049577 Ga0501041_0001015 Ga0501041_0001015_9874_10266 130
271 3300049578 Ga0501042_0016093 Ga0501042_0016093_4312_4704 130
272 3300049578 Ga0501042_0044217 Ga0501042_0044217_1120_1512 130
273 3300049578 Ga0501042_0419083 Ga0501042_0419083_426_818 130
274 3300049579 Ga0501043_0001921 Ga0501043_0001921_5498_5890 130
275 3300049579 Ga0501043_0187340 Ga0501043_0187340_32_424 130
276 3300049580 Ga0501046_0003728 Ga0501046_0003728_11901_12293 130
277 3300049580 Ga0501046_0004942 Ga0501046_0004942_9403_9795 130
278 3300049581 Ga0501047_0004891 Ga0501047_0004891_293_685 130
279 3300049582 Ga0501048_0003976 Ga0501048_0003976_5520_5912 130
280 3300049582 Ga0501048_0007040 Ga0501048_0007040_5085_5477 130
281 3300049583 Ga0501067_0120093 Ga0501067_0120093_240_632 130
282 3300049584 Ga0501068_0035393 Ga0501068_0035393_1255_1647 130
283 3300049584 Ga0501068_0068252 Ga0501068_0068252_1103_1495 130
284 3300049584 Ga0501068_0109488 Ga0501068_0109488_1299_1691 130
285 3300049585 Ga0501069_0157630 Ga0501069_0157630_44_436 130
286 3300049586 Ga0501070_0003576 Ga0501070_0003576_1150_1542 130
287 3300049586 Ga0501070_0312773 Ga0501070_0312773_190_582 130
288 3300049586 Ga0501070_0377227 Ga0501070_0377227_109_501 130
289 3300049587 Ga0501071_0006785 Ga0501071_0006785_1502_1894 130
290 3300049587 Ga0501071_0008677 Ga0501071_0008677_2339_2731 130
291 3300049587 Ga0501071_0850220 Ga0501071_0850220_132_524 130
292 3300049588 Ga0501072_0002888 Ga0501072_0002888_9278_9670 130
293 3300049589 Ga0501073_0004093 Ga0501073_0004093_5025_5417 130
294 3300049589 Ga0501073_0384107 Ga0501073_0384107_409_801 130
295 3300049590 Ga0501074_0008602 Ga0501074_0008602_5528_5920 130
296 3300049590 Ga0501074_0199141 Ga0501074_0199141_312_704 130
297 3300049591 Ga0501075_0012631 Ga0501075_0012631_584_976 130
298 3300049591 Ga0501075_0461491 Ga0501075_0461491_216_608 130
299 3300049592 Ga0501076_0017201 Ga0501076_0017201_2162_2554 130
300 3300049592 Ga0501076_0194796 Ga0501076_0194796_932_1324 130
301 3300049593 Ga0501077_0255270 Ga0501077_0255270_307_699 130
302 3300049741 Ga0501079_0010534 Ga0501079_0010534_1777_2169 130
303 3300049741 Ga0501079_0123906 Ga0501079_0123906_1188_1580 130
304 3300049742 Ga0501080_0031754 Ga0501080_0031754_3657_4049 130
305 3300049742 Ga0501080_0040307 Ga0501080_0040307_1134_1526 130
306 3300049743 Ga0501081_0004550 Ga0501081_0004550_2203_2595 130
307 3300049744 Ga0501083_0025050 Ga0501083_0025050_2968_3360 130
308 3300049822 Ga0501035_0004356 Ga0501035_0004356_11901_12293 130
309 3300049823 Ga0501044_0005926 Ga0501044_0005926_1250_1642 130
310 3300049824 Ga0501045_0003311 Ga0501045_0003311_8434_8826 130
311 3300049824 Ga0501045_0017532 Ga0501045_0017532_53_445 130
312 3300049824 Ga0501045_0251991 Ga0501045_0251991_205_597 130
313 3300050509 nmdc:mga0qj67_1305131_c1 nmdc:mga0qj67_1305131_c1_139_531 130
314 3300050510 nmdc:mga06r32_801989_c1 nmdc:mga06r32_801989_c1_308_700 130
315 3300050511 nmdc:mga08y16_1527529_c1 nmdc:mga08y16_1527529_c1_136_534 130
316 3300050515 nmdc:mga0a205_5571_c1 nmdc:mga0a205_5571_c1_10678_11070 130
317 3300053077 Ga0495601_0001597 Ga0495601_0001597_3382_3774 130
318 3300053077 Ga0495601_0057565 Ga0495601_0057565_369_761 130
319 3300053078 Ga0495612_0000058 Ga0495612_0000058_6606_6998 130
320 3300054114 Ga0501084_0004034 Ga0501084_0004034_9400_9792 130
321 3300054114 Ga0501084_0219432 Ga0501084_0219432_406_798 130
322 3300054114 Ga0501084_0659660 Ga0501084_0659660_250_642 130
323 3300060353 Ga0501082_0005667 Ga0501082_0005667_2169_2561 130
324 3300060353 Ga0501082_0010661 Ga0501082_0010661_5214_5606 130
325 3300060353 Ga0501082_0490561 Ga0501082_0490561_554_946 130
326 3300061734 Ga0530510_0001730 Ga0530510_0001730_9460_9852 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

25

145

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.7763 4 115
5ecw-assembly1.cif.gz_A structure of the shigella flexneri vapc mutant d7a 0.7756 1 119
2fe1-assembly1.cif.gz_A-2 crystal structure of pae0151 from pyrobaculum aerophilum 0.7709 3 128
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.7589 1 118
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.7488 2 119
ID Description Score Start End Superfamily
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9801 4 125 3.40.50.1010
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9645 4 125 3.40.50.1010
af_P9WF57_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.774 4 119 3.40.50.1010
2fe1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7709 3 128 3.40.50.1010
af_O50411_2_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7612 2 124 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7I7NM26-F1-model_v4 PIN domain-containing protein 0.9822 1 88 GO:0004518
AF-P71623-F1-model_v4 Ribonuclease VapC22 (RNase VapC22) (EC 3.1.-.-) (Toxin VapC22) 0.9801 1 130 GO:0000287
GO:0004540
GO:0005576
GO:0017148
AF-A0A7V9JZP3-F1-model_v4 PIN domain-containing protein 0.9765 1 101 GO:0004518
AF-A0A7V9JZP3-F1-model_v4 PIN domain-containing protein 0.9579 1 101 GO:0004518
AF-A0A2V9HBF3-F1-model_v4 PIN domain-containing protein 0.9422 3 104

Feature Viewer

pLDDT pTM Quality
94.41 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map