F408321
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 207 | 326 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300014745|Ga0157377_10644205|Ga0157377_106442051 |
| Length | 151 |
| Sequence | MTAGEEEDLFSTGESWNASEEVDAVLLDTHVVHWWSAEPKRVSAPARKILEEADELVVAAISWYELAWLARHDRIVVNVPIRSWLQGLAEQLRTIGVTPAIADTAAALPSSFPGDPADRLIYATAIEHGFGLVTKDRVIRDHDRPRSLTIW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 24 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 25 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 26 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 27 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 30 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 32 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 49 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 51 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 53 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 54 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 79 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 80 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 81 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 82 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 83 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 84 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 85 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 86 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 87 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 88 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 89 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 90 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 91 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 93 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 94 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 95 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 96 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 97 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 98 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 99 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 100 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 101 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 102 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 103 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 104 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 107 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 108 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 111 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 112 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 113 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 114 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 115 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 116 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 117 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 118 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 119 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 120 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 121 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 122 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 155 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 156 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 157 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 159 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 160 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 161 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 162 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 163 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 164 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 165 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 205 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.77 |
| Metatranscriptomes | 1.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.31 |
| Nodule | 0 |
| Rhizoplane | 5.83 |
| Rhizosphere | 92.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000010 | 3300001977 | Bacteria | 18578 |
| 2 | JGI25407J50210_10006500 | 3300003373 | Bacteria | 2912 |
| 3 | JGI25407J50210_10021998 | 3300003373 | Bacteria | 1658 |
| 4 | JGI25407J50210_10101948 | 3300003373 | Unclassified | 709 |
| 5 | Ga0070658_10007065 | 3300005327 | Bacteria | 9060 |
| 6 | Ga0070683_100057328 | 3300005329 | Bacteria | 3619 |
| 7 | Ga0070690_100174241 | 3300005330 | Bacteria | 1482 |
| 8 | Ga0070680_100130738 | 3300005336 | Bacteria | 2100 |
| 9 | Ga0070682_100657284 | 3300005337 | Bacteria | 835 |
| 10 | Ga0070682_100964750 | 3300005337 | Unclassified | 705 |
| 11 | Ga0068868_100001165 | 3300005338 | Bacteria | 18004 |
| 12 | Ga0070692_10214095 | 3300005345 | Bacteria | 1135 |
| 13 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 14 | Ga0070674_100000241 | 3300005356 | Bacteria | 27097 |
| 15 | Ga0070673_100545966 | 3300005364 | Bacteria | 1052 |
| 16 | Ga0070711_100031016 | 3300005439 | Bacteria | 3545 |
| 17 | Ga0070711_100611969 | 3300005439 | Bacteria | 910 |
| 18 | Ga0070681_10035936 | 3300005458 | Bacteria | 4977 |
| 19 | Ga0070706_100513782 | 3300005467 | Unclassified | 1114 |
| 20 | Ga0070706_100525016 | 3300005467 | Bacteria | 1101 |
| 21 | Ga0070679_100324431 | 3300005530 | Bacteria | 1489 |
| 22 | Ga0070679_100412874 | 3300005530 | Unclassified | 1295 |
| 23 | Ga0070684_100015411 | 3300005535 | Bacteria | 6226 |
| 24 | Ga0070697_102002612 | 3300005536 | Bacteria | 518 |
| 25 | Ga0070693_100436958 | 3300005547 | Unclassified | 915 |
| 26 | Ga0070704_100141133 | 3300005549 | Unclassified | 1881 |
| 27 | Ga0070704_102004289 | 3300005549 | Unclassified | 537 |
| 28 | Ga0068855_100423349 | 3300005563 | Bacteria | 1456 |
| 29 | Ga0068855_100959322 | 3300005563 | Bacteria | 900 |
| 30 | Ga0068856_100041764 | 3300005614 | Bacteria | 4509 |
| 31 | Ga0068852_100000104 | 3300005616 | Bacteria | 56243 |
| 32 | Ga0068866_10000575 | 3300005718 | Bacteria | 16721 |
| 33 | Ga0068866_10000600 | 3300005718 | Bacteria | 16403 |
| 34 | Ga0068861_100095638 | 3300005719 | Bacteria | 2353 |
| 35 | Ga0068851_10007094 | 3300005834 | Bacteria | 5132 |
| 36 | Ga0068870_10248601 | 3300005840 | Unclassified | 1101 |
| 37 | Ga0068863_100009454 | 3300005841 | Bacteria | 9511 |
| 38 | Ga0068860_100003597 | 3300005843 | Bacteria | 15930 |
| 39 | Ga0081455_11039556 | 3300005937 | Bacteria | 506 |
| 40 | Ga0081538_10005519 | 3300005981 | Bacteria | 11359 |
| 41 | Ga0081538_10010996 | 3300005981 | Bacteria | 7368 |
| 42 | Ga0081538_10011153 | 3300005981 | Bacteria | 7300 |
| 43 | Ga0081538_10020661 | 3300005981 | Bacteria | 4836 |
| 44 | Ga0081538_10058734 | 3300005981 | Bacteria | 2228 |
| 45 | Ga0081540_1015551 | 3300005983 | Bacteria | 4813 |
| 46 | Ga0081539_10018669 | 3300005985 | Bacteria | 4797 |
| 47 | Ga0081539_10146240 | 3300005985 | Bacteria | 1142 |
| 48 | Ga0070717_10581756 | 3300006028 | Unclassified | 1015 |
| 49 | Ga0070715_10000008 | 3300006163 | Bacteria | 189899 |
| 50 | Ga0075431_100583687 | 3300006847 | Bacteria | 1103 |
| 51 | Ga0111539_10413010 | 3300009094 | Bacteria | 1572 |
| 52 | Ga0111539_11741238 | 3300009094 | Bacteria | 723 |
| 53 | Ga0105245_10000117 | 3300009098 | Bacteria | 76863 |
| 54 | Ga0105242_10035255 | 3300009176 | Bacteria | 4012 |
| 55 | Ga0105248_10000037 | 3300009177 | Bacteria | 180751 |
| 56 | Ga0105237_10002855 | 3300009545 | Bacteria | 21010 |
| 57 | Ga0157370_10083061 | 3300013104 | Bacteria | 3012 |
| 58 | Ga0157369_10000051 | 3300013105 | Bacteria | 165672 |
| 59 | Ga0157374_10003614 | 3300013296 | Bacteria | 13023 |
| 60 | Ga0163162_10193867 | 3300013306 | Bacteria | 2160 |
| 61 | Ga0157375_10352197 | 3300013308 | Bacteria | 1638 |
| 62 | Ga0157375_10725639 | 3300013308 | Unclassified | 1146 |
| 63 | Ga0163163_10148946 | 3300014325 | Bacteria | 2385 |
| 64 | Ga0157380_10252213 | 3300014326 | Bacteria | 1598 |
| 65 | Ga0157380_10356805 | 3300014326 | Bacteria | 1370 |
| 66 | Ga0182008_10229501 | 3300014497 | Bacteria | 952 |
| 67 | Ga0157377_10644205 | 3300014745 | Bacteria | 762 |
| 68 | Ga0197907_10108656 | 3300020069 | Unclassified | 1783 |
| 69 | Ga0206354_10857453 | 3300020081 | Unclassified | 1890 |
| 70 | Ga0206353_11593059 | 3300020082 | Bacteria | 1744 |
| 71 | Ga0154015_1134837 | 3300020610 | Bacteria | 860 |
| 72 | Ga0207642_10000108 | 3300025899 | Bacteria | 22373 |
| 73 | Ga0207642_10000227 | 3300025899 | Bacteria | 16602 |
| 74 | Ga0207685_10000012 | 3300025905 | Bacteria | 189900 |
| 75 | Ga0207705_10861420 | 3300025909 | Bacteria | 702 |
| 76 | Ga0207684_10593520 | 3300025910 | Bacteria | 946 |
| 77 | Ga0207707_10206821 | 3300025912 | Bacteria | 1710 |
| 78 | Ga0207707_10657068 | 3300025912 | Bacteria | 883 |
| 79 | Ga0207671_10000406 | 3300025914 | Bacteria | 60268 |
| 80 | Ga0207663_10006102 | 3300025916 | Bacteria | 6133 |
| 81 | Ga0207663_10372457 | 3300025916 | Bacteria | 1086 |
| 82 | Ga0207660_10077080 | 3300025917 | Unclassified | 2439 |
| 83 | Ga0207652_10226323 | 3300025921 | Unclassified | 1686 |
| 84 | Ga0207652_11283797 | 3300025921 | Unclassified | 635 |
| 85 | Ga0207646_10405546 | 3300025922 | Bacteria | 1231 |
| 86 | Ga0207687_10000070 | 3300025927 | Bacteria | 77432 |
| 87 | Ga0207686_10075562 | 3300025934 | Bacteria | 2181 |
| 88 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 89 | Ga0207669_10000014 | 3300025937 | Bacteria | 129145 |
| 90 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 91 | Ga0207667_10366051 | 3300025949 | Bacteria | 1470 |
| 92 | Ga0207667_10968609 | 3300025949 | Bacteria | 839 |
| 93 | Ga0207651_10446376 | 3300025960 | Bacteria | 1109 |
| 94 | Ga0207677_10005215 | 3300026023 | Bacteria | 7032 |
| 95 | Ga0207708_10014365 | 3300026075 | Bacteria | 5925 |
| 96 | Ga0207702_10000202 | 3300026078 | Bacteria | 70333 |
| 97 | Ga0207702_10028659 | 3300026078 | Bacteria | 4629 |
| 98 | Ga0207641_10003078 | 3300026088 | Bacteria | 15029 |
| 99 | Ga0207675_100132209 | 3300026118 | Bacteria | 2366 |
| 100 | Ga0207683_10179935 | 3300026121 | Bacteria | 1917 |
| 101 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 102 | Ga0268264_10002647 | 3300028381 | Bacteria | 15644 |
| 103 | Ga0265326_10025820 | 3300028558 | Unclassified | 1675 |
| 104 | Ga0265319_1000020 | 3300028563 | Bacteria | 153921 |
| 105 | Ga0265319_1059245 | 3300028563 | Unclassified | 1245 |
| 106 | Ga0265334_10022069 | 3300028573 | Unclassified | 2598 |
| 107 | Ga0265338_10000222 | 3300028800 | Bacteria | 105765 |
| 108 | Ga0265338_10093657 | 3300028800 | Bacteria | 2474 |
| 109 | Ga0265324_10046705 | 3300029957 | Unclassified | 1490 |
| 110 | Ga0265320_10136331 | 3300031240 | Unclassified | 1113 |
| 111 | Ga0265325_10017278 | 3300031241 | Bacteria | 4011 |
| 112 | Ga0265340_10123965 | 3300031247 | Unclassified | 1187 |
| 113 | Ga0265339_10123020 | 3300031249 | Unclassified | 1332 |
| 114 | Ga0265331_10318526 | 3300031250 | Unclassified | 696 |
| 115 | Ga0265331_10432867 | 3300031250 | Bacteria | 591 |
| 116 | Ga0265316_10162263 | 3300031344 | Unclassified | 1670 |
| 117 | Ga0265316_10948241 | 3300031344 | Unclassified | 600 |
| 118 | Ga0307513_10319239 | 3300031456 | Bacteria | 1312 |
| 119 | Ga0307408_100016716 | 3300031548 | Bacteria | 4904 |
| 120 | Ga0307408_100184107 | 3300031548 | Bacteria | 1677 |
| 121 | Ga0307408_100206295 | 3300031548 | Bacteria | 1594 |
| 122 | Ga0265314_10138501 | 3300031711 | Unclassified | 1508 |
| 123 | Ga0265342_10170982 | 3300031712 | Unclassified | 1195 |
| 124 | Ga0307405_10009750 | 3300031731 | Bacteria | 4938 |
| 125 | Ga0307405_10038705 | 3300031731 | Bacteria | 2877 |
| 126 | Ga0307405_10066503 | 3300031731 | Bacteria | 2298 |
| 127 | Ga0307413_10003204 | 3300031824 | Bacteria | 6847 |
| 128 | Ga0307413_10006024 | 3300031824 | Bacteria | 5490 |
| 129 | Ga0307413_10851114 | 3300031824 | Bacteria | 770 |
| 130 | Ga0307410_10000513 | 3300031852 | Bacteria | 15726 |
| 131 | Ga0307410_10011358 | 3300031852 | Bacteria | 5090 |
| 132 | Ga0307410_10015456 | 3300031852 | Bacteria | 4528 |
| 133 | Ga0307410_11937798 | 3300031852 | Unclassified | 525 |
| 134 | Ga0307406_10000219 | 3300031901 | Bacteria | 34661 |
| 135 | Ga0307406_10003563 | 3300031901 | Bacteria | 8488 |
| 136 | Ga0307406_10014150 | 3300031901 | Bacteria | 4584 |
| 137 | Ga0307407_10002623 | 3300031903 | Bacteria | 7108 |
| 138 | Ga0307407_10007277 | 3300031903 | Bacteria | 5003 |
| 139 | Ga0307407_10023279 | 3300031903 | Bacteria | 3230 |
| 140 | Ga0307412_10209767 | 3300031911 | Unclassified | 1485 |
| 141 | Ga0307412_10538742 | 3300031911 | Bacteria | 978 |
| 142 | Ga0307412_11689209 | 3300031911 | Unclassified | 580 |
| 143 | Ga0307409_100000594 | 3300031995 | Bacteria | 15787 |
| 144 | Ga0307409_100002712 | 3300031995 | Bacteria | 9346 |
| 145 | Ga0307409_100027542 | 3300031995 | Bacteria | 4029 |
| 146 | Ga0307409_100203611 | 3300031995 | Bacteria | 1773 |
| 147 | Ga0307409_102741323 | 3300031995 | Unclassified | 521 |
| 148 | Ga0307416_100000297 | 3300032002 | Bacteria | 25889 |
| 149 | Ga0307416_100045411 | 3300032002 | Bacteria | 3459 |
| 150 | Ga0307414_10003969 | 3300032004 | Bacteria | 7980 |
| 151 | Ga0307414_10020640 | 3300032004 | Bacteria | 4111 |
| 152 | Ga0307411_10018504 | 3300032005 | Bacteria | 3998 |
| 153 | Ga0307411_10904103 | 3300032005 | Bacteria | 784 |
| 154 | Ga0307415_100001395 | 3300032126 | Bacteria | 11528 |
| 155 | Ga0307415_100021916 | 3300032126 | Bacteria | 3935 |
| 156 | Ga0307415_100039917 | 3300032126 | Bacteria | 3106 |
| 157 | Ga0307415_100085977 | 3300032126 | Unclassified | 2261 |
| 158 | Ga0395899_0759032 | 3300037312 | Bacteria | 603 |
| 159 | Ga0395900_0069174 | 3300037418 | Bacteria | 3628 |
| 160 | Ga0395900_1261468 | 3300037418 | Bacteria | 653 |
| 161 | Ga0395898_0072590 | 3300037466 | Bacteria | 3325 |
| 162 | Ga0395898_0176175 | 3300037466 | Bacteria | 2044 |
| 163 | Ga0395898_0834517 | 3300037466 | Bacteria | 861 |
| 164 | Ga0395905_0008247 | 3300037471 | Bacteria | 10289 |
| 165 | Ga0395905_0292922 | 3300037471 | Unclassified | 1514 |
| 166 | Ga0395905_0783954 | 3300037471 | Unclassified | 856 |
| 167 | Ga0436364_1030110 | 3300037853 | Unclassified | 1387 |
| 168 | Ga0395901_0049448 | 3300038443 | Bacteria | 4368 |
| 169 | Ga0395901_0574054 | 3300038443 | Bacteria | 1140 |
| 170 | Ga0395901_0747383 | 3300038443 | Unclassified | 971 |
| 171 | Ga0436365_0133759 | 3300039437 | Bacteria | 1448 |
| 172 | Ga0436365_0338100 | 3300039437 | Bacteria | 1539 |
| 173 | Ga0451800_0326761 | 3300041459 | Bacteria | 621 |
| 174 | Ga0451849_1576500 | 3300041505 | Bacteria | 1091 |
| 175 | Ga0439448_0140264 | 3300042005 | Unclassified | 836 |
| 176 | Ga0439448_0174744 | 3300042005 | Bacteria | 750 |
| 177 | Ga0439455_0039777 | 3300042012 | Unclassified | 1200 |
| 178 | Ga0439457_109835 | 3300042014 | Unclassified | 647 |
| 179 | Ga0439463_155428 | 3300042016 | Bacteria | 593 |
| 180 | Ga0450914_040453 | 3300042118 | Bacteria | 590 |
| 181 | Ga0450917_031644 | 3300042120 | Bacteria | 508 |
| 182 | Ga0439458_0051689 | 3300042157 | Unclassified | 1015 |
| 183 | Ga0439459_0055332 | 3300042438 | Bacteria | 883 |
| 184 | Ga0439440_0059465 | 3300042993 | Unclassified | 973 |
| 185 | Ga0495603_0000087 | 3300046455 | Bacteria | 41407 |
| 186 | Ga0495629_0000674 | 3300046459 | Bacteria | 27697 |
| 187 | Ga0495629_0221600 | 3300046459 | Bacteria | 1305 |
| 188 | Ga0495641_0058602 | 3300046461 | Bacteria | 1742 |
| 189 | Ga0495653_0005823 | 3300046463 | Bacteria | 10088 |
| 190 | Ga0495653_0334311 | 3300046463 | Unclassified | 978 |
| 191 | Ga0495605_0068459 | 3300046474 | Unclassified | 1682 |
| 192 | Ga0495584_0012341 | 3300046491 | Bacteria | 4361 |
| 193 | Ga0495585_0157566 | 3300046492 | Bacteria | 1180 |
| 194 | Ga0495608_0043825 | 3300046511 | Bacteria | 2989 |
| 195 | Ga0495620_0000041 | 3300046515 | Bacteria | 112605 |
| 196 | Ga0495620_0059920 | 3300046515 | Bacteria | 1589 |
| 197 | Ga0495628_0032156 | 3300046516 | Plasmid | 4238 |
| 198 | Ga0495630_0003541 | 3300046517 | Bacteria | 10873 |
| 199 | Ga0495630_0172761 | 3300046517 | Unclassified | 1647 |
| 200 | Ga0495631_0074787 | 3300046518 | Bacteria | 1462 |
| 201 | Ga0495637_0181078 | 3300046520 | Unclassified | 781 |
| 202 | Ga0495637_0341762 | 3300046520 | Unclassified | 526 |
| 203 | Ga0495644_0025372 | 3300046523 | Bacteria | 2250 |
| 204 | Ga0495652_0000171 | 3300046529 | Bacteria | 74097 |
| 205 | Ga0495640_0011620 | 3300046533 | Bacteria | 6764 |
| 206 | Ga0495586_0000254 | 3300046535 | Bacteria | 35015 |
| 207 | Ga0495621_0000872 | 3300046539 | Bacteria | 7702 |
| 208 | Ga0495645_0067874 | 3300046543 | Bacteria | 2575 |
| 209 | Ga0495656_0001348 | 3300046615 | Bacteria | 8010 |
| 210 | Ga0495634_0331776 | 3300046642 | Bacteria | 914 |
| 211 | Ga0495635_0052791 | 3300046663 | Bacteria | 2800 |
| 212 | Ga0495659_0018308 | 3300046664 | Bacteria | 2333 |
| 213 | Ga0495599_0016108 | 3300046678 | Bacteria | 4639 |
| 214 | Ga0495658_0742249 | 3300046683 | Bacteria | 629 |
| 215 | Ga0495624_0000013 | 3300046690 | Bacteria | 115278 |
| 216 | Ga0495624_0000123 | 3300046690 | Bacteria | 54291 |
| 217 | Ga0495589_0049013 | 3300046794 | Unclassified | 2090 |
| 218 | Ga0495604_0281527 | 3300047317 | Bacteria | 1123 |
| 219 | Ga0495636_0030403 | 3300047318 | Unclassified | 2208 |
| 220 | Ga0495676_0335354 | 3300047321 | Unclassified | 1013 |
| 221 | Ga0495685_094847 | 3300047447 | Unclassified | 987 |
| 222 | Ga0495602_0518571 | 3300048088 | Bacteria | 830 |
| 223 | Ga0496105_0894393 | 3300048908 | Unclassified | 670 |
| 224 | Ga0496106_0000013 | 3300048909 | Bacteria | 202263 |
| 225 | Ga0496106_0000307 | 3300048909 | Bacteria | 34433 |
| 226 | Ga0496106_0184947 | 3300048909 | Bacteria | 1655 |
| 227 | Ga0496107_0041652 | 3300048910 | Bacteria | 3298 |
| 228 | Ga0496107_0106039 | 3300048910 | Bacteria | 2063 |
| 229 | Ga0496107_0533945 | 3300048910 | Bacteria | 869 |
| 230 | Ga0496108_0012230 | 3300048911 | Bacteria | 6982 |
| 231 | Ga0496110_0017966 | 3300048913 | Bacteria | 5924 |
| 232 | Ga0496111_0130377 | 3300048914 | Unclassified | 1860 |
| 233 | Ga0496111_0251791 | 3300048914 | Bacteria | 1311 |
| 234 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 235 | Ga0496113_0031568 | 3300048916 | Bacteria | 3845 |
| 236 | Ga0496114_0000080 | 3300048917 | Bacteria | 68701 |
| 237 | Ga0496114_0035358 | 3300048917 | Bacteria | 4125 |
| 238 | Ga0496115_0000006 | 3300048918 | Bacteria | 252944 |
| 239 | Ga0496115_0000064 | 3300048918 | Bacteria | 99309 |
| 240 | Ga0496115_0000104 | 3300048918 | Bacteria | 79824 |
| 241 | Ga0496124_0197932 | 3300048927 | Unclassified | 1531 |
| 242 | Ga0501031_0000634 | 3300049568 | Bacteria | 20782 |
| 243 | Ga0501031_0015790 | 3300049568 | Bacteria | 4903 |
| 244 | Ga0501032_0001623 | 3300049569 | Bacteria | 17925 |
| 245 | Ga0501032_0021806 | 3300049569 | Bacteria | 4449 |
| 246 | Ga0501033_0004632 | 3300049570 | Bacteria | 11006 |
| 247 | Ga0501033_0011271 | 3300049570 | Bacteria | 6843 |
| 248 | Ga0501034_0089472 | 3300049571 | Bacteria | 3076 |
| 249 | Ga0501034_0544067 | 3300049571 | Unclassified | 1071 |
| 250 | Ga0501036_0002639 | 3300049572 | Bacteria | 14137 |
| 251 | Ga0501036_0003720 | 3300049572 | Bacteria | 12228 |
| 252 | Ga0501036_0274696 | 3300049572 | Unclassified | 1411 |
| 253 | Ga0501037_0007652 | 3300049573 | Bacteria | 7910 |
| 254 | Ga0501038_0001045 | 3300049574 | Bacteria | 25011 |
| 255 | Ga0501038_0003380 | 3300049574 | Bacteria | 14878 |
| 256 | Ga0501039_0011493 | 3300049575 | Bacteria | 6739 |
| 257 | Ga0501039_0019841 | 3300049575 | Bacteria | 5152 |
| 258 | Ga0501039_1079658 | 3300049575 | Unclassified | 622 |
| 259 | Ga0501040_0002587 | 3300049576 | Bacteria | 11671 |
| 260 | Ga0501040_0020350 | 3300049576 | Bacteria | 4420 |
| 261 | Ga0501040_0092854 | 3300049576 | Unclassified | 2099 |
| 262 | Ga0501040_0100420 | 3300049576 | Bacteria | 2017 |
| 263 | Ga0501041_0001015 | 3300049577 | Bacteria | 15334 |
| 264 | Ga0501042_0016093 | 3300049578 | Bacteria | 5132 |
| 265 | Ga0501042_0044217 | 3300049578 | Bacteria | 3172 |
| 266 | Ga0501042_0419083 | 3300049578 | Bacteria | 970 |
| 267 | Ga0501043_0001921 | 3300049579 | Bacteria | 17790 |
| 268 | Ga0501043_0187340 | 3300049579 | Bacteria | 1610 |
| 269 | Ga0501046_0003728 | 3300049580 | Bacteria | 13948 |
| 270 | Ga0501046_0004942 | 3300049580 | Bacteria | 11982 |
| 271 | Ga0501047_0004891 | 3300049581 | Bacteria | 12585 |
| 272 | Ga0501048_0003976 | 3300049582 | Bacteria | 11228 |
| 273 | Ga0501048_0007040 | 3300049582 | Bacteria | 8541 |
| 274 | Ga0501067_0120093 | 3300049583 | Bacteria | 1462 |
| 275 | Ga0501068_0035393 | 3300049584 | Bacteria | 2980 |
| 276 | Ga0501068_0068252 | 3300049584 | Bacteria | 2167 |
| 277 | Ga0501068_0109488 | 3300049584 | Unclassified | 1717 |
| 278 | Ga0501069_0157630 | 3300049585 | Bacteria | 1306 |
| 279 | Ga0501070_0003576 | 3300049586 | Bacteria | 13442 |
| 280 | Ga0501070_0312773 | 3300049586 | Bacteria | 1278 |
| 281 | Ga0501070_0377227 | 3300049586 | Bacteria | 1149 |
| 282 | Ga0501071_0006785 | 3300049587 | Bacteria | 7456 |
| 283 | Ga0501071_0008677 | 3300049587 | Bacteria | 6724 |
| 284 | Ga0501071_0850220 | 3300049587 | Unclassified | 704 |
| 285 | Ga0501072_0002888 | 3300049588 | Bacteria | 12930 |
| 286 | Ga0501073_0004093 | 3300049589 | Bacteria | 10940 |
| 287 | Ga0501073_0384107 | 3300049589 | Bacteria | 970 |
| 288 | Ga0501074_0008602 | 3300049590 | Bacteria | 7393 |
| 289 | Ga0501074_0199141 | 3300049590 | Bacteria | 1427 |
| 290 | Ga0501075_0012631 | 3300049591 | Bacteria | 6006 |
| 291 | Ga0501075_0461491 | 3300049591 | Bacteria | 969 |
| 292 | Ga0501076_0017201 | 3300049592 | Bacteria | 5491 |
| 293 | Ga0501076_0194796 | 3300049592 | Bacteria | 1654 |
| 294 | Ga0501077_0255270 | 3300049593 | Bacteria | 1115 |
| 295 | Ga0501079_0010534 | 3300049741 | Bacteria | 7030 |
| 296 | Ga0501079_0123906 | 3300049741 | Bacteria | 2010 |
| 297 | Ga0501079_0470152 | 3300049741 | Bacteria | 988 |
| 298 | Ga0501079_1460056 | 3300049741 | Unclassified | 538 |
| 299 | Ga0501080_0031754 | 3300049742 | Bacteria | 4921 |
| 300 | Ga0501080_0040307 | 3300049742 | Bacteria | 4356 |
| 301 | Ga0501080_0383072 | 3300049742 | Unclassified | 1267 |
| 302 | Ga0501081_0004550 | 3300049743 | Bacteria | 8905 |
| 303 | Ga0501083_0025050 | 3300049744 | Bacteria | 4132 |
| 304 | Ga0501035_0004356 | 3300049822 | Bacteria | 13442 |
| 305 | Ga0501035_0932094 | 3300049822 | Bacteria | 686 |
| 306 | Ga0501044_0005926 | 3300049823 | Bacteria | 13542 |
| 307 | Ga0501045_0003311 | 3300049824 | Bacteria | 11014 |
| 308 | Ga0501045_0017532 | 3300049824 | Bacteria | 5085 |
| 309 | Ga0501045_0251991 | 3300049824 | Bacteria | 1314 |
| 310 | Ga0501045_1140503 | 3300049824 | Unclassified | 570 |
| 311 | nmdc:mga0qj67_1305131_c1 | 3300050509 | Unclassified | 562 |
| 312 | nmdc:mga06r32_801989_c1 | 3300050510 | Bacteria | 902 |
| 313 | nmdc:mga08y16_1527529_c1 | 3300050511 | Bacteria | 627 |
| 314 | nmdc:mga0a205_5571_c1 | 3300050515 | Bacteria | 11344 |
| 315 | Ga0495601_0001597 | 3300053077 | Bacteria | 12512 |
| 316 | Ga0495601_0057565 | 3300053077 | Bacteria | 2462 |
| 317 | Ga0495612_0000058 | 3300053078 | Bacteria | 49549 |
| 318 | Ga0500566_0000785 | 3300053094 | Bacteria | 18011 |
| 319 | Ga0501084_0004034 | 3300054114 | Bacteria | 11960 |
| 320 | Ga0501084_0219432 | 3300054114 | Bacteria | 1604 |
| 321 | Ga0501084_0659660 | 3300054114 | Unclassified | 883 |
| 322 | Ga0501084_0820486 | 3300054114 | Bacteria | 783 |
| 323 | Ga0501082_0005667 | 3300060353 | Bacteria | 10839 |
| 324 | Ga0501082_0010661 | 3300060353 | Bacteria | 7911 |
| 325 | Ga0501082_0490561 | 3300060353 | Unclassified | 1074 |
| 326 | Ga0530510_0001730 | 3300061734 | Bacteria | 14843 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046463 | Ga0495653_0334311 | Ga0495653_0334311_228_581 | 114 |
| 2 | 3300005536 | Ga0070697_102002612 | Ga0070697_1020026121 | 123 |
| 3 | 3300047317 | Ga0495604_0281527 | Ga0495604_0281527_86_463 | 125 |
| 4 | 3300049742 | Ga0501080_0383072 | Ga0501080_0383072_138_530 | 125 |
| 5 | 3300005329 | Ga0070683_100057328 | Ga0070683_1000573284 | 126 |
| 6 | 3300005356 | Ga0070674_100000241 | Ga0070674_10000024111 | 126 |
| 7 | 3300005439 | Ga0070711_100031016 | Ga0070711_1000310164 | 126 |
| 8 | 3300005535 | Ga0070684_100015411 | Ga0070684_1000154113 | 126 |
| 9 | 3300005718 | Ga0068866_10000575 | Ga0068866_1000057512 | 126 |
| 10 | 3300005840 | Ga0068870_10248601 | Ga0068870_102486013 | 126 |
| 11 | 3300005841 | Ga0068863_100009454 | Ga0068863_1000094549 | 126 |
| 12 | 3300009176 | Ga0105242_10035255 | Ga0105242_100352553 | 126 |
| 13 | 3300013308 | Ga0157375_10725639 | Ga0157375_107256393 | 126 |
| 14 | 3300025899 | Ga0207642_10000227 | Ga0207642_1000022712 | 126 |
| 15 | 3300025916 | Ga0207663_10006102 | Ga0207663_100061028 | 126 |
| 16 | 3300025934 | Ga0207686_10075562 | Ga0207686_100755621 | 126 |
| 17 | 3300025937 | Ga0207669_10000014 | Ga0207669_10000014122 | 126 |
| 18 | 3300026088 | Ga0207641_10003078 | Ga0207641_100030788 | 126 |
| 19 | 3300042118 | Ga0450914_040453 | Ga0450914_040453_130_510 | 126 |
| 20 | 3300046455 | Ga0495603_0000087 | Ga0495603_0000087_26440_26829 | 126 |
| 21 | 3300046511 | Ga0495608_0043825 | Ga0495608_0043825_205_594 | 126 |
| 22 | 3300046663 | Ga0495635_0052791 | Ga0495635_0052791_1971_2360 | 126 |
| 23 | 3300046678 | Ga0495599_0016108 | Ga0495599_0016108_2793_3182 | 126 |
| 24 | 3300046690 | Ga0495624_0000013 | Ga0495624_0000013_112500_112889 | 126 |
| 25 | 3300048909 | Ga0496106_0000013 | Ga0496106_0000013_192764_193153 | 126 |
| 26 | 3300048910 | Ga0496107_0041652 | Ga0496107_0041652_220_609 | 126 |
| 27 | 3300048911 | Ga0496108_0012230 | Ga0496108_0012230_442_831 | 126 |
| 28 | 3300048913 | Ga0496110_0017966 | Ga0496110_0017966_5331_5720 | 126 |
| 29 | 3300048914 | Ga0496111_0251791 | Ga0496111_0251791_604_993 | 126 |
| 30 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_656040_656429 | 126 |
| 31 | 3300048917 | Ga0496114_0035358 | Ga0496114_0035358_3592_3981 | 126 |
| 32 | 3300053094 | Ga0500566_0000785 | Ga0500566_0000785_6949_7338 | 126 |
| 33 | 3300048908 | Ga0496105_0894393 | Ga0496105_0894393_55_438 | 127 |
| 34 | 3300049824 | Ga0501045_1140503 | Ga0501045_1140503_51_434 | 127 |
| 35 | 3300013296 | Ga0157374_10003614 | Ga0157374_1000361414 | 128 |
| 36 | 3300031712 | Ga0265342_10170982 | Ga0265342_101709823 | 128 |
| 37 | 3300041505 | Ga0451849_1576500 | Ga0451849_1576500_318_704 | 128 |
| 38 | 3300048917 | Ga0496114_0000080 | Ga0496114_0000080_18866_19252 | 128 |
| 39 | 3300048918 | Ga0496115_0000104 | Ga0496115_0000104_61089_61475 | 128 |
| 40 | 3300049741 | Ga0501079_0470152 | Ga0501079_0470152_190_576 | 128 |
| 41 | 3300049822 | Ga0501035_0932094 | Ga0501035_0932094_25_411 | 128 |
| 42 | 3300054114 | Ga0501084_0820486 | Ga0501084_0820486_277_663 | 128 |
| 43 | 3300049741 | Ga0501079_1460056 | Ga0501079_1460056_114_503 | 129 |
| 44 | 3300001977 | JGI24746J21847_1000010 | JGI24746J21847_100001013 | 130 |
| 45 | 3300003373 | JGI25407J50210_10006500 | JGI25407J50210_100065006 | 130 |
| 46 | 3300003373 | JGI25407J50210_10021998 | JGI25407J50210_100219981 | 130 |
| 47 | 3300003373 | JGI25407J50210_10101948 | JGI25407J50210_101019482 | 130 |
| 48 | 3300005327 | Ga0070658_10007065 | Ga0070658_100070655 | 130 |
| 49 | 3300005330 | Ga0070690_100174241 | Ga0070690_1001742413 | 130 |
| 50 | 3300005336 | Ga0070680_100130738 | Ga0070680_1001307383 | 130 |
| 51 | 3300005337 | Ga0070682_100657284 | Ga0070682_1006572842 | 130 |
| 52 | 3300005337 | Ga0070682_100964750 | Ga0070682_1009647502 | 130 |
| 53 | 3300005338 | Ga0068868_100001165 | Ga0068868_10000116518 | 130 |
| 54 | 3300005345 | Ga0070692_10214095 | Ga0070692_102140952 | 130 |
| 55 | 3300005356 | Ga0070674_100000002 | Ga0070674_10000000275 | 130 |
| 56 | 3300005364 | Ga0070673_100545966 | Ga0070673_1005459662 | 130 |
| 57 | 3300005439 | Ga0070711_100611969 | Ga0070711_1006119692 | 130 |
| 58 | 3300005458 | Ga0070681_10035936 | Ga0070681_100359366 | 130 |
| 59 | 3300005467 | Ga0070706_100513782 | Ga0070706_1005137822 | 130 |
| 60 | 3300005467 | Ga0070706_100525016 | Ga0070706_1005250162 | 130 |
| 61 | 3300005530 | Ga0070679_100324431 | Ga0070679_1003244312 | 130 |
| 62 | 3300005530 | Ga0070679_100412874 | Ga0070679_1004128742 | 130 |
| 63 | 3300005547 | Ga0070693_100436958 | Ga0070693_1004369582 | 130 |
| 64 | 3300005549 | Ga0070704_100141133 | Ga0070704_1001411333 | 130 |
| 65 | 3300005549 | Ga0070704_102004289 | Ga0070704_1020042891 | 130 |
| 66 | 3300005563 | Ga0068855_100423349 | Ga0068855_1004233493 | 130 |
| 67 | 3300005563 | Ga0068855_100959322 | Ga0068855_1009593222 | 130 |
| 68 | 3300005614 | Ga0068856_100041764 | Ga0068856_1000417646 | 130 |
| 69 | 3300005616 | Ga0068852_100000104 | Ga0068852_1000001049 | 130 |
| 70 | 3300005718 | Ga0068866_10000600 | Ga0068866_1000060019 | 130 |
| 71 | 3300005719 | Ga0068861_100095638 | Ga0068861_1000956385 | 130 |
| 72 | 3300005834 | Ga0068851_10007094 | Ga0068851_100070942 | 130 |
| 73 | 3300005843 | Ga0068860_100003597 | Ga0068860_1000035974 | 130 |
| 74 | 3300005937 | Ga0081455_11039556 | Ga0081455_110395562 | 130 |
| 75 | 3300005981 | Ga0081538_10005519 | Ga0081538_100055192 | 130 |
| 76 | 3300005981 | Ga0081538_10010996 | Ga0081538_100109964 | 130 |
| 77 | 3300005981 | Ga0081538_10011153 | Ga0081538_100111536 | 130 |
| 78 | 3300005981 | Ga0081538_10020661 | Ga0081538_100206613 | 130 |
| 79 | 3300005981 | Ga0081538_10058734 | Ga0081538_100587342 | 130 |
| 80 | 3300005983 | Ga0081540_1015551 | Ga0081540_10155515 | 130 |
| 81 | 3300005985 | Ga0081539_10018669 | Ga0081539_100186692 | 130 |
| 82 | 3300005985 | Ga0081539_10146240 | Ga0081539_101462403 | 130 |
| 83 | 3300006028 | Ga0070717_10581756 | Ga0070717_105817562 | 130 |
| 84 | 3300006163 | Ga0070715_10000008 | Ga0070715_1000000811 | 130 |
| 85 | 3300006847 | Ga0075431_100583687 | Ga0075431_1005836873 | 130 |
| 86 | 3300009094 | Ga0111539_10413010 | Ga0111539_104130104 | 130 |
| 87 | 3300009094 | Ga0111539_11741238 | Ga0111539_117412382 | 130 |
| 88 | 3300009098 | Ga0105245_10000117 | Ga0105245_1000011737 | 130 |
| 89 | 3300009177 | Ga0105248_10000037 | Ga0105248_10000037128 | 130 |
| 90 | 3300009545 | Ga0105237_10002855 | Ga0105237_1000285511 | 130 |
| 91 | 3300013104 | Ga0157370_10083061 | Ga0157370_100830613 | 130 |
| 92 | 3300013105 | Ga0157369_10000051 | Ga0157369_10000051141 | 130 |
| 93 | 3300013306 | Ga0163162_10193867 | Ga0163162_101938671 | 130 |
| 94 | 3300013308 | Ga0157375_10352197 | Ga0157375_103521974 | 130 |
| 95 | 3300014325 | Ga0163163_10148946 | Ga0163163_101489465 | 130 |
| 96 | 3300014326 | Ga0157380_10252213 | Ga0157380_102522132 | 130 |
| 97 | 3300014326 | Ga0157380_10356805 | Ga0157380_103568054 | 130 |
| 98 | 3300014497 | Ga0182008_10229501 | Ga0182008_102295012 | 130 |
| 99 | 3300014745 | Ga0157377_10644205 | Ga0157377_106442051 | 130 |
| 100 | 3300020069 | Ga0197907_10108656 | Ga0197907_101086563 | 130 |
| 101 | 3300020081 | Ga0206354_10857453 | Ga0206354_108574533 | 130 |
| 102 | 3300020082 | Ga0206353_11593059 | Ga0206353_115930593 | 130 |
| 103 | 3300020610 | Ga0154015_1134837 | Ga0154015_11348372 | 130 |
| 104 | 3300025899 | Ga0207642_10000108 | Ga0207642_1000010818 | 130 |
| 105 | 3300025905 | Ga0207685_10000012 | Ga0207685_1000001211 | 130 |
| 106 | 3300025909 | Ga0207705_10861420 | Ga0207705_108614201 | 130 |
| 107 | 3300025910 | Ga0207684_10593520 | Ga0207684_105935202 | 130 |
| 108 | 3300025912 | Ga0207707_10206821 | Ga0207707_102068212 | 130 |
| 109 | 3300025912 | Ga0207707_10657068 | Ga0207707_106570683 | 130 |
| 110 | 3300025914 | Ga0207671_10000406 | Ga0207671_1000040655 | 130 |
| 111 | 3300025916 | Ga0207663_10372457 | Ga0207663_103724571 | 130 |
| 112 | 3300025917 | Ga0207660_10077080 | Ga0207660_100770803 | 130 |
| 113 | 3300025921 | Ga0207652_10226323 | Ga0207652_102263233 | 130 |
| 114 | 3300025921 | Ga0207652_11283797 | Ga0207652_112837972 | 130 |
| 115 | 3300025922 | Ga0207646_10405546 | Ga0207646_104055462 | 130 |
| 116 | 3300025927 | Ga0207687_10000070 | Ga0207687_1000007058 | 130 |
| 117 | 3300025937 | Ga0207669_10000003 | Ga0207669_10000003219 | 130 |
| 118 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011415 | 130 |
| 119 | 3300025949 | Ga0207667_10366051 | Ga0207667_103660513 | 130 |
| 120 | 3300025949 | Ga0207667_10968609 | Ga0207667_109686092 | 130 |
| 121 | 3300025960 | Ga0207651_10446376 | Ga0207651_104463763 | 130 |
| 122 | 3300026023 | Ga0207677_10005215 | Ga0207677_100052155 | 130 |
| 123 | 3300026075 | Ga0207708_10014365 | Ga0207708_100143652 | 130 |
| 124 | 3300026078 | Ga0207702_10000202 | Ga0207702_1000020267 | 130 |
| 125 | 3300026078 | Ga0207702_10028659 | Ga0207702_100286595 | 130 |
| 126 | 3300026118 | Ga0207675_100132209 | Ga0207675_1001322095 | 130 |
| 127 | 3300026121 | Ga0207683_10179935 | Ga0207683_101799352 | 130 |
| 128 | 3300026142 | Ga0207698_10000015 | Ga0207698_1000001574 | 130 |
| 129 | 3300028381 | Ga0268264_10002647 | Ga0268264_1000264716 | 130 |
| 130 | 3300028558 | Ga0265326_10025820 | Ga0265326_100258202 | 130 |
| 131 | 3300028563 | Ga0265319_1000020 | Ga0265319_100002098 | 130 |
| 132 | 3300028563 | Ga0265319_1059245 | Ga0265319_10592452 | 130 |
| 133 | 3300028573 | Ga0265334_10022069 | Ga0265334_100220692 | 130 |
| 134 | 3300028800 | Ga0265338_10000222 | Ga0265338_1000022288 | 130 |
| 135 | 3300028800 | Ga0265338_10093657 | Ga0265338_100936574 | 130 |
| 136 | 3300029957 | Ga0265324_10046705 | Ga0265324_100467052 | 130 |
| 137 | 3300031240 | Ga0265320_10136331 | Ga0265320_101363312 | 130 |
| 138 | 3300031241 | Ga0265325_10017278 | Ga0265325_100172782 | 130 |
| 139 | 3300031247 | Ga0265340_10123965 | Ga0265340_101239652 | 130 |
| 140 | 3300031249 | Ga0265339_10123020 | Ga0265339_101230202 | 130 |
| 141 | 3300031250 | Ga0265331_10318526 | Ga0265331_103185262 | 130 |
| 142 | 3300031250 | Ga0265331_10432867 | Ga0265331_104328672 | 130 |
| 143 | 3300031344 | Ga0265316_10162263 | Ga0265316_101622632 | 130 |
| 144 | 3300031344 | Ga0265316_10948241 | Ga0265316_109482412 | 130 |
| 145 | 3300031456 | Ga0307513_10319239 | Ga0307513_103192392 | 130 |
| 146 | 3300031548 | Ga0307408_100016716 | Ga0307408_1000167165 | 130 |
| 147 | 3300031548 | Ga0307408_100184107 | Ga0307408_1001841073 | 130 |
| 148 | 3300031548 | Ga0307408_100206295 | Ga0307408_1002062953 | 130 |
| 149 | 3300031711 | Ga0265314_10138501 | Ga0265314_101385012 | 130 |
| 150 | 3300031731 | Ga0307405_10009750 | Ga0307405_100097502 | 130 |
| 151 | 3300031731 | Ga0307405_10038705 | Ga0307405_100387053 | 130 |
| 152 | 3300031731 | Ga0307405_10066503 | Ga0307405_100665032 | 130 |
| 153 | 3300031824 | Ga0307413_10003204 | Ga0307413_100032044 | 130 |
| 154 | 3300031824 | Ga0307413_10006024 | Ga0307413_100060246 | 130 |
| 155 | 3300031824 | Ga0307413_10851114 | Ga0307413_108511142 | 130 |
| 156 | 3300031852 | Ga0307410_10000513 | Ga0307410_100005136 | 130 |
| 157 | 3300031852 | Ga0307410_10011358 | Ga0307410_100113583 | 130 |
| 158 | 3300031852 | Ga0307410_10015456 | Ga0307410_100154563 | 130 |
| 159 | 3300031852 | Ga0307410_11937798 | Ga0307410_119377981 | 130 |
| 160 | 3300031901 | Ga0307406_10000219 | Ga0307406_1000021931 | 130 |
| 161 | 3300031901 | Ga0307406_10003563 | Ga0307406_100035637 | 130 |
| 162 | 3300031901 | Ga0307406_10014150 | Ga0307406_100141505 | 130 |
| 163 | 3300031903 | Ga0307407_10002623 | Ga0307407_100026237 | 130 |
| 164 | 3300031903 | Ga0307407_10007277 | Ga0307407_100072773 | 130 |
| 165 | 3300031903 | Ga0307407_10023279 | Ga0307407_100232794 | 130 |
| 166 | 3300031911 | Ga0307412_10209767 | Ga0307412_102097672 | 130 |
| 167 | 3300031911 | Ga0307412_10538742 | Ga0307412_105387422 | 130 |
| 168 | 3300031911 | Ga0307412_11689209 | Ga0307412_116892091 | 130 |
| 169 | 3300031995 | Ga0307409_100000594 | Ga0307409_10000059417 | 130 |
| 170 | 3300031995 | Ga0307409_100002712 | Ga0307409_1000027125 | 130 |
| 171 | 3300031995 | Ga0307409_100027542 | Ga0307409_1000275424 | 130 |
| 172 | 3300031995 | Ga0307409_100203611 | Ga0307409_1002036112 | 130 |
| 173 | 3300031995 | Ga0307409_102741323 | Ga0307409_1027413232 | 130 |
| 174 | 3300032002 | Ga0307416_100000297 | Ga0307416_1000002973 | 130 |
| 175 | 3300032002 | Ga0307416_100045411 | Ga0307416_1000454113 | 130 |
| 176 | 3300032004 | Ga0307414_10003969 | Ga0307414_100039698 | 130 |
| 177 | 3300032004 | Ga0307414_10020640 | Ga0307414_100206403 | 130 |
| 178 | 3300032005 | Ga0307411_10018504 | Ga0307411_100185043 | 130 |
| 179 | 3300032005 | Ga0307411_10904103 | Ga0307411_109041031 | 130 |
| 180 | 3300032126 | Ga0307415_100001395 | Ga0307415_1000013959 | 130 |
| 181 | 3300032126 | Ga0307415_100021916 | Ga0307415_1000219161 | 130 |
| 182 | 3300032126 | Ga0307415_100039917 | Ga0307415_1000399174 | 130 |
| 183 | 3300032126 | Ga0307415_100085977 | Ga0307415_1000859773 | 130 |
| 184 | 3300037312 | Ga0395899_0759032 | Ga0395899_0759032_14_406 | 130 |
| 185 | 3300037418 | Ga0395900_0069174 | Ga0395900_0069174_1731_2123 | 130 |
| 186 | 3300037418 | Ga0395900_1261468 | Ga0395900_1261468_58_450 | 130 |
| 187 | 3300037466 | Ga0395898_0072590 | Ga0395898_0072590_453_845 | 130 |
| 188 | 3300037466 | Ga0395898_0176175 | Ga0395898_0176175_950_1342 | 130 |
| 189 | 3300037466 | Ga0395898_0834517 | Ga0395898_0834517_21_413 | 130 |
| 190 | 3300037471 | Ga0395905_0008247 | Ga0395905_0008247_8572_8964 | 130 |
| 191 | 3300037471 | Ga0395905_0292922 | Ga0395905_0292922_193_585 | 130 |
| 192 | 3300037471 | Ga0395905_0783954 | Ga0395905_0783954_229_621 | 130 |
| 193 | 3300037853 | Ga0436364_1030110 | Ga0436364_1030110_967_1359 | 130 |
| 194 | 3300038443 | Ga0395901_0049448 | Ga0395901_0049448_291_683 | 130 |
| 195 | 3300038443 | Ga0395901_0574054 | Ga0395901_0574054_543_935 | 130 |
| 196 | 3300038443 | Ga0395901_0747383 | Ga0395901_0747383_151_543 | 130 |
| 197 | 3300039437 | Ga0436365_0133759 | Ga0436365_0133759_402_794 | 130 |
| 198 | 3300039437 | Ga0436365_0338100 | Ga0436365_0338100_240_632 | 130 |
| 199 | 3300041459 | Ga0451800_0326761 | Ga0451800_0326761_57_449 | 130 |
| 200 | 3300042005 | Ga0439448_0140264 | Ga0439448_0140264_299_691 | 130 |
| 201 | 3300042005 | Ga0439448_0174744 | Ga0439448_0174744_195_587 | 130 |
| 202 | 3300042012 | Ga0439455_0039777 | Ga0439455_0039777_666_1058 | 130 |
| 203 | 3300042014 | Ga0439457_109835 | Ga0439457_109835_227_619 | 130 |
| 204 | 3300042016 | Ga0439463_155428 | Ga0439463_155428_116_508 | 130 |
| 205 | 3300042120 | Ga0450917_031644 | Ga0450917_031644_91_483 | 130 |
| 206 | 3300042157 | Ga0439458_0051689 | Ga0439458_0051689_550_942 | 130 |
| 207 | 3300042438 | Ga0439459_0055332 | Ga0439459_0055332_202_594 | 130 |
| 208 | 3300042993 | Ga0439440_0059465 | Ga0439440_0059465_405_797 | 130 |
| 209 | 3300046459 | Ga0495629_0000674 | Ga0495629_0000674_26071_26463 | 130 |
| 210 | 3300046459 | Ga0495629_0221600 | Ga0495629_0221600_382_774 | 130 |
| 211 | 3300046461 | Ga0495641_0058602 | Ga0495641_0058602_325_717 | 130 |
| 212 | 3300046463 | Ga0495653_0005823 | Ga0495653_0005823_1238_1630 | 130 |
| 213 | 3300046474 | Ga0495605_0068459 | Ga0495605_0068459_869_1261 | 130 |
| 214 | 3300046491 | Ga0495584_0012341 | Ga0495584_0012341_817_1209 | 130 |
| 215 | 3300046492 | Ga0495585_0157566 | Ga0495585_0157566_332_724 | 130 |
| 216 | 3300046515 | Ga0495620_0000041 | Ga0495620_0000041_66152_66562 | 130 |
| 217 | 3300046515 | Ga0495620_0059920 | Ga0495620_0059920_295_687 | 130 |
| 218 | 3300046516 | Ga0495628_0032156 | Ga0495628_0032156_2628_3020 | 130 |
| 219 | 3300046517 | Ga0495630_0003541 | Ga0495630_0003541_1272_1682 | 130 |
| 220 | 3300046517 | Ga0495630_0172761 | Ga0495630_0172761_80_472 | 130 |
| 221 | 3300046518 | Ga0495631_0074787 | Ga0495631_0074787_624_1016 | 130 |
| 222 | 3300046520 | Ga0495637_0181078 | Ga0495637_0181078_166_558 | 130 |
| 223 | 3300046520 | Ga0495637_0341762 | Ga0495637_0341762_89_481 | 130 |
| 224 | 3300046523 | Ga0495644_0025372 | Ga0495644_0025372_1524_1916 | 130 |
| 225 | 3300046529 | Ga0495652_0000171 | Ga0495652_0000171_61460_61852 | 130 |
| 226 | 3300046533 | Ga0495640_0011620 | Ga0495640_0011620_5800_6192 | 130 |
| 227 | 3300046535 | Ga0495586_0000254 | Ga0495586_0000254_31141_31533 | 130 |
| 228 | 3300046539 | Ga0495621_0000872 | Ga0495621_0000872_3097_3489 | 130 |
| 229 | 3300046543 | Ga0495645_0067874 | Ga0495645_0067874_490_882 | 130 |
| 230 | 3300046615 | Ga0495656_0001348 | Ga0495656_0001348_1166_1558 | 130 |
| 231 | 3300046642 | Ga0495634_0331776 | Ga0495634_0331776_460_852 | 130 |
| 232 | 3300046664 | Ga0495659_0018308 | Ga0495659_0018308_869_1261 | 130 |
| 233 | 3300046683 | Ga0495658_0742249 | Ga0495658_0742249_152_556 | 130 |
| 234 | 3300046690 | Ga0495624_0000123 | Ga0495624_0000123_30631_31023 | 130 |
| 235 | 3300046794 | Ga0495589_0049013 | Ga0495589_0049013_1326_1718 | 130 |
| 236 | 3300047318 | Ga0495636_0030403 | Ga0495636_0030403_100_492 | 130 |
| 237 | 3300047321 | Ga0495676_0335354 | Ga0495676_0335354_533_925 | 130 |
| 238 | 3300047447 | Ga0495685_094847 | Ga0495685_094847_54_446 | 130 |
| 239 | 3300048088 | Ga0495602_0518571 | Ga0495602_0518571_131_523 | 130 |
| 240 | 3300048909 | Ga0496106_0000307 | Ga0496106_0000307_18663_19055 | 130 |
| 241 | 3300048909 | Ga0496106_0184947 | Ga0496106_0184947_388_792 | 130 |
| 242 | 3300048910 | Ga0496107_0106039 | Ga0496107_0106039_257_649 | 130 |
| 243 | 3300048910 | Ga0496107_0533945 | Ga0496107_0533945_345_749 | 130 |
| 244 | 3300048914 | Ga0496111_0130377 | Ga0496111_0130377_987_1379 | 130 |
| 245 | 3300048916 | Ga0496113_0031568 | Ga0496113_0031568_2039_2431 | 130 |
| 246 | 3300048918 | Ga0496115_0000006 | Ga0496115_0000006_243735_244127 | 130 |
| 247 | 3300048918 | Ga0496115_0000064 | Ga0496115_0000064_83842_84234 | 130 |
| 248 | 3300048927 | Ga0496124_0197932 | Ga0496124_0197932_801_1193 | 130 |
| 249 | 3300049568 | Ga0501031_0000634 | Ga0501031_0000634_11900_12292 | 130 |
| 250 | 3300049568 | Ga0501031_0015790 | Ga0501031_0015790_2589_2981 | 130 |
| 251 | 3300049569 | Ga0501032_0001623 | Ga0501032_0001623_5633_6025 | 130 |
| 252 | 3300049569 | Ga0501032_0021806 | Ga0501032_0021806_70_462 | 130 |
| 253 | 3300049570 | Ga0501033_0004632 | Ga0501033_0004632_5563_5955 | 130 |
| 254 | 3300049570 | Ga0501033_0011271 | Ga0501033_0011271_5302_5694 | 130 |
| 255 | 3300049571 | Ga0501034_0089472 | Ga0501034_0089472_1150_1542 | 130 |
| 256 | 3300049571 | Ga0501034_0544067 | Ga0501034_0544067_326_718 | 130 |
| 257 | 3300049572 | Ga0501036_0002639 | Ga0501036_0002639_5253_5645 | 130 |
| 258 | 3300049572 | Ga0501036_0003720 | Ga0501036_0003720_2355_2747 | 130 |
| 259 | 3300049572 | Ga0501036_0274696 | Ga0501036_0274696_189_581 | 130 |
| 260 | 3300049573 | Ga0501037_0007652 | Ga0501037_0007652_2223_2615 | 130 |
| 261 | 3300049574 | Ga0501038_0001045 | Ga0501038_0001045_11873_12265 | 130 |
| 262 | 3300049574 | Ga0501038_0003380 | Ga0501038_0003380_9390_9782 | 130 |
| 263 | 3300049575 | Ga0501039_0011493 | Ga0501039_0011493_2003_2395 | 130 |
| 264 | 3300049575 | Ga0501039_0019841 | Ga0501039_0019841_1456_1848 | 130 |
| 265 | 3300049575 | Ga0501039_1079658 | Ga0501039_1079658_128_520 | 130 |
| 266 | 3300049576 | Ga0501040_0002587 | Ga0501040_0002587_2186_2578 | 130 |
| 267 | 3300049576 | Ga0501040_0020350 | Ga0501040_0020350_2413_2805 | 130 |
| 268 | 3300049576 | Ga0501040_0092854 | Ga0501040_0092854_412_804 | 130 |
| 269 | 3300049576 | Ga0501040_0100420 | Ga0501040_0100420_107_499 | 130 |
| 270 | 3300049577 | Ga0501041_0001015 | Ga0501041_0001015_9874_10266 | 130 |
| 271 | 3300049578 | Ga0501042_0016093 | Ga0501042_0016093_4312_4704 | 130 |
| 272 | 3300049578 | Ga0501042_0044217 | Ga0501042_0044217_1120_1512 | 130 |
| 273 | 3300049578 | Ga0501042_0419083 | Ga0501042_0419083_426_818 | 130 |
| 274 | 3300049579 | Ga0501043_0001921 | Ga0501043_0001921_5498_5890 | 130 |
| 275 | 3300049579 | Ga0501043_0187340 | Ga0501043_0187340_32_424 | 130 |
| 276 | 3300049580 | Ga0501046_0003728 | Ga0501046_0003728_11901_12293 | 130 |
| 277 | 3300049580 | Ga0501046_0004942 | Ga0501046_0004942_9403_9795 | 130 |
| 278 | 3300049581 | Ga0501047_0004891 | Ga0501047_0004891_293_685 | 130 |
| 279 | 3300049582 | Ga0501048_0003976 | Ga0501048_0003976_5520_5912 | 130 |
| 280 | 3300049582 | Ga0501048_0007040 | Ga0501048_0007040_5085_5477 | 130 |
| 281 | 3300049583 | Ga0501067_0120093 | Ga0501067_0120093_240_632 | 130 |
| 282 | 3300049584 | Ga0501068_0035393 | Ga0501068_0035393_1255_1647 | 130 |
| 283 | 3300049584 | Ga0501068_0068252 | Ga0501068_0068252_1103_1495 | 130 |
| 284 | 3300049584 | Ga0501068_0109488 | Ga0501068_0109488_1299_1691 | 130 |
| 285 | 3300049585 | Ga0501069_0157630 | Ga0501069_0157630_44_436 | 130 |
| 286 | 3300049586 | Ga0501070_0003576 | Ga0501070_0003576_1150_1542 | 130 |
| 287 | 3300049586 | Ga0501070_0312773 | Ga0501070_0312773_190_582 | 130 |
| 288 | 3300049586 | Ga0501070_0377227 | Ga0501070_0377227_109_501 | 130 |
| 289 | 3300049587 | Ga0501071_0006785 | Ga0501071_0006785_1502_1894 | 130 |
| 290 | 3300049587 | Ga0501071_0008677 | Ga0501071_0008677_2339_2731 | 130 |
| 291 | 3300049587 | Ga0501071_0850220 | Ga0501071_0850220_132_524 | 130 |
| 292 | 3300049588 | Ga0501072_0002888 | Ga0501072_0002888_9278_9670 | 130 |
| 293 | 3300049589 | Ga0501073_0004093 | Ga0501073_0004093_5025_5417 | 130 |
| 294 | 3300049589 | Ga0501073_0384107 | Ga0501073_0384107_409_801 | 130 |
| 295 | 3300049590 | Ga0501074_0008602 | Ga0501074_0008602_5528_5920 | 130 |
| 296 | 3300049590 | Ga0501074_0199141 | Ga0501074_0199141_312_704 | 130 |
| 297 | 3300049591 | Ga0501075_0012631 | Ga0501075_0012631_584_976 | 130 |
| 298 | 3300049591 | Ga0501075_0461491 | Ga0501075_0461491_216_608 | 130 |
| 299 | 3300049592 | Ga0501076_0017201 | Ga0501076_0017201_2162_2554 | 130 |
| 300 | 3300049592 | Ga0501076_0194796 | Ga0501076_0194796_932_1324 | 130 |
| 301 | 3300049593 | Ga0501077_0255270 | Ga0501077_0255270_307_699 | 130 |
| 302 | 3300049741 | Ga0501079_0010534 | Ga0501079_0010534_1777_2169 | 130 |
| 303 | 3300049741 | Ga0501079_0123906 | Ga0501079_0123906_1188_1580 | 130 |
| 304 | 3300049742 | Ga0501080_0031754 | Ga0501080_0031754_3657_4049 | 130 |
| 305 | 3300049742 | Ga0501080_0040307 | Ga0501080_0040307_1134_1526 | 130 |
| 306 | 3300049743 | Ga0501081_0004550 | Ga0501081_0004550_2203_2595 | 130 |
| 307 | 3300049744 | Ga0501083_0025050 | Ga0501083_0025050_2968_3360 | 130 |
| 308 | 3300049822 | Ga0501035_0004356 | Ga0501035_0004356_11901_12293 | 130 |
| 309 | 3300049823 | Ga0501044_0005926 | Ga0501044_0005926_1250_1642 | 130 |
| 310 | 3300049824 | Ga0501045_0003311 | Ga0501045_0003311_8434_8826 | 130 |
| 311 | 3300049824 | Ga0501045_0017532 | Ga0501045_0017532_53_445 | 130 |
| 312 | 3300049824 | Ga0501045_0251991 | Ga0501045_0251991_205_597 | 130 |
| 313 | 3300050509 | nmdc:mga0qj67_1305131_c1 | nmdc:mga0qj67_1305131_c1_139_531 | 130 |
| 314 | 3300050510 | nmdc:mga06r32_801989_c1 | nmdc:mga06r32_801989_c1_308_700 | 130 |
| 315 | 3300050511 | nmdc:mga08y16_1527529_c1 | nmdc:mga08y16_1527529_c1_136_534 | 130 |
| 316 | 3300050515 | nmdc:mga0a205_5571_c1 | nmdc:mga0a205_5571_c1_10678_11070 | 130 |
| 317 | 3300053077 | Ga0495601_0001597 | Ga0495601_0001597_3382_3774 | 130 |
| 318 | 3300053077 | Ga0495601_0057565 | Ga0495601_0057565_369_761 | 130 |
| 319 | 3300053078 | Ga0495612_0000058 | Ga0495612_0000058_6606_6998 | 130 |
| 320 | 3300054114 | Ga0501084_0004034 | Ga0501084_0004034_9400_9792 | 130 |
| 321 | 3300054114 | Ga0501084_0219432 | Ga0501084_0219432_406_798 | 130 |
| 322 | 3300054114 | Ga0501084_0659660 | Ga0501084_0659660_250_642 | 130 |
| 323 | 3300060353 | Ga0501082_0005667 | Ga0501082_0005667_2169_2561 | 130 |
| 324 | 3300060353 | Ga0501082_0010661 | Ga0501082_0010661_5214_5606 | 130 |
| 325 | 3300060353 | Ga0501082_0490561 | Ga0501082_0490561_554_946 | 130 |
| 326 | 3300061734 | Ga0530510_0001730 | Ga0530510_0001730_9460_9852 | 130 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7by2-assembly1.cif.gz_B-2 | toxin-antitoxin complex from klebsiella pneumoniae | 0.7763 | 4 | 115 |
| 5ecw-assembly1.cif.gz_A | structure of the shigella flexneri vapc mutant d7a | 0.7756 | 1 | 119 |
| 2fe1-assembly1.cif.gz_A-2 | crystal structure of pae0151 from pyrobaculum aerophilum | 0.7709 | 3 | 128 |
| 5ed0-assembly2.cif.gz_B | structure of the shigella flexneri vapc mutant d7n | 0.7589 | 1 | 118 |
| 6sd6-assembly1.cif.gz_C | structure of vapbc from shigella sonnei | 0.7488 | 2 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71623_4_126_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9801 | 4 | 125 | 3.40.50.1010 |
| af_P71623_4_126_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9645 | 4 | 125 | 3.40.50.1010 |
| af_P9WF57_1_130_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.774 | 4 | 119 | 3.40.50.1010 |
| 2fe1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.7709 | 3 | 128 | 3.40.50.1010 |
| af_O50411_2_124_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.7612 | 2 | 124 | 3.40.50.1010 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7I7NM26-F1-model_v4 | PIN domain-containing protein | 0.9822 | 1 | 88 |
GO:0004518
|
| AF-P71623-F1-model_v4 | Ribonuclease VapC22 (RNase VapC22) (EC 3.1.-.-) (Toxin VapC22) | 0.9801 | 1 | 130 |
GO:0000287
GO:0004540 GO:0005576 GO:0017148 |
| AF-A0A7V9JZP3-F1-model_v4 | PIN domain-containing protein | 0.9765 | 1 | 101 |
GO:0004518
|
| AF-A0A7V9JZP3-F1-model_v4 | PIN domain-containing protein | 0.9579 | 1 | 101 |
GO:0004518
|
| AF-A0A2V9HBF3-F1-model_v4 | PIN domain-containing protein | 0.9422 | 3 | 104 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar