F408270

General Info

Members Datasets Scaffolds Average Seq Length
326 197 652 232

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10403461|Ga0111539_104034612
Length 262
Sequence MEQTGGTPTPGGVIPPTCVIAVTPRLTGVVKSSVSKLVPKVRSVPGASRGAEYSASTKRALIDVAEELFTDNGYANASLDTIVAGAQVTKGALYHHFSGKQALFEAVFERIEADAAQTIQKAIKGTRDPWKKALAGVEAFMMIVQQPRYRRIVIQEGPAVLGYERFREQEERTTYANVVEIVRAVLTAGTWELDEEMLQTFARIFFGTMSAAGEVVATATDTELAAQRVETAVGFLLSGVQALVENGGELPAVPGREPDQDE

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
100 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
135 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
160 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
177 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
178 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
179 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
184 2643221576 Nocardioides sp. Root614 Isolate Unclassified
185 2643221590 Nocardioides sp. Root682 Isolate Unclassified
186 2643221604 Nocardioides sp. Root190 Isolate Unclassified
187 2643221615 Nocardioides sp. Root224 Isolate Unclassified
188 2643221617 Nocardioides sp. Root79 Isolate Unclassified
189 2643221620 Nocardioides sp. Root240 Isolate Unclassified
190 2643221641 Nocardioides sp. Root122 Isolate Unclassified
191 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
192 2738541305 Nocardioides sp. CF167 Isolate Unclassified
193 2739367898 Nocardioides sp. CF479 Isolate Unclassified
194 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
195 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
196 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
197 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 95.4
Metatranscriptomes 0.31
Isolates 4.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.31
Bulb 0
Endosphere 18.71
Nodule 0
Rhizoplane 7.36
Rhizosphere 67.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10403461 3300009094 Bacteria 1592
2 JGI24735J21928_10110893 3300002067 Bacteria 789
3 Ga0070683_100001861 3300005329 Bacteria 16469
4 Ga0070683_100004570 3300005329 Bacteria 11422
5 Ga0070690_100219630 3300005330 Bacteria 1331
6 Ga0068869_100252839 3300005334 Bacteria 1408
7 Ga0070666_10350479 3300005335 Bacteria 1056
8 Ga0070680_100112933 3300005336 Bacteria 2262
9 Ga0070682_100025973 3300005337 Bacteria 3500
10 Ga0070682_100080471 3300005337 Bacteria 2107
11 Ga0068868_100546722 3300005338 Bacteria 1020
12 Ga0070660_100227884 3300005339 Bacteria 1516
13 Ga0070661_100134981 3300005344 Bacteria 1856
14 Ga0070692_10059995 3300005345 Bacteria 2001
15 Ga0070659_100116015 3300005366 Bacteria 2165
16 Ga0070667_100087047 3300005367 Bacteria 2681
17 Ga0070667_100250857 3300005367 Bacteria 1582
18 Ga0070700_100008556 3300005441 Bacteria 5572
19 Ga0070678_100106049 3300005456 Bacteria 2189
20 Ga0068867_100385615 3300005459 Bacteria 1178
21 Ga0070679_100302537 3300005530 Bacteria 1550
22 Ga0070684_100000939 3300005535 Bacteria 20742
23 Ga0070684_100107918 3300005535 Bacteria 2494
24 Ga0068853_100810157 3300005539 Bacteria 897
25 Ga0070693_100119709 3300005547 Bacteria 1631
26 Ga0068855_100277803 3300005563 Bacteria 1861
27 Ga0070664_100221736 3300005564 Bacteria 1692
28 Ga0068857_100003902 3300005577 Bacteria 12553
29 Ga0068856_100698131 3300005614 Bacteria 1035
30 Ga0070702_100196497 3300005615 Bacteria 1332
31 Ga0068859_100339175 3300005617 Bacteria 1597
32 Ga0068864_100106286 3300005618 Bacteria 2496
33 Ga0068864_100406936 3300005618 Bacteria 1294
34 Ga0068864_100439335 3300005618 Bacteria 1246
35 Ga0068870_10183115 3300005840 Bacteria 1259
36 Ga0068858_100057280 3300005842 Bacteria 3602
37 Ga0068860_100000389 3300005843 Bacteria 57408
38 Ga0075365_10012239 3300006038 Bacteria 5085
39 Ga0075365_10015542 3300006038 Bacteria 4607
40 Ga0075365_10023430 3300006038 Bacteria 3883
41 Ga0075365_10024314 3300006038 Bacteria 3819
42 Ga0075365_10031602 3300006038 Bacteria 3397
43 Ga0075365_10036996 3300006038 Bacteria 3166
44 Ga0075365_10044628 3300006038 Bacteria 2906
45 Ga0075365_10048274 3300006038 Bacteria 2801
46 Ga0075365_10230905 3300006038 Bacteria 1299
47 Ga0075365_10249377 3300006038 Bacteria 1247
48 Ga0075368_10003155 3300006042 Bacteria 5478
49 Ga0075368_10025088 3300006042 Bacteria 2287
50 Ga0075363_100009644 3300006048 Bacteria 4546
51 Ga0075363_100070859 3300006048 Bacteria 1894
52 Ga0075363_100076687 3300006048 Bacteria 1823
53 Ga0075363_100150003 3300006048 Bacteria 1316
54 Ga0075364_10015616 3300006051 Bacteria 4712
55 Ga0075364_10115339 3300006051 Bacteria 1795
56 Ga0075364_10126217 3300006051 Bacteria 1715
57 Ga0075364_10168402 3300006051 Bacteria 1480
58 Ga0075362_10013079 3300006177 Bacteria 3313
59 Ga0075367_10076988 3300006178 Bacteria 2014
60 Ga0075367_10119050 3300006178 Bacteria 1626
61 Ga0075367_10230284 3300006178 Bacteria 1160
62 Ga0075367_10257152 3300006178 Bacteria 1096
63 Ga0075367_10517064 3300006178 Bacteria 758
64 Ga0075370_10011091 3300006353 Bacteria 4725
65 Ga0075370_10023717 3300006353 Bacteria 3382
66 Ga0075370_10058543 3300006353 Bacteria 2192
67 Ga0068865_100019075 3300006881 Bacteria 4435
68 Ga0097620_100339220 3300006931 Bacteria 1597
69 Ga0105240_10576923 3300009093 Bacteria 1241
70 Ga0105245_10065595 3300009098 Bacteria 3284
71 Ga0105245_10188869 3300009098 Bacteria 1972
72 Ga0105243_10326204 3300009148 Bacteria 1401
73 Ga0105242_10292392 3300009176 Bacteria 1484
74 Ga0105237_10133868 3300009545 Bacteria 2473
75 Ga0105238_10721312 3300009551 Bacteria 1009
76 Ga0105249_10101039 3300009553 Bacteria 2712
77 Ga0105249_10405197 3300009553 Bacteria 1395
78 Ga0105239_10002803 3300010375 Bacteria 21789
79 Ga0105246_10002128 3300011119 Bacteria 11936
80 Ga0157369_10270043 3300013105 Bacteria 1772
81 Ga0157374_10418396 3300013296 Bacteria 1339
82 Ga0157372_10082844 3300013307 Bacteria 3632
83 Ga0157372_10118789 3300013307 Bacteria 3034
84 Ga0157372_10209843 3300013307 Bacteria 2257
85 Ga0157372_10630748 3300013307 Bacteria 1249
86 Ga0157375_10060511 3300013308 Bacteria 3756
87 Ga0157375_10116583 3300013308 Bacteria 2775
88 Ga0157375_10173828 3300013308 Bacteria 2302
89 Ga0163163_10328419 3300014325 Bacteria 1583
90 Ga0157380_10213080 3300014326 Bacteria 1723
91 Ga0157380_10328231 3300014326 Bacteria 1422
92 Ga0157377_10084005 3300014745 Bacteria 1867
93 Ga0157379_10070374 3300014968 Bacteria 3130
94 Ga0207688_10045840 3300025901 Bacteria 2440
95 Ga0207647_10123879 3300025904 Bacteria 1522
96 Ga0207643_10304275 3300025908 Bacteria 993
97 Ga0207705_10175654 3300025909 Bacteria 1614
98 Ga0207671_10091080 3300025914 Bacteria 2297
99 Ga0207657_10060069 3300025919 Bacteria 3263
100 Ga0207657_10096311 3300025919 Bacteria 2461
101 Ga0207690_10462018 3300025932 Bacteria 1022
102 Ga0207704_10054476 3300025938 Bacteria 2439
103 Ga0207661_10005930 3300025944 Bacteria 8625
104 Ga0207661_10019585 3300025944 Bacteria 5049
105 Ga0207661_10152986 3300025944 Bacteria 1995
106 Ga0207679_10198799 3300025945 Bacteria 1673
107 Ga0207667_10149527 3300025949 Bacteria 2404
108 Ga0207712_10159348 3300025961 Bacteria 1752
109 Ga0207639_10584529 3300026041 Bacteria 1028
110 Ga0207678_10213539 3300026067 Bacteria 1651
111 Ga0207708_10012529 3300026075 Bacteria 6322
112 Ga0207648_10461820 3300026089 Bacteria 1157
113 Ga0207676_10132288 3300026095 Bacteria 2123
114 Ga0207676_10505123 3300026095 Bacteria 1149
115 Ga0207674_10028635 3300026116 Bacteria 5876
116 Ga0207675_100405924 3300026118 Bacteria 1343
117 Ga0207683_10075401 3300026121 Bacteria 2986
118 Ga0209813_10024072 3300027866 Bacteria 1738
119 Ga0209813_10041264 3300027866 Bacteria 1406
120 Ga0207428_10341948 3300027907 Bacteria 1102
121 Ga0268266_10001656 3300028379 Bacteria 25750
122 Ga0268264_10000250 3300028381 Bacteria 100909
123 Ga0268264_10376766 3300028381 Bacteria 1358
124 Ga0268264_10790445 3300028381 Bacteria 947
125 Ga0316181_1211149 3300030744 Bacteria 2512
126 Ga0307408_100139291 3300031548 Bacteria 1903
127 Ga0307405_10044175 3300031731 Bacteria 2724
128 Ga0307405_10197929 3300031731 Bacteria 1457
129 Ga0307405_10937557 3300031731 Bacteria 735
130 Ga0307413_10038010 3300031824 Bacteria 2786
131 Ga0307413_10191241 3300031824 Bacteria 1470
132 Ga0307410_10009781 3300031852 Bacteria 5397
133 Ga0307406_10020363 3300031901 Bacteria 3905
134 Ga0307407_10007109 3300031903 Bacteria 5044
135 Ga0307407_10050809 3300031903 Bacteria 2374
136 Ga0307407_10059055 3300031903 Bacteria 2232
137 Ga0307412_10021258 3300031911 Bacteria 3961
138 Ga0307409_100020680 3300031995 Bacteria 4492
139 Ga0307409_100100100 3300031995 Bacteria 2402
140 Ga0307409_100112051 3300031995 Bacteria 2290
141 Ga0307416_100000326 3300032002 Bacteria 24620
142 Ga0307416_100052199 3300032002 Bacteria 3272
143 Ga0307416_100180849 3300032002 Bacteria 1976
144 Ga0307414_10030941 3300032004 Bacteria 3503
145 Ga0307411_10016572 3300032005 Bacteria 4174
146 Ga0307411_10077551 3300032005 Bacteria 2275
147 Ga0307415_100001274 3300032126 Bacteria 11867
148 Ga0307415_100003952 3300032126 Bacteria 7622
149 Ga0307415_100098416 3300032126 Bacteria 2138
150 Ga0395900_0140895 3300037418 Bacteria 2469
151 Ga0395898_0027922 3300037466 Bacteria 5660
152 Ga0395898_0151424 3300037466 Bacteria 2219
153 Ga0436364_1208927 3300037853 Bacteria 3598
154 Ga0395901_0049115 3300038443 Bacteria 4383
155 Ga0395901_0147336 3300038443 Bacteria 2474
156 Ga0395901_0321198 3300038443 Bacteria 1602
157 Ga0395901_0775945 3300038443 Bacteria 949
158 Ga0451837_1566946 3300041494 Bacteria 1340
159 Ga0451843_1172291 3300041509 Bacteria 1076
160 Ga0451853_1038687 3300041512 Bacteria 1666
161 Ga0451853_3450098 3300041512 Bacteria 1594
162 Ga0466972_0023195 3300044658 Bacteria 3087
163 Ga0466965_0000788 3300044683 Bacteria 11913
164 Ga0466965_0026390 3300044683 Bacteria 2816
165 Ga0466966_0089993 3300044684 Bacteria 1906
166 Ga0466961_0279452 3300044693 Bacteria 1022
167 Ga0466963_0092374 3300044694 Bacteria 2062
168 Ga0466964_0009980 3300044706 Bacteria 3577
169 Ga0466964_0024523 3300044706 Bacteria 2351
170 Ga0466964_0110811 3300044706 Bacteria 1224
171 Ga0466971_0036226 3300044719 Bacteria 2213
172 Ga0466970_0001033 3300044765 Bacteria 13441
173 Ga0466957_0032426 3300044842 Bacteria 3128
174 Ga0466957_0160910 3300044842 Bacteria 1458
175 Ga0466957_0451800 3300044842 Bacteria 885
176 Ga0466960_0000384 3300044901 Bacteria 15121
177 Ga0466960_0007888 3300044901 Bacteria 4343
178 Ga0466960_0059754 3300044901 Bacteria 1866
179 Ga0466960_0075248 3300044901 Bacteria 1689
180 Ga0466960_0078003 3300044901 Bacteria 1662
181 Ga0466960_0157300 3300044901 Bacteria 1218
182 Ga0451576_0044542 3300045051 Bacteria 4678
183 Ga0466958_0081360 3300045836 Bacteria 1993
184 Ga0466967_0067004 3300045976 Bacteria 3201
185 Ga0466967_0090688 3300045976 Bacteria 2777
186 Ga0466967_0121210 3300045976 Bacteria 2416
187 Ga0466967_0198087 3300045976 Bacteria 1901
188 Ga0466967_0329830 3300045976 Bacteria 1473
189 Ga0495653_0391220 3300046463 Bacteria 886
190 Ga0495620_0059883 3300046515 Bacteria 1590
191 Ga0495630_0212962 3300046517 Bacteria 1475
192 Ga0495586_0390479 3300046535 Bacteria 801
193 Ga0496100_0188631 3300048903 Bacteria 1495
194 Ga0496100_0290858 3300048903 Bacteria 1221
195 Ga0496101_0132012 3300048904 Bacteria 1897
196 Ga0496102_0022755 3300048905 Bacteria 5555
197 Ga0496102_0045373 3300048905 Bacteria 3990
198 Ga0496103_0018611 3300048906 Bacteria 4167
199 Ga0496105_0115340 3300048908 Bacteria 2216
200 Ga0496106_0117808 3300048909 Bacteria 2073
201 Ga0496107_0022500 3300048910 Bacteria 4455
202 Ga0496107_0066425 3300048910 Bacteria 2615
203 Ga0496108_0080611 3300048911 Bacteria 2757
204 Ga0496109_0035016 3300048912 Bacteria 4526
205 Ga0496109_0373229 3300048912 Bacteria 1347
206 Ga0496109_0400643 3300048912 Bacteria 1296
207 Ga0496110_0027629 3300048913 Bacteria 4865
208 Ga0496110_0480057 3300048913 Bacteria 1132
209 Ga0496110_0499845 3300048913 Bacteria 1107
210 Ga0496111_0003177 3300048914 Bacteria 10121
211 Ga0496111_0100885 3300048914 Bacteria 2120
212 Ga0496112_0134894 3300048915 Bacteria 2439
213 Ga0496112_0685933 3300048915 Bacteria 953
214 Ga0496113_0207472 3300048916 Bacteria 1559
215 Ga0496114_0009272 3300048917 Bacteria 7807
216 Ga0496114_0160045 3300048917 Bacteria 1957
217 Ga0496124_0055673 3300048927 Bacteria 3341
218 Ga0501299_043053 3300049522 Bacteria 912
219 Ga0501318_000812 3300049534 Bacteria 2180
220 Ga0501031_0103366 3300049568 Bacteria 1859
221 Ga0501033_0004850 3300049570 Bacteria 10719
222 Ga0501034_0012156 3300049571 Bacteria 8901
223 Ga0501036_0017763 3300049572 Bacteria 5956
224 Ga0501036_0039454 3300049572 Bacteria 3996
225 Ga0501036_0477991 3300049572 Bacteria 1037
226 Ga0501037_0019507 3300049573 Bacteria 5002
227 Ga0501038_0018275 3300049574 Bacteria 6329
228 Ga0501039_0346983 3300049575 Bacteria 1166
229 Ga0501040_0016273 3300049576 Bacteria 4920
230 Ga0501040_0072541 3300049576 Bacteria 2378
231 Ga0501040_0095958 3300049576 Bacteria 2064
232 Ga0501041_0035903 3300049577 Bacteria 3004
233 Ga0501043_0183770 3300049579 Bacteria 1628
234 Ga0501043_0381595 3300049579 Bacteria 1067
235 Ga0501046_0000837 3300049580 Bacteria 29974
236 Ga0501046_0013240 3300049580 Bacteria 6990
237 Ga0501046_0260320 3300049580 Bacteria 1275
238 Ga0501047_0053581 3300049581 Bacteria 3901
239 Ga0501048_0447827 3300049582 Bacteria 925
240 Ga0501067_0005629 3300049583 Bacteria 6957
241 Ga0501067_0013827 3300049583 Bacteria 4469
242 Ga0501067_0028257 3300049583 Bacteria 3107
243 Ga0501067_0047138 3300049583 Bacteria 2391
244 Ga0501067_0080107 3300049583 Bacteria 1810
245 Ga0501067_0223287 3300049583 Bacteria 1049
246 Ga0501068_0003172 3300049584 Bacteria 8803
247 Ga0501068_0037824 3300049584 Bacteria 2889
248 Ga0501069_0015469 3300049585 Bacteria 4090
249 Ga0501069_0021842 3300049585 Bacteria 3476
250 Ga0501069_0069311 3300049585 Bacteria 1975
251 Ga0501069_0109072 3300049585 Bacteria 1575
252 Ga0501069_0256467 3300049585 Bacteria 1020
253 Ga0501070_0005664 3300049586 Bacteria 10649
254 Ga0501070_0046160 3300049586 Bacteria 3623
255 Ga0501072_0016835 3300049588 Bacteria 5617
256 Ga0501073_0009128 3300049589 Bacteria 7319
257 Ga0501073_0117952 3300049589 Bacteria 1839
258 Ga0501074_0002349 3300049590 Bacteria 13163
259 Ga0501075_0340048 3300049591 Bacteria 1144
260 Ga0501076_0061447 3300049592 Bacteria 2990
261 Ga0501076_0088483 3300049592 Bacteria 2489
262 Ga0501077_0005744 3300049593 Bacteria 7556
263 Ga0501077_0189730 3300049593 Bacteria 1306
264 Ga0501242_020964 3300049674 Bacteria 842
265 Ga0501255_036859 3300049684 Bacteria 703
266 Ga0501079_0010161 3300049741 Bacteria 7146
267 Ga0501079_0046230 3300049741 Bacteria 3358
268 Ga0501080_0004098 3300049742 Bacteria 12917
269 Ga0501083_0017046 3300049744 Bacteria 5071
270 Ga0501035_0013504 3300049822 Bacteria 7538
271 Ga0501035_0520770 3300049822 Bacteria 977
272 Ga0501044_0013939 3300049823 Bacteria 8685
273 Ga0501045_0029318 3300049824 Bacteria 3977
274 Ga0501045_0204713 3300049824 Bacteria 1470
275 nmdc:mga03n38_10567_c1 3300050490 Bacteria 3404
276 nmdc:mga03n38_137737_c1 3300050490 Bacteria 1216
277 nmdc:mga03n38_206199_c1 3300050490 Bacteria 1020
278 nmdc:mga03n38_38331_c1 3300050490 Bacteria 2072
279 nmdc:mga00v17_124659_c1 3300050491 Bacteria 1643
280 nmdc:mga00v17_23697_c1 3300050491 Bacteria 3553
281 nmdc:mga00v17_47364_c1 3300050491 Bacteria 2604
282 nmdc:mga00v17_52006_c1 3300050491 Bacteria 2491
283 nmdc:mga00v17_71587_c1 3300050491 Bacteria 2149
284 nmdc:mga0yw44_1795_c1 3300050492 Bacteria 8758
285 nmdc:mga0yw44_18057_c1 3300050492 Bacteria 3856
286 nmdc:mga0yw44_26968_c1 3300050492 Bacteria 3286
287 nmdc:mga0yw44_275524_c1 3300050492 Bacteria 1124
288 nmdc:mga0yw44_276505_c1 3300050492 Bacteria 1122
289 nmdc:mga0yw44_293659_c1 3300050492 Bacteria 1088
290 nmdc:mga0yw44_31465_c1 3300050492 Bacteria 3086
291 nmdc:mga0yw44_513659_c1 3300050492 Bacteria 813
292 nmdc:mga0yw44_8242_c1 3300050492 Bacteria 5179
293 nmdc:mga0yw44_86279_c1 3300050492 Bacteria 1977
294 nmdc:mga06z11_141939_c1 3300050494 Bacteria 1359
295 nmdc:mga06z11_242611_c1 3300050494 Bacteria 1059
296 nmdc:mga06z11_28606_c1 3300050494 Bacteria 2676
297 nmdc:mga04h51_44956_c1 3300050495 Bacteria 1459
298 nmdc:mga07m45_30065_c1 3300050496 Bacteria 3008
299 nmdc:mga07m45_41307_c1 3300050496 Bacteria 2582
300 nmdc:mga08y16_387691_c1 3300050511 Bacteria 1431
301 nmdc:mga08y16_567983_c1 3300050511 Bacteria 1146
302 Ga0495619_0014903 3300053085 Bacteria 4910
303 Ga0500644_0000050 3300053088 Bacteria 71907
304 Ga0500641_0098124 3300053096 Bacteria 1255
305 Ga0500556_0000614 3300053104 Bacteria 22712
306 Ga0500593_000811 3300053117 Bacteria 11691
307 Ga0500573_0198967 3300053140 Bacteria 1065
308 Ga0501084_0012997 3300054114 Bacteria 6890
309 Ga0501084_0281896 3300054114 Bacteria 1403
310 Ga0501082_0005687 3300060353 Bacteria 10818
311 Ga0466962_0053478 3300061719 Bacteria 1930
312 Ga0530510_0228240 3300061734 Bacteria 1385
313 2643889917 2643221576 Bacteria 5214352
314 2643958973 2643221590 Bacteria 5214697
315 2644033874 2643221604 Bacteria 5014917
316 2644091732 2643221615 Bacteria 5487866
317 2644102616 2643221617 Bacteria 5139111
318 2644118278 2643221620 Bacteria 5134593
319 2644231184 2643221641 Bacteria 4490190
320 2644321535 2643221657 Bacteria 5490246
321 2738867474 2738541305 Bacteria 4910150
322 2740166529 2739367898 Bacteria 4367674
323 2812331711 2811994874 Bacteria 5367947
324 2812350141 2811994878 Bacteria 5992952
325 2891972237 2891968417 Bacteria 5821697
326 2990260681 2990256926 Bacteria 4252839
327 Ga0111539_10403461
328 JGI24735J21928_10110893
329 Ga0070683_100001861
330 Ga0070683_100004570
331 Ga0070690_100219630
332 Ga0068869_100252839
333 Ga0070666_10350479
334 Ga0070680_100112933
335 Ga0070682_100025973
336 Ga0070682_100080471
337 Ga0068868_100546722
338 Ga0070660_100227884
339 Ga0070661_100134981
340 Ga0070692_10059995
341 Ga0070659_100116015
342 Ga0070667_100087047
343 Ga0070667_100250857
344 Ga0070700_100008556
345 Ga0070678_100106049
346 Ga0068867_100385615
347 Ga0070679_100302537
348 Ga0070684_100000939
349 Ga0070684_100107918
350 Ga0068853_100810157
351 Ga0070693_100119709
352 Ga0068855_100277803
353 Ga0070664_100221736
354 Ga0068857_100003902
355 Ga0068856_100698131
356 Ga0070702_100196497
357 Ga0068859_100339175
358 Ga0068864_100106286
359 Ga0068864_100406936
360 Ga0068864_100439335
361 Ga0068870_10183115
362 Ga0068858_100057280
363 Ga0068860_100000389
364 Ga0075365_10012239
365 Ga0075365_10015542
366 Ga0075365_10023430
367 Ga0075365_10024314
368 Ga0075365_10031602
369 Ga0075365_10036996
370 Ga0075365_10044628
371 Ga0075365_10048274
372 Ga0075365_10230905
373 Ga0075365_10249377
374 Ga0075368_10003155
375 Ga0075368_10025088
376 Ga0075363_100009644
377 Ga0075363_100070859
378 Ga0075363_100076687
379 Ga0075363_100150003
380 Ga0075364_10015616
381 Ga0075364_10115339
382 Ga0075364_10126217
383 Ga0075364_10168402
384 Ga0075362_10013079
385 Ga0075367_10076988
386 Ga0075367_10119050
387 Ga0075367_10230284
388 Ga0075367_10257152
389 Ga0075367_10517064
390 Ga0075370_10011091
391 Ga0075370_10023717
392 Ga0075370_10058543
393 Ga0068865_100019075
394 Ga0097620_100339220
395 Ga0105240_10576923
396 Ga0105245_10065595
397 Ga0105245_10188869
398 Ga0105243_10326204
399 Ga0105242_10292392
400 Ga0105237_10133868
401 Ga0105238_10721312
402 Ga0105249_10101039
403 Ga0105249_10405197
404 Ga0105239_10002803
405 Ga0105246_10002128
406 Ga0157369_10270043
407 Ga0157374_10418396
408 Ga0157372_10082844
409 Ga0157372_10118789
410 Ga0157372_10209843
411 Ga0157372_10630748
412 Ga0157375_10060511
413 Ga0157375_10116583
414 Ga0157375_10173828
415 Ga0163163_10328419
416 Ga0157380_10213080
417 Ga0157380_10328231
418 Ga0157377_10084005
419 Ga0157379_10070374
420 Ga0207688_10045840
421 Ga0207647_10123879
422 Ga0207643_10304275
423 Ga0207705_10175654
424 Ga0207671_10091080
425 Ga0207657_10060069
426 Ga0207657_10096311
427 Ga0207690_10462018
428 Ga0207704_10054476
429 Ga0207661_10005930
430 Ga0207661_10019585
431 Ga0207661_10152986
432 Ga0207679_10198799
433 Ga0207667_10149527
434 Ga0207712_10159348
435 Ga0207639_10584529
436 Ga0207678_10213539
437 Ga0207708_10012529
438 Ga0207648_10461820
439 Ga0207676_10132288
440 Ga0207676_10505123
441 Ga0207674_10028635
442 Ga0207675_100405924
443 Ga0207683_10075401
444 Ga0209813_10024072
445 Ga0209813_10041264
446 Ga0207428_10341948
447 Ga0268266_10001656
448 Ga0268264_10000250
449 Ga0268264_10376766
450 Ga0268264_10790445
451 Ga0316181_1211149
452 Ga0307408_100139291
453 Ga0307405_10044175
454 Ga0307405_10197929
455 Ga0307405_10937557
456 Ga0307413_10038010
457 Ga0307413_10191241
458 Ga0307410_10009781
459 Ga0307406_10020363
460 Ga0307407_10007109
461 Ga0307407_10050809
462 Ga0307407_10059055
463 Ga0307412_10021258
464 Ga0307409_100020680
465 Ga0307409_100100100
466 Ga0307409_100112051
467 Ga0307416_100000326
468 Ga0307416_100052199
469 Ga0307416_100180849
470 Ga0307414_10030941
471 Ga0307411_10016572
472 Ga0307411_10077551
473 Ga0307415_100001274
474 Ga0307415_100003952
475 Ga0307415_100098416
476 Ga0395900_0140895
477 Ga0395898_0027922
478 Ga0395898_0151424
479 Ga0436364_1208927
480 Ga0395901_0049115
481 Ga0395901_0147336
482 Ga0395901_0321198
483 Ga0395901_0775945
484 Ga0451837_1566946
485 Ga0451843_1172291
486 Ga0451853_1038687
487 Ga0451853_3450098
488 Ga0466972_0023195
489 Ga0466965_0000788
490 Ga0466965_0026390
491 Ga0466966_0089993
492 Ga0466961_0279452
493 Ga0466963_0092374
494 Ga0466964_0009980
495 Ga0466964_0024523
496 Ga0466964_0110811
497 Ga0466971_0036226
498 Ga0466970_0001033
499 Ga0466957_0032426
500 Ga0466957_0160910
501 Ga0466957_0451800
502 Ga0466960_0000384
503 Ga0466960_0007888
504 Ga0466960_0059754
505 Ga0466960_0075248
506 Ga0466960_0078003
507 Ga0466960_0157300
508 Ga0451576_0044542
509 Ga0466958_0081360
510 Ga0466967_0067004
511 Ga0466967_0090688
512 Ga0466967_0121210
513 Ga0466967_0198087
514 Ga0466967_0329830
515 Ga0495653_0391220
516 Ga0495620_0059883
517 Ga0495630_0212962
518 Ga0495586_0390479
519 Ga0496100_0188631
520 Ga0496100_0290858
521 Ga0496101_0132012
522 Ga0496102_0022755
523 Ga0496102_0045373
524 Ga0496103_0018611
525 Ga0496105_0115340
526 Ga0496106_0117808
527 Ga0496107_0022500
528 Ga0496107_0066425
529 Ga0496108_0080611
530 Ga0496109_0035016
531 Ga0496109_0373229
532 Ga0496109_0400643
533 Ga0496110_0027629
534 Ga0496110_0480057
535 Ga0496110_0499845
536 Ga0496111_0003177
537 Ga0496111_0100885
538 Ga0496112_0134894
539 Ga0496112_0685933
540 Ga0496113_0207472
541 Ga0496114_0009272
542 Ga0496114_0160045
543 Ga0496124_0055673
544 Ga0501299_043053
545 Ga0501318_000812
546 Ga0501031_0103366
547 Ga0501033_0004850
548 Ga0501034_0012156
549 Ga0501036_0017763
550 Ga0501036_0039454
551 Ga0501036_0477991
552 Ga0501037_0019507
553 Ga0501038_0018275
554 Ga0501039_0346983
555 Ga0501040_0016273
556 Ga0501040_0072541
557 Ga0501040_0095958
558 Ga0501041_0035903
559 Ga0501043_0183770
560 Ga0501043_0381595
561 Ga0501046_0000837
562 Ga0501046_0013240
563 Ga0501046_0260320
564 Ga0501047_0053581
565 Ga0501048_0447827
566 Ga0501067_0005629
567 Ga0501067_0013827
568 Ga0501067_0028257
569 Ga0501067_0047138
570 Ga0501067_0080107
571 Ga0501067_0223287
572 Ga0501068_0003172
573 Ga0501068_0037824
574 Ga0501069_0015469
575 Ga0501069_0021842
576 Ga0501069_0069311
577 Ga0501069_0109072
578 Ga0501069_0256467
579 Ga0501070_0005664
580 Ga0501070_0046160
581 Ga0501072_0016835
582 Ga0501073_0009128
583 Ga0501073_0117952
584 Ga0501074_0002349
585 Ga0501075_0340048
586 Ga0501076_0061447
587 Ga0501076_0088483
588 Ga0501077_0005744
589 Ga0501077_0189730
590 Ga0501242_020964
591 Ga0501255_036859
592 Ga0501079_0010161
593 Ga0501079_0046230
594 Ga0501080_0004098
595 Ga0501083_0017046
596 Ga0501035_0013504
597 Ga0501035_0520770
598 Ga0501044_0013939
599 Ga0501045_0029318
600 Ga0501045_0204713
601 nmdc:mga03n38_10567_c1
602 nmdc:mga03n38_137737_c1
603 nmdc:mga03n38_206199_c1
604 nmdc:mga03n38_38331_c1
605 nmdc:mga00v17_124659_c1
606 nmdc:mga00v17_23697_c1
607 nmdc:mga00v17_47364_c1
608 nmdc:mga00v17_52006_c1
609 nmdc:mga00v17_71587_c1
610 nmdc:mga0yw44_1795_c1
611 nmdc:mga0yw44_18057_c1
612 nmdc:mga0yw44_26968_c1
613 nmdc:mga0yw44_275524_c1
614 nmdc:mga0yw44_276505_c1
615 nmdc:mga0yw44_293659_c1
616 nmdc:mga0yw44_31465_c1
617 nmdc:mga0yw44_513659_c1
618 nmdc:mga0yw44_8242_c1
619 nmdc:mga0yw44_86279_c1
620 nmdc:mga06z11_141939_c1
621 nmdc:mga06z11_242611_c1
622 nmdc:mga06z11_28606_c1
623 nmdc:mga04h51_44956_c1
624 nmdc:mga07m45_30065_c1
625 nmdc:mga07m45_41307_c1
626 nmdc:mga08y16_387691_c1
627 nmdc:mga08y16_567983_c1
628 Ga0495619_0014903
629 Ga0500644_0000050
630 Ga0500641_0098124
631 Ga0500556_0000614
632 Ga0500593_000811
633 Ga0500573_0198967
634 Ga0501084_0012997
635 Ga0501084_0281896
636 Ga0501082_0005687
637 Ga0466962_0053478
638 Ga0530510_0228240
639 2643889917
640 2643958973
641 2644033874
642 2644091732
643 2644102616
644 2644118278
645 2644231184
646 2644321535
647 2738867474
648 2740166529
649 2812331711
650 2812350141
651 2891972237
652 2990260681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

61

107

0.98

PF21351

TetR_C_41

Tetracyclin repressor-like, C-terminal domain

130

240

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5icj-assembly1.cif.gz_B crystal structure of the mycobacterium tuberculosis transcriptional repressor ethr2 in complex with bdm41420 0.9006 26 211
5n1i-assembly1.cif.gz_B unliganded form of the mycobacterium tuberculosis repressor ethr2 0.8936 26 210
6hs1-assembly1.cif.gz_B ethr2 in complex with compound 9 (bdm76060) 0.8789 25 210
5n1c-assembly1.cif.gz_B iodinated form of the mycobacterium tuberculosis repressor ethr2 0.8786 25 210
5icj-assembly1.cif.gz_B crystal structure of the mycobacterium tuberculosis transcriptional repressor ethr2 in complex with bdm41420 0.8783 26 211
ID Description Score Start End Superfamily
3bt9A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.997 28 74 1.10.10.60
3btjA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9959 28 74 1.10.10.60
1jupA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9949 28 74 1.10.10.60
3btlA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9949 28 74 1.10.10.60
1rpwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9948 28 74 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A519GS16-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9451 59 223 GO:0003677
GO:0006355
AF-A0A7W0QYM1-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9348 19 211 GO:0000976
GO:0003700
AF-A0A7X4WP62-F1-model_v4 TetR family transcriptional regulator 0.9325 21 211 GO:0000976
GO:0003700
AF-A0A0Q7CY71-F1-model_v4 HTH tetR-type domain-containing protein 0.9256 19 211 GO:0000976
GO:0003700
AF-A0A7G5YWN7-F1-model_v4 TetR/AcrR family transcriptional regulator 0.923 20 211 GO:0000976
GO:0003700

Map