F408250
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 157 | 326 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_101735439|Ga0075428_1017354392 |
| Length | 107 |
| Sequence | MAQTTFAEPEIDEEAGEELEKLYHVIILNDDEHSFDYVIEMLQDVFGFSYSTALAHTVEADATGSSIVKTCRLSEAESKRDQIHAYGADWRMPNSRGPVTALVEPAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 39 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 61 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 64 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 65 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 66 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 67 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 101 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 102 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 103 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 104 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 105 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 106 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 107 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 108 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 109 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 111 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 113 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 114 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 115 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 116 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 117 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 118 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 119 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 120 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 121 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 122 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 123 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 124 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 137 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 138 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 139 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 140 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 141 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 152 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.16 |
| Metatranscriptomes | 1.84 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.23 |
| Rhizosphere | 82.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058859_11084040 | 3300004798 | Bacteria | 897 |
| 2 | Ga0058862_12619578 | 3300004803 | Bacteria | 1810 |
| 3 | Ga0065707_10652586 | 3300005295 | Bacteria | 662 |
| 4 | Ga0070658_10099841 | 3300005327 | Bacteria | 2398 |
| 5 | Ga0070676_11248336 | 3300005328 | Unclassified | 566 |
| 6 | Ga0070683_100077339 | 3300005329 | Bacteria | 3112 |
| 7 | Ga0070683_100864192 | 3300005329 | Archaea | 867 |
| 8 | Ga0068869_100750756 | 3300005334 | Unclassified | 835 |
| 9 | Ga0070666_11263419 | 3300005335 | Bacteria | 550 |
| 10 | Ga0070660_100061391 | 3300005339 | Bacteria | 2918 |
| 11 | Ga0070660_100146040 | 3300005339 | Unclassified | 1900 |
| 12 | Ga0070661_100128174 | 3300005344 | Unclassified | 1904 |
| 13 | Ga0070661_100147419 | 3300005344 | Bacteria | 1777 |
| 14 | Ga0070661_100486084 | 3300005344 | Bacteria | 987 |
| 15 | Ga0070692_10023895 | 3300005345 | Bacteria | 2999 |
| 16 | Ga0070675_100985661 | 3300005354 | Bacteria | 774 |
| 17 | Ga0070671_100214619 | 3300005355 | Bacteria | 1632 |
| 18 | Ga0070674_102083335 | 3300005356 | Bacteria | 517 |
| 19 | Ga0070673_100898478 | 3300005364 | Bacteria | 821 |
| 20 | Ga0070659_100106791 | 3300005366 | Unclassified | 2257 |
| 21 | Ga0070714_101579772 | 3300005435 | Unclassified | 641 |
| 22 | Ga0070711_100596085 | 3300005439 | Unclassified | 921 |
| 23 | Ga0070663_100161455 | 3300005455 | Bacteria | 1725 |
| 24 | Ga0070663_100186304 | 3300005455 | Bacteria | 1613 |
| 25 | Ga0070663_100781712 | 3300005455 | Bacteria | 817 |
| 26 | Ga0070678_100184680 | 3300005456 | Unclassified | 1710 |
| 27 | Ga0070678_100281156 | 3300005456 | Bacteria | 1407 |
| 28 | Ga0070678_100326250 | 3300005456 | Unclassified | 1312 |
| 29 | Ga0070678_101352110 | 3300005456 | Bacteria | 664 |
| 30 | Ga0070681_10256593 | 3300005458 | Bacteria | 1660 |
| 31 | Ga0070681_10422202 | 3300005458 | Bacteria | 1245 |
| 32 | Ga0070679_100072729 | 3300005530 | Bacteria | 3430 |
| 33 | Ga0070679_100333742 | 3300005530 | Bacteria | 1465 |
| 34 | Ga0070679_101340263 | 3300005530 | Bacteria | 661 |
| 35 | Ga0070684_100233245 | 3300005535 | Bacteria | 1680 |
| 36 | Ga0070684_100348129 | 3300005535 | Bacteria | 1363 |
| 37 | Ga0068853_100345865 | 3300005539 | Bacteria | 1382 |
| 38 | Ga0068853_100460247 | 3300005539 | Unclassified | 1197 |
| 39 | Ga0068853_100646420 | 3300005539 | Bacteria | 1006 |
| 40 | Ga0070693_100101653 | 3300005547 | Bacteria | 1752 |
| 41 | Ga0070665_100020189 | 3300005548 | Bacteria | 6689 |
| 42 | Ga0070665_102590593 | 3300005548 | Unclassified | 508 |
| 43 | Ga0068855_100007832 | 3300005563 | Bacteria | 12909 |
| 44 | Ga0068855_100289979 | 3300005563 | Unclassified | 1814 |
| 45 | Ga0068855_100420293 | 3300005563 | Bacteria | 1462 |
| 46 | Ga0070664_100051179 | 3300005564 | Bacteria | 3497 |
| 47 | Ga0070664_100320457 | 3300005564 | Unclassified | 1404 |
| 48 | Ga0070664_100522839 | 3300005564 | Unclassified | 1095 |
| 49 | Ga0068857_100003985 | 3300005577 | Bacteria | 12436 |
| 50 | Ga0068856_100067801 | 3300005614 | Bacteria | 3526 |
| 51 | Ga0068856_100108089 | 3300005614 | Unclassified | 2778 |
| 52 | Ga0068856_101146917 | 3300005614 | Bacteria | 794 |
| 53 | Ga0068856_101572426 | 3300005614 | Unclassified | 671 |
| 54 | Ga0068852_101193769 | 3300005616 | Unclassified | 782 |
| 55 | Ga0068852_101762735 | 3300005616 | Unclassified | 642 |
| 56 | Ga0068864_100024920 | 3300005618 | Bacteria | 5033 |
| 57 | Ga0068863_100031031 | 3300005841 | Bacteria | 5103 |
| 58 | Ga0068863_100301934 | 3300005841 | Unclassified | 1553 |
| 59 | Ga0068863_101103098 | 3300005841 | Bacteria | 798 |
| 60 | Ga0068858_101505774 | 3300005842 | Bacteria | 663 |
| 61 | Ga0070717_10011438 | 3300006028 | Bacteria | 6741 |
| 62 | Ga0097621_100119859 | 3300006237 | Unclassified | 2230 |
| 63 | Ga0075428_101735439 | 3300006844 | Unclassified | 651 |
| 64 | Ga0075428_102377375 | 3300006844 | Bacteria | 544 |
| 65 | Ga0075431_100677795 | 3300006847 | Unclassified | 1010 |
| 66 | Ga0075434_102461980 | 3300006871 | Unclassified | 522 |
| 67 | Ga0105240_10006166 | 3300009093 | Bacteria | 17670 |
| 68 | Ga0105240_10040196 | 3300009093 | Bacteria | 5986 |
| 69 | Ga0105240_10893946 | 3300009093 | Bacteria | 956 |
| 70 | Ga0105245_10898902 | 3300009098 | Bacteria | 927 |
| 71 | Ga0105241_10909485 | 3300009174 | Unclassified | 818 |
| 72 | Ga0105241_10914607 | 3300009174 | Bacteria | 816 |
| 73 | Ga0105242_10638570 | 3300009176 | Bacteria | 1034 |
| 74 | Ga0105242_11674566 | 3300009176 | Bacteria | 672 |
| 75 | Ga0105248_10279951 | 3300009177 | Bacteria | 1878 |
| 76 | Ga0105248_10360768 | 3300009177 | Bacteria | 1636 |
| 77 | Ga0105248_10579917 | 3300009177 | Bacteria | 1265 |
| 78 | Ga0105248_10742905 | 3300009177 | Bacteria | 1107 |
| 79 | Ga0105248_11877783 | 3300009177 | Unclassified | 680 |
| 80 | Ga0105248_12068741 | 3300009177 | Bacteria | 647 |
| 81 | Ga0105248_12125931 | 3300009177 | Unclassified | 638 |
| 82 | Ga0105237_10076056 | 3300009545 | Bacteria | 3348 |
| 83 | Ga0105237_10461381 | 3300009545 | Unclassified | 1276 |
| 84 | Ga0105237_11669851 | 3300009545 | Bacteria | 644 |
| 85 | Ga0105237_12372280 | 3300009545 | Unclassified | 541 |
| 86 | Ga0105238_10099786 | 3300009551 | Bacteria | 2886 |
| 87 | Ga0105238_10155772 | 3300009551 | Bacteria | 2260 |
| 88 | Ga0105238_10357385 | 3300009551 | Bacteria | 1450 |
| 89 | Ga0105238_10568699 | 3300009551 | Bacteria | 1139 |
| 90 | Ga0105239_10238696 | 3300010375 | Bacteria | 2040 |
| 91 | Ga0105239_10336375 | 3300010375 | Bacteria | 1703 |
| 92 | Ga0105239_10374261 | 3300010375 | Bacteria | 1610 |
| 93 | Ga0105239_11181057 | 3300010375 | Bacteria | 882 |
| 94 | Ga0157371_10415903 | 3300013102 | Unclassified | 985 |
| 95 | Ga0157371_10554118 | 3300013102 | Unclassified | 852 |
| 96 | Ga0157371_10642851 | 3300013102 | Unclassified | 791 |
| 97 | Ga0157371_11480784 | 3300013102 | Bacteria | 529 |
| 98 | Ga0157370_10002904 | 3300013104 | Bacteria | 20437 |
| 99 | Ga0157370_10085011 | 3300013104 | Bacteria | 2972 |
| 100 | Ga0157370_10108276 | 3300013104 | Bacteria | 2599 |
| 101 | Ga0157370_10202939 | 3300013104 | Bacteria | 1839 |
| 102 | Ga0157370_10224531 | 3300013104 | Bacteria | 1739 |
| 103 | Ga0157370_10309726 | 3300013104 | Bacteria | 1457 |
| 104 | Ga0157370_10376683 | 3300013104 | Bacteria | 1307 |
| 105 | Ga0157370_11025693 | 3300013104 | Bacteria | 746 |
| 106 | Ga0157370_11668438 | 3300013104 | Unclassified | 572 |
| 107 | Ga0157369_10007007 | 3300013105 | Bacteria | 13007 |
| 108 | Ga0157369_10140498 | 3300013105 | Bacteria | 2556 |
| 109 | Ga0157369_10173443 | 3300013105 | Bacteria | 2271 |
| 110 | Ga0157369_10432451 | 3300013105 | Unclassified | 1364 |
| 111 | Ga0157369_10658956 | 3300013105 | Bacteria | 1079 |
| 112 | Ga0157369_11385049 | 3300013105 | Bacteria | 716 |
| 113 | Ga0157374_10005280 | 3300013296 | Bacteria | 10844 |
| 114 | Ga0157378_11186634 | 3300013297 | Bacteria | 802 |
| 115 | Ga0163162_10090746 | 3300013306 | Bacteria | 3137 |
| 116 | Ga0163162_11086850 | 3300013306 | Bacteria | 906 |
| 117 | Ga0163162_11625323 | 3300013306 | Unclassified | 737 |
| 118 | Ga0157372_10509356 | 3300013307 | Unclassified | 1403 |
| 119 | Ga0157372_11830840 | 3300013307 | Unclassified | 698 |
| 120 | Ga0157372_12284931 | 3300013307 | Unclassified | 621 |
| 121 | Ga0157375_10138440 | 3300013308 | Bacteria | 2559 |
| 122 | Ga0163163_10065440 | 3300014325 | Bacteria | 3609 |
| 123 | Ga0157376_10077246 | 3300014969 | Unclassified | 2848 |
| 124 | Ga0157376_11355092 | 3300014969 | Bacteria | 742 |
| 125 | Ga0157376_12530970 | 3300014969 | Unclassified | 553 |
| 126 | Ga0182007_10198755 | 3300015262 | Bacteria | 700 |
| 127 | Ga0197907_10373791 | 3300020069 | Unclassified | 1760 |
| 128 | Ga0206355_1394900 | 3300020076 | Unclassified | 1068 |
| 129 | Ga0206350_10163834 | 3300020080 | Bacteria | 1332 |
| 130 | Ga0154015_1103909 | 3300020610 | Unclassified | 619 |
| 131 | Ga0213873_10282329 | 3300021358 | Unclassified | 532 |
| 132 | Ga0213872_10329983 | 3300021361 | Bacteria | 629 |
| 133 | Ga0213876_10006886 | 3300021384 | Bacteria | 6197 |
| 134 | Ga0213876_10019556 | 3300021384 | Bacteria | 3578 |
| 135 | Ga0213876_10099165 | 3300021384 | Bacteria | 1544 |
| 136 | Ga0213875_10000005 | 3300021388 | Bacteria | 595146 |
| 137 | Ga0213875_10000032 | 3300021388 | Bacteria | 172918 |
| 138 | Ga0213875_10004701 | 3300021388 | Bacteria | 7433 |
| 139 | Ga0213875_10012251 | 3300021388 | Bacteria | 4242 |
| 140 | Ga0213875_10012833 | 3300021388 | Bacteria | 4127 |
| 141 | Ga0213875_10034697 | 3300021388 | Bacteria | 2382 |
| 142 | Ga0213875_10042572 | 3300021388 | Bacteria | 2133 |
| 143 | Ga0213875_10075676 | 3300021388 | Bacteria | 1571 |
| 144 | Ga0213875_10195875 | 3300021388 | Unclassified | 950 |
| 145 | Ga0213875_10205237 | 3300021388 | Bacteria | 927 |
| 146 | Ga0213875_10337905 | 3300021388 | Bacteria | 715 |
| 147 | Ga0213875_10633782 | 3300021388 | Unclassified | 517 |
| 148 | Ga0213875_10652051 | 3300021388 | Unclassified | 510 |
| 149 | Ga0207647_10116807 | 3300025904 | Bacteria | 1575 |
| 150 | Ga0207699_10574902 | 3300025906 | Unclassified | 819 |
| 151 | Ga0207645_10979197 | 3300025907 | Unclassified | 573 |
| 152 | Ga0207705_10134416 | 3300025909 | Bacteria | 1843 |
| 153 | Ga0207707_10166522 | 3300025912 | Bacteria | 1926 |
| 154 | Ga0207695_10001974 | 3300025913 | Bacteria | 31730 |
| 155 | Ga0207695_10004561 | 3300025913 | Bacteria | 18833 |
| 156 | Ga0207660_10899222 | 3300025917 | Bacteria | 722 |
| 157 | Ga0207657_10021954 | 3300025919 | Bacteria | 5993 |
| 158 | Ga0207657_10076829 | 3300025919 | Unclassified | 2816 |
| 159 | Ga0207649_10099930 | 3300025920 | Unclassified | 1918 |
| 160 | Ga0207649_10184029 | 3300025920 | Bacteria | 1464 |
| 161 | Ga0207649_10410438 | 3300025920 | Bacteria | 1015 |
| 162 | Ga0207649_10741162 | 3300025920 | Bacteria | 764 |
| 163 | Ga0207652_10166205 | 3300025921 | Bacteria | 1978 |
| 164 | Ga0207652_10290933 | 3300025921 | Bacteria | 1474 |
| 165 | Ga0207652_11081205 | 3300025921 | Unclassified | 702 |
| 166 | Ga0207694_10143144 | 3300025924 | Bacteria | 1923 |
| 167 | Ga0207694_10867046 | 3300025924 | Bacteria | 763 |
| 168 | Ga0207687_10552629 | 3300025927 | Bacteria | 966 |
| 169 | Ga0207700_12003263 | 3300025928 | Unclassified | 506 |
| 170 | Ga0207664_11320556 | 3300025929 | Unclassified | 641 |
| 171 | Ga0207644_11669177 | 3300025931 | Bacteria | 534 |
| 172 | Ga0207690_10074609 | 3300025932 | Unclassified | 2350 |
| 173 | Ga0207690_10168001 | 3300025932 | Unclassified | 1641 |
| 174 | Ga0207670_11309583 | 3300025936 | Bacteria | 614 |
| 175 | Ga0207711_10251549 | 3300025941 | Bacteria | 1623 |
| 176 | Ga0207711_10254791 | 3300025941 | Bacteria | 1612 |
| 177 | Ga0207711_10488625 | 3300025941 | Bacteria | 1147 |
| 178 | Ga0207711_10561689 | 3300025941 | Bacteria | 1065 |
| 179 | Ga0207689_10589679 | 3300025942 | Unclassified | 935 |
| 180 | Ga0207661_10181608 | 3300025944 | Bacteria | 1838 |
| 181 | Ga0207661_10691050 | 3300025944 | Unclassified | 938 |
| 182 | Ga0207679_10128680 | 3300025945 | Unclassified | 2028 |
| 183 | Ga0207667_10248369 | 3300025949 | Unclassified | 1820 |
| 184 | Ga0207667_10527005 | 3300025949 | Bacteria | 1196 |
| 185 | Ga0207651_12125411 | 3300025960 | Bacteria | 504 |
| 186 | Ga0207640_10103233 | 3300025981 | Bacteria | 2004 |
| 187 | Ga0207677_10155372 | 3300026023 | Bacteria | 1771 |
| 188 | Ga0207677_10333313 | 3300026023 | Bacteria | 1265 |
| 189 | Ga0207677_11566951 | 3300026023 | Bacteria | 609 |
| 190 | Ga0207703_11243608 | 3300026035 | Unclassified | 716 |
| 191 | Ga0207703_11448066 | 3300026035 | Bacteria | 661 |
| 192 | Ga0207639_10339896 | 3300026041 | Unclassified | 1338 |
| 193 | Ga0207678_10066294 | 3300026067 | Bacteria | 3101 |
| 194 | Ga0207678_10113586 | 3300026067 | Bacteria | 2311 |
| 195 | Ga0207678_10558390 | 3300026067 | Bacteria | 1002 |
| 196 | Ga0207678_12025826 | 3300026067 | Unclassified | 501 |
| 197 | Ga0207702_10016322 | 3300026078 | Bacteria | 6146 |
| 198 | Ga0207702_10043904 | 3300026078 | Bacteria | 3755 |
| 199 | Ga0207702_10289568 | 3300026078 | Unclassified | 1551 |
| 200 | Ga0207641_10066670 | 3300026088 | Bacteria | 3081 |
| 201 | Ga0207641_10712280 | 3300026088 | Unclassified | 989 |
| 202 | Ga0207683_10607272 | 3300026121 | Unclassified | 1013 |
| 203 | Ga0207698_11777282 | 3300026142 | Unclassified | 632 |
| 204 | Ga0268266_10058313 | 3300028379 | Bacteria | 3324 |
| 205 | Ga0268266_10104211 | 3300028379 | Bacteria | 2504 |
| 206 | Ga0268266_10783672 | 3300028379 | Bacteria | 921 |
| 207 | Ga0268266_10794558 | 3300028379 | Unclassified | 914 |
| 208 | Ga0265325_10201112 | 3300031241 | Bacteria | 919 |
| 209 | Ga0265313_10133719 | 3300031595 | Bacteria | 1072 |
| 210 | Ga0316579_10528032 | 3300031691 | Unclassified | 571 |
| 211 | Ga0373954_0047120 | 3300035118 | Bacteria | 2016 |
| 212 | Ga0373956_0053805 | 3300035119 | Bacteria | 1813 |
| 213 | Ga0373935_0054828 | 3300035692 | Bacteria | 2540 |
| 214 | Ga0373935_0394149 | 3300035692 | Bacteria | 993 |
| 215 | Ga0373927_0001450 | 3300035695 | Bacteria | 17885 |
| 216 | Ga0373927_0858968 | 3300035695 | Unclassified | 599 |
| 217 | Ga0373933_0558303 | 3300035724 | Bacteria | 751 |
| 218 | Ga0373947_0038514 | 3300035725 | Bacteria | 2841 |
| 219 | Ga0373937_0026961 | 3300036401 | Bacteria | 5194 |
| 220 | Ga0316582_1259725 | 3300036647 | Bacteria | 503 |
| 221 | Ga0373925_0188390 | 3300037068 | Bacteria | 1636 |
| 222 | Ga0395900_1515576 | 3300037418 | Unclassified | 582 |
| 223 | Ga0436364_0115483 | 3300037853 | Bacteria | 5634 |
| 224 | Ga0436364_0132953 | 3300037853 | Bacteria | 5490 |
| 225 | Ga0436364_0157811 | 3300037853 | Bacteria | 430293 |
| 226 | Ga0436364_0167917 | 3300037853 | Bacteria | 1011 |
| 227 | Ga0436364_0226015 | 3300037853 | Unclassified | 725 |
| 228 | Ga0436364_0245453 | 3300037853 | Bacteria | 1182 |
| 229 | Ga0436364_0280635 | 3300037853 | Bacteria | 1409 |
| 230 | Ga0436364_0297132 | 3300037853 | Bacteria | 839 |
| 231 | Ga0436364_0457930 | 3300037853 | Bacteria | 8284 |
| 232 | Ga0436364_0601128 | 3300037853 | Bacteria | 88345 |
| 233 | Ga0436364_0767563 | 3300037853 | Bacteria | 4482 |
| 234 | Ga0436364_0833005 | 3300037853 | Bacteria | 8565 |
| 235 | Ga0436364_0836434 | 3300037853 | Bacteria | 6134 |
| 236 | Ga0436364_0837803 | 3300037853 | Unclassified | 616 |
| 237 | Ga0436364_0838259 | 3300037853 | Bacteria | 2006 |
| 238 | Ga0436364_0931464 | 3300037853 | Bacteria | 2303 |
| 239 | Ga0436364_1001815 | 3300037853 | Bacteria | 911 |
| 240 | Ga0436364_1073870 | 3300037853 | Bacteria | 1275 |
| 241 | Ga0436364_1091499 | 3300037853 | Bacteria | 2278 |
| 242 | Ga0436364_1198079 | 3300037853 | Unclassified | 695 |
| 243 | Ga0436364_1294855 | 3300037853 | Bacteria | 862 |
| 244 | Ga0436364_1369713 | 3300037853 | Bacteria | 825 |
| 245 | Ga0436364_1397089 | 3300037853 | Bacteria | 1429 |
| 246 | Ga0436364_1432395 | 3300037853 | Bacteria | 1229 |
| 247 | Ga0436365_0068008 | 3300039437 | Bacteria | 17073 |
| 248 | Ga0436365_0101172 | 3300039437 | Bacteria | 10071 |
| 249 | Ga0436365_0234072 | 3300039437 | Bacteria | 1141 |
| 250 | Ga0436365_0268960 | 3300039437 | Unclassified | 528 |
| 251 | Ga0436365_1342949 | 3300039437 | Bacteria | 2327 |
| 252 | Ga0436365_1406589 | 3300039437 | Bacteria | 2068 |
| 253 | Ga0436365_1859137 | 3300039437 | Unclassified | 595 |
| 254 | Ga0436365_1868334 | 3300039437 | Bacteria | 1233 |
| 255 | Ga0436360_0559645 | 3300039438 | Bacteria | 7688 |
| 256 | Ga0436360_1345827 | 3300039438 | Unclassified | 502 |
| 257 | Ga0436361_0377638 | 3300039447 | Bacteria | 39633 |
| 258 | Ga0436361_0985588 | 3300039447 | Bacteria | 2513 |
| 259 | Ga0436361_1168680 | 3300039447 | Unclassified | 949 |
| 260 | Ga0436363_0423375 | 3300039450 | Bacteria | 1581 |
| 261 | Ga0436363_0973591 | 3300039450 | Bacteria | 1410 |
| 262 | Ga0436363_1595681 | 3300039450 | Bacteria | 788 |
| 263 | Ga0436362_0101726 | 3300039453 | Unclassified | 518 |
| 264 | Ga0436362_0145154 | 3300039453 | Bacteria | 818 |
| 265 | Ga0436362_0274019 | 3300039453 | Bacteria | 1546 |
| 266 | Ga0436362_0817581 | 3300039453 | Bacteria | 904 |
| 267 | Ga0436362_1205175 | 3300039453 | Bacteria | 2022 |
| 268 | Ga0436362_1290406 | 3300039453 | Bacteria | 872 |
| 269 | Ga0451577_1027507 | 3300042876 | Unclassified | 739 |
| 270 | Ga0451577_1031899 | 3300042876 | Bacteria | 738 |
| 271 | Ga0466963_0253558 | 3300044694 | Bacteria | 1235 |
| 272 | Ga0466963_0281516 | 3300044694 | Bacteria | 1169 |
| 273 | Ga0466963_0512465 | 3300044694 | Bacteria | 847 |
| 274 | Ga0453684_0005316 | 3300044712 | Bacteria | 25672 |
| 275 | Ga0466959_0487545 | 3300045049 | Bacteria | 834 |
| 276 | Ga0466959_0654813 | 3300045049 | Bacteria | 705 |
| 277 | Ga0466967_0458172 | 3300045976 | Bacteria | 1247 |
| 278 | Ga0466967_1043153 | 3300045976 | Unclassified | 814 |
| 279 | Ga0466967_1121791 | 3300045976 | Bacteria | 784 |
| 280 | Ga0495580_0003414 | 3300046472 | Bacteria | 13541 |
| 281 | Ga0495580_0133669 | 3300046472 | Bacteria | 1720 |
| 282 | Ga0495580_0166808 | 3300046472 | Bacteria | 1523 |
| 283 | Ga0495608_0261288 | 3300046511 | Bacteria | 1078 |
| 284 | Ga0495630_0812070 | 3300046517 | Bacteria | 714 |
| 285 | Ga0495665_0165379 | 3300046531 | Bacteria | 1152 |
| 286 | Ga0495587_0609343 | 3300046536 | Unclassified | 601 |
| 287 | Ga0495588_0474330 | 3300046674 | Unclassified | 656 |
| 288 | Ga0495623_0359374 | 3300046679 | Bacteria | 792 |
| 289 | Ga0495647_0321135 | 3300046681 | Bacteria | 701 |
| 290 | Ga0495613_0163039 | 3300046689 | Bacteria | 1585 |
| 291 | Ga0495613_0954921 | 3300046689 | Bacteria | 552 |
| 292 | Ga0495636_0569204 | 3300047318 | Bacteria | 552 |
| 293 | Ga0495684_0209593 | 3300047471 | Bacteria | 1434 |
| 294 | Ga0495684_0638935 | 3300047471 | Bacteria | 713 |
| 295 | Ga0495602_0659486 | 3300048088 | Bacteria | 714 |
| 296 | Ga0496106_1443298 | 3300048909 | Bacteria | 531 |
| 297 | Ga0496110_1029658 | 3300048913 | Unclassified | 731 |
| 298 | Ga0496114_0948500 | 3300048917 | Bacteria | 743 |
| 299 | Ga0496115_0022736 | 3300048918 | Bacteria | 4861 |
| 300 | Ga0496126_0047036 | 3300048929 | Bacteria | 3952 |
| 301 | Ga0501032_0132624 | 3300049569 | Bacteria | 1643 |
| 302 | Ga0501032_0347985 | 3300049569 | Unclassified | 955 |
| 303 | Ga0501033_0174882 | 3300049570 | Bacteria | 1541 |
| 304 | Ga0501034_0948189 | 3300049571 | Bacteria | 746 |
| 305 | Ga0501034_1111460 | 3300049571 | Unclassified | 671 |
| 306 | Ga0501037_0056898 | 3300049573 | Bacteria | 2856 |
| 307 | Ga0501037_0523755 | 3300049573 | Unclassified | 802 |
| 308 | Ga0501039_0721080 | 3300049575 | Bacteria | 779 |
| 309 | Ga0501042_0714325 | 3300049578 | Bacteria | 729 |
| 310 | Ga0501043_0423924 | 3300049579 | Bacteria | 1003 |
| 311 | Ga0501047_0012100 | 3300049581 | Bacteria | 8166 |
| 312 | Ga0501047_0528341 | 3300049581 | Bacteria | 1005 |
| 313 | Ga0501070_0029125 | 3300049586 | Bacteria | 4631 |
| 314 | Ga0501070_0386269 | 3300049586 | Unclassified | 1134 |
| 315 | Ga0501073_0029796 | 3300049589 | Bacteria | 3900 |
| 316 | Ga0501073_0363320 | 3300049589 | Unclassified | 1000 |
| 317 | Ga0501238_061524 | 3300049671 | Unclassified | 574 |
| 318 | Ga0501035_0018032 | 3300049822 | Bacteria | 6506 |
| 319 | Ga0501035_0197102 | 3300049822 | Bacteria | 1729 |
| 320 | Ga0501044_0000314 | 3300049823 | Bacteria | 61262 |
| 321 | Ga0501044_0001731 | 3300049823 | Bacteria | 25525 |
| 322 | Ga0501044_0064267 | 3300049823 | Bacteria | 3747 |
| 323 | Ga0501045_1285015 | 3300049824 | Bacteria | 533 |
| 324 | nmdc:mga06r32_1144444_c1 | 3300050510 | Unclassified | 726 |
| 325 | nmdc:mga0n895_1449641_c1 | 3300050512 | Bacteria | 654 |
| 326 | Ga0501082_1210703 | 3300060353 | Bacteria | 660 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10085011 | Ga0157370_100850114 | 96 |
| 2 | 3300014969 | Ga0157376_12530970 | Ga0157376_125309701 | 96 |
| 3 | 3300036647 | Ga0316582_1259725 | Ga0316582_1259725_108_434 | 98 |
| 4 | 3300031241 | Ga0265325_10201112 | Ga0265325_102011121 | 99 |
| 5 | 3300042876 | Ga0451577_1027507 | Ga0451577_1027507_339_641 | 99 |
| 6 | 3300044712 | Ga0453684_0005316 | Ga0453684_0005316_15235_15537 | 99 |
| 7 | 3300005327 | Ga0070658_10099841 | Ga0070658_100998411 | 100 |
| 8 | 3300005334 | Ga0068869_100750756 | Ga0068869_1007507562 | 100 |
| 9 | 3300005335 | Ga0070666_11263419 | Ga0070666_112634191 | 100 |
| 10 | 3300005339 | Ga0070660_100061391 | Ga0070660_1000613913 | 100 |
| 11 | 3300005344 | Ga0070661_100147419 | Ga0070661_1001474191 | 100 |
| 12 | 3300005344 | Ga0070661_100486084 | Ga0070661_1004860841 | 100 |
| 13 | 3300005355 | Ga0070671_100214619 | Ga0070671_1002146193 | 100 |
| 14 | 3300005458 | Ga0070681_10422202 | Ga0070681_104222023 | 100 |
| 15 | 3300005530 | Ga0070679_101340263 | Ga0070679_1013402631 | 100 |
| 16 | 3300005539 | Ga0068853_100345865 | Ga0068853_1003458652 | 100 |
| 17 | 3300005547 | Ga0070693_100101653 | Ga0070693_1001016533 | 100 |
| 18 | 3300005563 | Ga0068855_100007832 | Ga0068855_1000078322 | 100 |
| 19 | 3300005563 | Ga0068855_100420293 | Ga0068855_1004202932 | 100 |
| 20 | 3300005564 | Ga0070664_100051179 | Ga0070664_1000511793 | 100 |
| 21 | 3300005577 | Ga0068857_100003985 | Ga0068857_10000398510 | 100 |
| 22 | 3300005614 | Ga0068856_100067801 | Ga0068856_1000678015 | 100 |
| 23 | 3300005616 | Ga0068852_101193769 | Ga0068852_1011937692 | 100 |
| 24 | 3300005616 | Ga0068852_101762735 | Ga0068852_1017627352 | 100 |
| 25 | 3300005618 | Ga0068864_100024920 | Ga0068864_1000249205 | 100 |
| 26 | 3300005841 | Ga0068863_100031031 | Ga0068863_1000310313 | 100 |
| 27 | 3300006871 | Ga0075434_102461980 | Ga0075434_1024619802 | 100 |
| 28 | 3300009093 | Ga0105240_10006166 | Ga0105240_1000616618 | 100 |
| 29 | 3300009093 | Ga0105240_10893946 | Ga0105240_108939462 | 100 |
| 30 | 3300009098 | Ga0105245_10898902 | Ga0105245_108989022 | 100 |
| 31 | 3300009174 | Ga0105241_10909485 | Ga0105241_109094852 | 100 |
| 32 | 3300009174 | Ga0105241_10914607 | Ga0105241_109146072 | 100 |
| 33 | 3300009176 | Ga0105242_10638570 | Ga0105242_106385701 | 100 |
| 34 | 3300009176 | Ga0105242_11674566 | Ga0105242_116745662 | 100 |
| 35 | 3300009177 | Ga0105248_10279951 | Ga0105248_102799511 | 100 |
| 36 | 3300009545 | Ga0105237_10076056 | Ga0105237_100760563 | 100 |
| 37 | 3300009545 | Ga0105237_12372280 | Ga0105237_123722801 | 100 |
| 38 | 3300009551 | Ga0105238_10099786 | Ga0105238_100997864 | 100 |
| 39 | 3300009551 | Ga0105238_10357385 | Ga0105238_103573853 | 100 |
| 40 | 3300010375 | Ga0105239_10238696 | Ga0105239_102386963 | 100 |
| 41 | 3300010375 | Ga0105239_10374261 | Ga0105239_103742613 | 100 |
| 42 | 3300010375 | Ga0105239_11181057 | Ga0105239_111810572 | 100 |
| 43 | 3300013102 | Ga0157371_11480784 | Ga0157371_114807841 | 100 |
| 44 | 3300013104 | Ga0157370_10002904 | Ga0157370_1000290421 | 100 |
| 45 | 3300013104 | Ga0157370_10108276 | Ga0157370_101082762 | 100 |
| 46 | 3300013105 | Ga0157369_11385049 | Ga0157369_113850491 | 100 |
| 47 | 3300013306 | Ga0163162_10090746 | Ga0163162_100907464 | 100 |
| 48 | 3300013308 | Ga0157375_10138440 | Ga0157375_101384404 | 100 |
| 49 | 3300014325 | Ga0163163_10065440 | Ga0163163_100654404 | 100 |
| 50 | 3300015262 | Ga0182007_10198755 | Ga0182007_101987551 | 100 |
| 51 | 3300025909 | Ga0207705_10134416 | Ga0207705_101344162 | 100 |
| 52 | 3300025913 | Ga0207695_10001974 | Ga0207695_100019744 | 100 |
| 53 | 3300025913 | Ga0207695_10004561 | Ga0207695_1000456118 | 100 |
| 54 | 3300025917 | Ga0207660_10899222 | Ga0207660_108992222 | 100 |
| 55 | 3300025919 | Ga0207657_10021954 | Ga0207657_100219548 | 100 |
| 56 | 3300025920 | Ga0207649_10184029 | Ga0207649_101840293 | 100 |
| 57 | 3300025920 | Ga0207649_10410438 | Ga0207649_104104382 | 100 |
| 58 | 3300025921 | Ga0207652_11081205 | Ga0207652_110812052 | 100 |
| 59 | 3300025924 | Ga0207694_10867046 | Ga0207694_108670461 | 100 |
| 60 | 3300025927 | Ga0207687_10552629 | Ga0207687_105526293 | 100 |
| 61 | 3300025931 | Ga0207644_11669177 | Ga0207644_116691771 | 100 |
| 62 | 3300025941 | Ga0207711_10254791 | Ga0207711_102547913 | 100 |
| 63 | 3300025942 | Ga0207689_10589679 | Ga0207689_105896792 | 100 |
| 64 | 3300025949 | Ga0207667_10527005 | Ga0207667_105270051 | 100 |
| 65 | 3300025981 | Ga0207640_10103233 | Ga0207640_101032331 | 100 |
| 66 | 3300026035 | Ga0207703_11243608 | Ga0207703_112436081 | 100 |
| 67 | 3300026078 | Ga0207702_10043904 | Ga0207702_100439041 | 100 |
| 68 | 3300026088 | Ga0207641_10066670 | Ga0207641_100666704 | 100 |
| 69 | 3300026142 | Ga0207698_11777282 | Ga0207698_117772822 | 100 |
| 70 | 3300031595 | Ga0265313_10133719 | Ga0265313_101337191 | 100 |
| 71 | 3300039453 | Ga0436362_1290406 | Ga0436362_1290406_113_529 | 100 |
| 72 | 3300046472 | Ga0495580_0166808 | Ga0495580_0166808_959_1291 | 100 |
| 73 | 3300046674 | Ga0495588_0474330 | Ga0495588_0474330_67_399 | 100 |
| 74 | 3300046681 | Ga0495647_0321135 | Ga0495647_0321135_25_357 | 100 |
| 75 | 3300046689 | Ga0495613_0163039 | Ga0495613_0163039_1154_1486 | 100 |
| 76 | 3300047318 | Ga0495636_0569204 | Ga0495636_0569204_59_382 | 100 |
| 77 | 3300047471 | Ga0495684_0638935 | Ga0495684_0638935_300_632 | 100 |
| 78 | 3300048088 | Ga0495602_0659486 | Ga0495602_0659486_144_476 | 100 |
| 79 | 3300048909 | Ga0496106_1443298 | Ga0496106_1443298_150_482 | 100 |
| 80 | 3300050512 | nmdc:mga0n895_1449641_c1 | nmdc:mga0n895_1449641_c1_186_515 | 100 |
| 81 | 3300005455 | Ga0070663_100186304 | Ga0070663_1001863042 | 101 |
| 82 | 3300005539 | Ga0068853_100646420 | Ga0068853_1006464201 | 101 |
| 83 | 3300005614 | Ga0068856_101146917 | Ga0068856_1011469172 | 101 |
| 84 | 3300005842 | Ga0068858_101505774 | Ga0068858_1015057741 | 101 |
| 85 | 3300006844 | Ga0075428_102377375 | Ga0075428_1023773751 | 101 |
| 86 | 3300009545 | Ga0105237_11669851 | Ga0105237_116698512 | 101 |
| 87 | 3300009551 | Ga0105238_10155772 | Ga0105238_101557723 | 101 |
| 88 | 3300014969 | Ga0157376_11355092 | Ga0157376_113550922 | 101 |
| 89 | 3300025906 | Ga0207699_10574902 | Ga0207699_105749022 | 101 |
| 90 | 3300025924 | Ga0207694_10143144 | Ga0207694_101431443 | 101 |
| 91 | 3300026023 | Ga0207677_10155372 | Ga0207677_101553721 | 101 |
| 92 | 3300026035 | Ga0207703_11448066 | Ga0207703_114480662 | 101 |
| 93 | 3300026067 | Ga0207678_10066294 | Ga0207678_100662943 | 101 |
| 94 | 3300028379 | Ga0268266_10104211 | Ga0268266_101042113 | 101 |
| 95 | 3300048917 | Ga0496114_0948500 | Ga0496114_0948500_230_565 | 101 |
| 96 | 3300005455 | Ga0070663_100161455 | Ga0070663_1001614551 | 102 |
| 97 | 3300009177 | Ga0105248_10579917 | Ga0105248_105799173 | 102 |
| 98 | 3300013104 | Ga0157370_11025693 | Ga0157370_110256932 | 102 |
| 99 | 3300013105 | Ga0157369_10658956 | Ga0157369_106589562 | 102 |
| 100 | 3300021388 | Ga0213875_10012251 | Ga0213875_100122513 | 102 |
| 101 | 3300021388 | Ga0213875_10633782 | Ga0213875_106337821 | 102 |
| 102 | 3300025941 | Ga0207711_10488625 | Ga0207711_104886252 | 102 |
| 103 | 3300026067 | Ga0207678_10113586 | Ga0207678_101135863 | 102 |
| 104 | 3300035118 | Ga0373954_0047120 | Ga0373954_0047120_1169_1492 | 102 |
| 105 | 3300035119 | Ga0373956_0053805 | Ga0373956_0053805_1314_1637 | 102 |
| 106 | 3300035692 | Ga0373935_0394149 | Ga0373935_0394149_309_632 | 102 |
| 107 | 3300035695 | Ga0373927_0001450 | Ga0373927_0001450_13848_14171 | 102 |
| 108 | 3300035724 | Ga0373933_0558303 | Ga0373933_0558303_133_456 | 102 |
| 109 | 3300035725 | Ga0373947_0038514 | Ga0373947_0038514_641_964 | 102 |
| 110 | 3300036401 | Ga0373937_0026961 | Ga0373937_0026961_1413_1736 | 102 |
| 111 | 3300037068 | Ga0373925_0188390 | Ga0373925_0188390_706_1029 | 102 |
| 112 | 3300037853 | Ga0436364_0836434 | Ga0436364_0836434_5685_6011 | 102 |
| 113 | 3300037853 | Ga0436364_1369713 | Ga0436364_1369713_10_351 | 102 |
| 114 | 3300044694 | Ga0466963_0512465 | Ga0466963_0512465_240_581 | 102 |
| 115 | 3300045049 | Ga0466959_0487545 | Ga0466959_0487545_249_590 | 102 |
| 116 | 3300046472 | Ga0495580_0003414 | Ga0495580_0003414_12680_13003 | 102 |
| 117 | 3300046511 | Ga0495608_0261288 | Ga0495608_0261288_539_862 | 102 |
| 118 | 3300046517 | Ga0495630_0812070 | Ga0495630_0812070_343_666 | 102 |
| 119 | 3300046531 | Ga0495665_0165379 | Ga0495665_0165379_644_967 | 102 |
| 120 | 3300046536 | Ga0495587_0609343 | Ga0495587_0609343_202_525 | 102 |
| 121 | 3300046679 | Ga0495623_0359374 | Ga0495623_0359374_198_521 | 102 |
| 122 | 3300046689 | Ga0495613_0954921 | Ga0495613_0954921_95_418 | 102 |
| 123 | 3300047471 | Ga0495684_0209593 | Ga0495684_0209593_605_928 | 102 |
| 124 | 3300049578 | Ga0501042_0714325 | Ga0501042_0714325_84_404 | 102 |
| 125 | 3300049824 | Ga0501045_1285015 | Ga0501045_1285015_118_438 | 102 |
| 126 | 3300005339 | Ga0070660_100146040 | Ga0070660_1001460402 | 103 |
| 127 | 3300005344 | Ga0070661_100128174 | Ga0070661_1001281742 | 103 |
| 128 | 3300005354 | Ga0070675_100985661 | Ga0070675_1009856612 | 103 |
| 129 | 3300005356 | Ga0070674_102083335 | Ga0070674_1020833351 | 103 |
| 130 | 3300005364 | Ga0070673_100898478 | Ga0070673_1008984782 | 103 |
| 131 | 3300005366 | Ga0070659_100106791 | Ga0070659_1001067912 | 103 |
| 132 | 3300005435 | Ga0070714_101579772 | Ga0070714_1015797722 | 103 |
| 133 | 3300005439 | Ga0070711_100596085 | Ga0070711_1005960852 | 103 |
| 134 | 3300005456 | Ga0070678_100184680 | Ga0070678_1001846802 | 103 |
| 135 | 3300005456 | Ga0070678_100326250 | Ga0070678_1003262501 | 103 |
| 136 | 3300005456 | Ga0070678_101352110 | Ga0070678_1013521102 | 103 |
| 137 | 3300005539 | Ga0068853_100460247 | Ga0068853_1004602472 | 103 |
| 138 | 3300005563 | Ga0068855_100289979 | Ga0068855_1002899792 | 103 |
| 139 | 3300005564 | Ga0070664_100320457 | Ga0070664_1003204571 | 103 |
| 140 | 3300005564 | Ga0070664_100522839 | Ga0070664_1005228391 | 103 |
| 141 | 3300005614 | Ga0068856_100108089 | Ga0068856_1001080892 | 103 |
| 142 | 3300005614 | Ga0068856_101572426 | Ga0068856_1015724262 | 103 |
| 143 | 3300006028 | Ga0070717_10011438 | Ga0070717_100114383 | 103 |
| 144 | 3300006237 | Ga0097621_100119859 | Ga0097621_1001198592 | 103 |
| 145 | 3300009545 | Ga0105237_10461381 | Ga0105237_104613811 | 103 |
| 146 | 3300010375 | Ga0105239_10336375 | Ga0105239_103363752 | 103 |
| 147 | 3300013102 | Ga0157371_10415903 | Ga0157371_104159032 | 103 |
| 148 | 3300013104 | Ga0157370_10309726 | Ga0157370_103097262 | 103 |
| 149 | 3300013105 | Ga0157369_10007007 | Ga0157369_100070072 | 103 |
| 150 | 3300013105 | Ga0157369_10140498 | Ga0157369_101404982 | 103 |
| 151 | 3300013296 | Ga0157374_10005280 | Ga0157374_100052802 | 103 |
| 152 | 3300013307 | Ga0157372_10509356 | Ga0157372_105093562 | 103 |
| 153 | 3300013307 | Ga0157372_12284931 | Ga0157372_122849311 | 103 |
| 154 | 3300014969 | Ga0157376_10077246 | Ga0157376_100772462 | 103 |
| 155 | 3300021358 | Ga0213873_10282329 | Ga0213873_102823291 | 103 |
| 156 | 3300021384 | Ga0213876_10099165 | Ga0213876_100991651 | 103 |
| 157 | 3300021388 | Ga0213875_10012833 | Ga0213875_100128334 | 103 |
| 158 | 3300021388 | Ga0213875_10195875 | Ga0213875_101958752 | 103 |
| 159 | 3300021388 | Ga0213875_10652051 | Ga0213875_106520511 | 103 |
| 160 | 3300025919 | Ga0207657_10076829 | Ga0207657_100768291 | 103 |
| 161 | 3300025920 | Ga0207649_10099930 | Ga0207649_100999302 | 103 |
| 162 | 3300025928 | Ga0207700_12003263 | Ga0207700_120032631 | 103 |
| 163 | 3300025929 | Ga0207664_11320556 | Ga0207664_113205561 | 103 |
| 164 | 3300025932 | Ga0207690_10074609 | Ga0207690_100746092 | 103 |
| 165 | 3300025932 | Ga0207690_10168001 | Ga0207690_101680012 | 103 |
| 166 | 3300025936 | Ga0207670_11309583 | Ga0207670_113095831 | 103 |
| 167 | 3300025945 | Ga0207679_10128680 | Ga0207679_101286802 | 103 |
| 168 | 3300025949 | Ga0207667_10248369 | Ga0207667_102483692 | 103 |
| 169 | 3300025960 | Ga0207651_12125411 | Ga0207651_121254112 | 103 |
| 170 | 3300026023 | Ga0207677_11566951 | Ga0207677_115669512 | 103 |
| 171 | 3300026041 | Ga0207639_10339896 | Ga0207639_103398961 | 103 |
| 172 | 3300026078 | Ga0207702_10016322 | Ga0207702_100163223 | 103 |
| 173 | 3300026078 | Ga0207702_10289568 | Ga0207702_102895681 | 103 |
| 174 | 3300028379 | Ga0268266_10783672 | Ga0268266_107836722 | 103 |
| 175 | 3300037853 | Ga0436364_0132953 | Ga0436364_0132953_539_883 | 103 |
| 176 | 3300037853 | Ga0436364_0226015 | Ga0436364_0226015_104_442 | 103 |
| 177 | 3300037853 | Ga0436364_0767563 | Ga0436364_0767563_271_615 | 103 |
| 178 | 3300037853 | Ga0436364_1073870 | Ga0436364_1073870_391_735 | 103 |
| 179 | 3300037853 | Ga0436364_1198079 | Ga0436364_1198079_169_513 | 103 |
| 180 | 3300039437 | Ga0436365_0101172 | Ga0436365_0101172_6277_6621 | 103 |
| 181 | 3300039437 | Ga0436365_0268960 | Ga0436365_0268960_148_492 | 103 |
| 182 | 3300039437 | Ga0436365_1406589 | Ga0436365_1406589_1083_1427 | 103 |
| 183 | 3300039450 | Ga0436363_0423375 | Ga0436363_0423375_490_834 | 103 |
| 184 | 3300039453 | Ga0436362_1205175 | Ga0436362_1205175_590_934 | 103 |
| 185 | 3300048918 | Ga0496115_0022736 | Ga0496115_0022736_825_1169 | 103 |
| 186 | 3300060353 | Ga0501082_1210703 | Ga0501082_1210703_258_587 | 103 |
| 187 | 3300004803 | Ga0058862_12619578 | Ga0058862_126195782 | 104 |
| 188 | 3300005328 | Ga0070676_11248336 | Ga0070676_112483361 | 104 |
| 189 | 3300005329 | Ga0070683_100077339 | Ga0070683_1000773393 | 104 |
| 190 | 3300005329 | Ga0070683_100864192 | Ga0070683_1008641922 | 104 |
| 191 | 3300005345 | Ga0070692_10023895 | Ga0070692_100238951 | 104 |
| 192 | 3300005455 | Ga0070663_100781712 | Ga0070663_1007817121 | 104 |
| 193 | 3300005458 | Ga0070681_10256593 | Ga0070681_102565933 | 104 |
| 194 | 3300005530 | Ga0070679_100072729 | Ga0070679_1000727292 | 104 |
| 195 | 3300005530 | Ga0070679_100333742 | Ga0070679_1003337422 | 104 |
| 196 | 3300005535 | Ga0070684_100233245 | Ga0070684_1002332452 | 104 |
| 197 | 3300005535 | Ga0070684_100348129 | Ga0070684_1003481292 | 104 |
| 198 | 3300005548 | Ga0070665_100020189 | Ga0070665_1000201894 | 104 |
| 199 | 3300005841 | Ga0068863_100301934 | Ga0068863_1003019342 | 104 |
| 200 | 3300009093 | Ga0105240_10040196 | Ga0105240_100401964 | 104 |
| 201 | 3300009177 | Ga0105248_10360768 | Ga0105248_103607683 | 104 |
| 202 | 3300009177 | Ga0105248_10742905 | Ga0105248_107429052 | 104 |
| 203 | 3300009177 | Ga0105248_12125931 | Ga0105248_121259312 | 104 |
| 204 | 3300009551 | Ga0105238_10568699 | Ga0105238_105686992 | 104 |
| 205 | 3300013102 | Ga0157371_10554118 | Ga0157371_105541182 | 104 |
| 206 | 3300013102 | Ga0157371_10642851 | Ga0157371_106428511 | 104 |
| 207 | 3300013104 | Ga0157370_10202939 | Ga0157370_102029392 | 104 |
| 208 | 3300013104 | Ga0157370_10224531 | Ga0157370_102245312 | 104 |
| 209 | 3300013104 | Ga0157370_10376683 | Ga0157370_103766832 | 104 |
| 210 | 3300013105 | Ga0157369_10173443 | Ga0157369_101734432 | 104 |
| 211 | 3300013105 | Ga0157369_10432451 | Ga0157369_104324512 | 104 |
| 212 | 3300013297 | Ga0157378_11186634 | Ga0157378_111866341 | 104 |
| 213 | 3300013306 | Ga0163162_11086850 | Ga0163162_110868501 | 104 |
| 214 | 3300013307 | Ga0157372_11830840 | Ga0157372_118308401 | 104 |
| 215 | 3300020069 | Ga0197907_10373791 | Ga0197907_103737911 | 104 |
| 216 | 3300020076 | Ga0206355_1394900 | Ga0206355_13949002 | 104 |
| 217 | 3300020080 | Ga0206350_10163834 | Ga0206350_101638341 | 104 |
| 218 | 3300020610 | Ga0154015_1103909 | Ga0154015_11039091 | 104 |
| 219 | 3300021361 | Ga0213872_10329983 | Ga0213872_103299831 | 104 |
| 220 | 3300021384 | Ga0213876_10006886 | Ga0213876_100068863 | 104 |
| 221 | 3300021384 | Ga0213876_10019556 | Ga0213876_100195562 | 104 |
| 222 | 3300021388 | Ga0213875_10000005 | Ga0213875_10000005367 | 104 |
| 223 | 3300021388 | Ga0213875_10000032 | Ga0213875_1000003266 | 104 |
| 224 | 3300021388 | Ga0213875_10004701 | Ga0213875_100047018 | 104 |
| 225 | 3300021388 | Ga0213875_10034697 | Ga0213875_100346972 | 104 |
| 226 | 3300021388 | Ga0213875_10042572 | Ga0213875_100425721 | 104 |
| 227 | 3300021388 | Ga0213875_10075676 | Ga0213875_100756762 | 104 |
| 228 | 3300021388 | Ga0213875_10205237 | Ga0213875_102052371 | 104 |
| 229 | 3300021388 | Ga0213875_10337905 | Ga0213875_103379052 | 104 |
| 230 | 3300025904 | Ga0207647_10116807 | Ga0207647_101168071 | 104 |
| 231 | 3300025907 | Ga0207645_10979197 | Ga0207645_109791972 | 104 |
| 232 | 3300025912 | Ga0207707_10166522 | Ga0207707_101665222 | 104 |
| 233 | 3300025920 | Ga0207649_10741162 | Ga0207649_107411622 | 104 |
| 234 | 3300025921 | Ga0207652_10166205 | Ga0207652_101662052 | 104 |
| 235 | 3300025921 | Ga0207652_10290933 | Ga0207652_102909332 | 104 |
| 236 | 3300025941 | Ga0207711_10251549 | Ga0207711_102515493 | 104 |
| 237 | 3300025941 | Ga0207711_10561689 | Ga0207711_105616892 | 104 |
| 238 | 3300025944 | Ga0207661_10181608 | Ga0207661_101816082 | 104 |
| 239 | 3300025944 | Ga0207661_10691050 | Ga0207661_106910501 | 104 |
| 240 | 3300026023 | Ga0207677_10333313 | Ga0207677_103333132 | 104 |
| 241 | 3300026067 | Ga0207678_10558390 | Ga0207678_105583902 | 104 |
| 242 | 3300026067 | Ga0207678_12025826 | Ga0207678_120258261 | 104 |
| 243 | 3300026088 | Ga0207641_10712280 | Ga0207641_107122802 | 104 |
| 244 | 3300028379 | Ga0268266_10058313 | Ga0268266_100583132 | 104 |
| 245 | 3300035692 | Ga0373935_0054828 | Ga0373935_0054828_878_1225 | 104 |
| 246 | 3300035695 | Ga0373927_0858968 | Ga0373927_0858968_233_559 | 104 |
| 247 | 3300037418 | Ga0395900_1515576 | Ga0395900_1515576_161_529 | 104 |
| 248 | 3300037853 | Ga0436364_0115483 | Ga0436364_0115483_1454_1801 | 104 |
| 249 | 3300037853 | Ga0436364_0157811 | Ga0436364_0157811_159606_159953 | 104 |
| 250 | 3300037853 | Ga0436364_0167917 | Ga0436364_0167917_480_851 | 104 |
| 251 | 3300037853 | Ga0436364_0245453 | Ga0436364_0245453_302_649 | 104 |
| 252 | 3300037853 | Ga0436364_0280635 | Ga0436364_0280635_863_1210 | 104 |
| 253 | 3300037853 | Ga0436364_0457930 | Ga0436364_0457930_269_616 | 104 |
| 254 | 3300037853 | Ga0436364_0601128 | Ga0436364_0601128_74897_75244 | 104 |
| 255 | 3300037853 | Ga0436364_0833005 | Ga0436364_0833005_5214_5561 | 104 |
| 256 | 3300037853 | Ga0436364_0837803 | Ga0436364_0837803_65_427 | 104 |
| 257 | 3300037853 | Ga0436364_0838259 | Ga0436364_0838259_1087_1437 | 104 |
| 258 | 3300037853 | Ga0436364_0931464 | Ga0436364_0931464_1202_1564 | 104 |
| 259 | 3300037853 | Ga0436364_1001815 | Ga0436364_1001815_349_699 | 104 |
| 260 | 3300037853 | Ga0436364_1091499 | Ga0436364_1091499_1298_1648 | 104 |
| 261 | 3300037853 | Ga0436364_1294855 | Ga0436364_1294855_468_821 | 104 |
| 262 | 3300037853 | Ga0436364_1397089 | Ga0436364_1397089_501_851 | 104 |
| 263 | 3300037853 | Ga0436364_1432395 | Ga0436364_1432395_56_403 | 104 |
| 264 | 3300039437 | Ga0436365_0068008 | Ga0436365_0068008_9438_9788 | 104 |
| 265 | 3300039437 | Ga0436365_0234072 | Ga0436365_0234072_364_711 | 104 |
| 266 | 3300039437 | Ga0436365_1342949 | Ga0436365_1342949_351_698 | 104 |
| 267 | 3300039437 | Ga0436365_1868334 | Ga0436365_1868334_664_1011 | 104 |
| 268 | 3300039438 | Ga0436360_0559645 | Ga0436360_0559645_6659_7006 | 104 |
| 269 | 3300039438 | Ga0436360_1345827 | Ga0436360_1345827_93_443 | 104 |
| 270 | 3300039447 | Ga0436361_0377638 | Ga0436361_0377638_5301_5648 | 104 |
| 271 | 3300039447 | Ga0436361_0985588 | Ga0436361_0985588_948_1295 | 104 |
| 272 | 3300039447 | Ga0436361_1168680 | Ga0436361_1168680_97_444 | 104 |
| 273 | 3300039450 | Ga0436363_0973591 | Ga0436363_0973591_746_1099 | 104 |
| 274 | 3300039450 | Ga0436363_1595681 | Ga0436363_1595681_353_700 | 104 |
| 275 | 3300039453 | Ga0436362_0101726 | Ga0436362_0101726_103_450 | 104 |
| 276 | 3300039453 | Ga0436362_0145154 | Ga0436362_0145154_185_559 | 104 |
| 277 | 3300039453 | Ga0436362_0274019 | Ga0436362_0274019_454_801 | 104 |
| 278 | 3300042876 | Ga0451577_1031899 | Ga0451577_1031899_221_544 | 104 |
| 279 | 3300044694 | Ga0466963_0281516 | Ga0466963_0281516_296_643 | 104 |
| 280 | 3300045049 | Ga0466959_0654813 | Ga0466959_0654813_33_380 | 104 |
| 281 | 3300045976 | Ga0466967_1043153 | Ga0466967_1043153_332_679 | 104 |
| 282 | 3300045976 | Ga0466967_1121791 | Ga0466967_1121791_93_440 | 104 |
| 283 | 3300046472 | Ga0495580_0133669 | Ga0495580_0133669_236_583 | 104 |
| 284 | 3300048913 | Ga0496110_1029658 | Ga0496110_1029658_21_347 | 104 |
| 285 | 3300048929 | Ga0496126_0047036 | Ga0496126_0047036_2564_2911 | 104 |
| 286 | 3300049569 | Ga0501032_0132624 | Ga0501032_0132624_249_596 | 104 |
| 287 | 3300049569 | Ga0501032_0347985 | Ga0501032_0347985_196_543 | 104 |
| 288 | 3300049570 | Ga0501033_0174882 | Ga0501033_0174882_68_415 | 104 |
| 289 | 3300049571 | Ga0501034_0948189 | Ga0501034_0948189_46_393 | 104 |
| 290 | 3300049571 | Ga0501034_1111460 | Ga0501034_1111460_267_614 | 104 |
| 291 | 3300049573 | Ga0501037_0056898 | Ga0501037_0056898_928_1275 | 104 |
| 292 | 3300049573 | Ga0501037_0523755 | Ga0501037_0523755_367_714 | 104 |
| 293 | 3300049575 | Ga0501039_0721080 | Ga0501039_0721080_226_573 | 104 |
| 294 | 3300049579 | Ga0501043_0423924 | Ga0501043_0423924_589_936 | 104 |
| 295 | 3300049581 | Ga0501047_0012100 | Ga0501047_0012100_6879_7226 | 104 |
| 296 | 3300049581 | Ga0501047_0528341 | Ga0501047_0528341_16_363 | 104 |
| 297 | 3300049586 | Ga0501070_0029125 | Ga0501070_0029125_3938_4285 | 104 |
| 298 | 3300049586 | Ga0501070_0386269 | Ga0501070_0386269_487_834 | 104 |
| 299 | 3300049589 | Ga0501073_0029796 | Ga0501073_0029796_2709_3056 | 104 |
| 300 | 3300049589 | Ga0501073_0363320 | Ga0501073_0363320_410_757 | 104 |
| 301 | 3300049671 | Ga0501238_061524 | Ga0501238_061524_99_440 | 104 |
| 302 | 3300049822 | Ga0501035_0018032 | Ga0501035_0018032_5314_5661 | 104 |
| 303 | 3300049822 | Ga0501035_0197102 | Ga0501035_0197102_321_668 | 104 |
| 304 | 3300049823 | Ga0501044_0000314 | Ga0501044_0000314_34264_34611 | 104 |
| 305 | 3300049823 | Ga0501044_0001731 | Ga0501044_0001731_7395_7742 | 104 |
| 306 | 3300049823 | Ga0501044_0064267 | Ga0501044_0064267_2756_3103 | 104 |
| 307 | 3300005456 | Ga0070678_100281156 | Ga0070678_1002811562 | 106 |
| 308 | 3300005548 | Ga0070665_102590593 | Ga0070665_1025905932 | 106 |
| 309 | 3300005841 | Ga0068863_101103098 | Ga0068863_1011030982 | 106 |
| 310 | 3300009177 | Ga0105248_11877783 | Ga0105248_118777832 | 106 |
| 311 | 3300009177 | Ga0105248_12068741 | Ga0105248_120687411 | 106 |
| 312 | 3300013104 | Ga0157370_11668438 | Ga0157370_116684382 | 106 |
| 313 | 3300013306 | Ga0163162_11625323 | Ga0163162_116253233 | 106 |
| 314 | 3300026121 | Ga0207683_10607272 | Ga0207683_106072722 | 106 |
| 315 | 3300028379 | Ga0268266_10794558 | Ga0268266_107945582 | 106 |
| 316 | 3300031691 | Ga0316579_10528032 | Ga0316579_105280321 | 106 |
| 317 | 3300037853 | Ga0436364_0297132 | Ga0436364_0297132_469_822 | 106 |
| 318 | 3300039437 | Ga0436365_1859137 | Ga0436365_1859137_70_423 | 106 |
| 319 | 3300039453 | Ga0436362_0817581 | Ga0436362_0817581_328_681 | 106 |
| 320 | 3300044694 | Ga0466963_0253558 | Ga0466963_0253558_369_692 | 106 |
| 321 | 3300045976 | Ga0466967_0458172 | Ga0466967_0458172_857_1180 | 106 |
| 322 | 3300004798 | Ga0058859_11084040 | Ga0058859_110840402 | 107 |
| 323 | 3300005295 | Ga0065707_10652586 | Ga0065707_106525862 | 107 |
| 324 | 3300006844 | Ga0075428_101735439 | Ga0075428_1017354392 | 107 |
| 325 | 3300006847 | Ga0075431_100677795 | Ga0075431_1006777952 | 107 |
| 326 | 3300050510 | nmdc:mga06r32_1144444_c1 | nmdc:mga06r32_1144444_c1_204_527 | 107 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7d34-assembly1.cif.gz_B | atclps1-peptide complex | 0.9398 | 21 | 107 |
| 7ef7-assembly1.cif.gz_A | crystal structure of xanthosine monophosphate phosphatase complex with xmp | 0.9286 | 35 | 63 |
| 4o2x-assembly2.cif.gz_B | structure of a malarial protein | 0.9272 | 22 | 105 |
| 5cbf-assembly2.cif.gz_C | structural and functional characterization of a calcium-activated cation channel from tsukamurella paurometabola | 0.9245 | 35 | 60 |
| 7d34-assembly1.cif.gz_B | atclps1-peptide complex | 0.9058 | 21 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1rykA00 | Mainly Alpha;Orthogonal Bundle;Protein Yjbj; Chain: A;;YjbJ | 0.9619 | 34 | 63 | 1.10.1470.10 |
| 5cbgF00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.938 | 35 | 60 | 1.10.287.70 |
| af_A0A0R0IJ84_76_154_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9326 | 22 | 105 | 3.30.1390.10 |
| af_Q8IEB2_84_184_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.931 | 21 | 107 | 3.30.1390.10 |
| 5cbgC00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9294 | 35 | 60 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B0WAT3-F1-model_v4 | ATP-dependent Clp protease adaptor ClpS | 0.9666 | 21 | 106 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A4P5Y3L7-F1-model_v4 | ATP-dependent Clp protease ClpS | 0.9631 | 21 | 107 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A7C3SFC0-F1-model_v4 | ATP-dependent Clp protease adaptor ClpS | 0.9613 | 21 | 107 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A4Z0LTS9-F1-model_v4 | ATP-dependent Clp protease adaptor ClpS | 0.9573 | 21 | 107 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A7X6UXN4-F1-model_v4 | ATP-dependent Clp protease adaptor ClpS | 0.9569 | 19 | 107 |
GO:0006508
GO:0008233 GO:0030163 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar