F408250

General Info

Members Datasets Scaffolds Average Seq Length
326 157 326 112

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_101735439|Ga0075428_1017354392
Length 107
Sequence MAQTTFAEPEIDEEAGEELEKLYHVIILNDDEHSFDYVIEMLQDVFGFSYSTALAHTVEADATGSSIVKTCRLSEAESKRDQIHAYGADWRMPNSRGPVTALVEPAA

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.16
Metatranscriptomes 1.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.23
Rhizosphere 82.52
Stem 0
Stem Tuber 0
Unclassified 16.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_11084040 3300004798 Bacteria 897
2 Ga0058862_12619578 3300004803 Bacteria 1810
3 Ga0065707_10652586 3300005295 Bacteria 662
4 Ga0070658_10099841 3300005327 Bacteria 2398
5 Ga0070676_11248336 3300005328 Unclassified 566
6 Ga0070683_100077339 3300005329 Bacteria 3112
7 Ga0070683_100864192 3300005329 Archaea 867
8 Ga0068869_100750756 3300005334 Unclassified 835
9 Ga0070666_11263419 3300005335 Bacteria 550
10 Ga0070660_100061391 3300005339 Bacteria 2918
11 Ga0070660_100146040 3300005339 Unclassified 1900
12 Ga0070661_100128174 3300005344 Unclassified 1904
13 Ga0070661_100147419 3300005344 Bacteria 1777
14 Ga0070661_100486084 3300005344 Bacteria 987
15 Ga0070692_10023895 3300005345 Bacteria 2999
16 Ga0070675_100985661 3300005354 Bacteria 774
17 Ga0070671_100214619 3300005355 Bacteria 1632
18 Ga0070674_102083335 3300005356 Bacteria 517
19 Ga0070673_100898478 3300005364 Bacteria 821
20 Ga0070659_100106791 3300005366 Unclassified 2257
21 Ga0070714_101579772 3300005435 Unclassified 641
22 Ga0070711_100596085 3300005439 Unclassified 921
23 Ga0070663_100161455 3300005455 Bacteria 1725
24 Ga0070663_100186304 3300005455 Bacteria 1613
25 Ga0070663_100781712 3300005455 Bacteria 817
26 Ga0070678_100184680 3300005456 Unclassified 1710
27 Ga0070678_100281156 3300005456 Bacteria 1407
28 Ga0070678_100326250 3300005456 Unclassified 1312
29 Ga0070678_101352110 3300005456 Bacteria 664
30 Ga0070681_10256593 3300005458 Bacteria 1660
31 Ga0070681_10422202 3300005458 Bacteria 1245
32 Ga0070679_100072729 3300005530 Bacteria 3430
33 Ga0070679_100333742 3300005530 Bacteria 1465
34 Ga0070679_101340263 3300005530 Bacteria 661
35 Ga0070684_100233245 3300005535 Bacteria 1680
36 Ga0070684_100348129 3300005535 Bacteria 1363
37 Ga0068853_100345865 3300005539 Bacteria 1382
38 Ga0068853_100460247 3300005539 Unclassified 1197
39 Ga0068853_100646420 3300005539 Bacteria 1006
40 Ga0070693_100101653 3300005547 Bacteria 1752
41 Ga0070665_100020189 3300005548 Bacteria 6689
42 Ga0070665_102590593 3300005548 Unclassified 508
43 Ga0068855_100007832 3300005563 Bacteria 12909
44 Ga0068855_100289979 3300005563 Unclassified 1814
45 Ga0068855_100420293 3300005563 Bacteria 1462
46 Ga0070664_100051179 3300005564 Bacteria 3497
47 Ga0070664_100320457 3300005564 Unclassified 1404
48 Ga0070664_100522839 3300005564 Unclassified 1095
49 Ga0068857_100003985 3300005577 Bacteria 12436
50 Ga0068856_100067801 3300005614 Bacteria 3526
51 Ga0068856_100108089 3300005614 Unclassified 2778
52 Ga0068856_101146917 3300005614 Bacteria 794
53 Ga0068856_101572426 3300005614 Unclassified 671
54 Ga0068852_101193769 3300005616 Unclassified 782
55 Ga0068852_101762735 3300005616 Unclassified 642
56 Ga0068864_100024920 3300005618 Bacteria 5033
57 Ga0068863_100031031 3300005841 Bacteria 5103
58 Ga0068863_100301934 3300005841 Unclassified 1553
59 Ga0068863_101103098 3300005841 Bacteria 798
60 Ga0068858_101505774 3300005842 Bacteria 663
61 Ga0070717_10011438 3300006028 Bacteria 6741
62 Ga0097621_100119859 3300006237 Unclassified 2230
63 Ga0075428_101735439 3300006844 Unclassified 651
64 Ga0075428_102377375 3300006844 Bacteria 544
65 Ga0075431_100677795 3300006847 Unclassified 1010
66 Ga0075434_102461980 3300006871 Unclassified 522
67 Ga0105240_10006166 3300009093 Bacteria 17670
68 Ga0105240_10040196 3300009093 Bacteria 5986
69 Ga0105240_10893946 3300009093 Bacteria 956
70 Ga0105245_10898902 3300009098 Bacteria 927
71 Ga0105241_10909485 3300009174 Unclassified 818
72 Ga0105241_10914607 3300009174 Bacteria 816
73 Ga0105242_10638570 3300009176 Bacteria 1034
74 Ga0105242_11674566 3300009176 Bacteria 672
75 Ga0105248_10279951 3300009177 Bacteria 1878
76 Ga0105248_10360768 3300009177 Bacteria 1636
77 Ga0105248_10579917 3300009177 Bacteria 1265
78 Ga0105248_10742905 3300009177 Bacteria 1107
79 Ga0105248_11877783 3300009177 Unclassified 680
80 Ga0105248_12068741 3300009177 Bacteria 647
81 Ga0105248_12125931 3300009177 Unclassified 638
82 Ga0105237_10076056 3300009545 Bacteria 3348
83 Ga0105237_10461381 3300009545 Unclassified 1276
84 Ga0105237_11669851 3300009545 Bacteria 644
85 Ga0105237_12372280 3300009545 Unclassified 541
86 Ga0105238_10099786 3300009551 Bacteria 2886
87 Ga0105238_10155772 3300009551 Bacteria 2260
88 Ga0105238_10357385 3300009551 Bacteria 1450
89 Ga0105238_10568699 3300009551 Bacteria 1139
90 Ga0105239_10238696 3300010375 Bacteria 2040
91 Ga0105239_10336375 3300010375 Bacteria 1703
92 Ga0105239_10374261 3300010375 Bacteria 1610
93 Ga0105239_11181057 3300010375 Bacteria 882
94 Ga0157371_10415903 3300013102 Unclassified 985
95 Ga0157371_10554118 3300013102 Unclassified 852
96 Ga0157371_10642851 3300013102 Unclassified 791
97 Ga0157371_11480784 3300013102 Bacteria 529
98 Ga0157370_10002904 3300013104 Bacteria 20437
99 Ga0157370_10085011 3300013104 Bacteria 2972
100 Ga0157370_10108276 3300013104 Bacteria 2599
101 Ga0157370_10202939 3300013104 Bacteria 1839
102 Ga0157370_10224531 3300013104 Bacteria 1739
103 Ga0157370_10309726 3300013104 Bacteria 1457
104 Ga0157370_10376683 3300013104 Bacteria 1307
105 Ga0157370_11025693 3300013104 Bacteria 746
106 Ga0157370_11668438 3300013104 Unclassified 572
107 Ga0157369_10007007 3300013105 Bacteria 13007
108 Ga0157369_10140498 3300013105 Bacteria 2556
109 Ga0157369_10173443 3300013105 Bacteria 2271
110 Ga0157369_10432451 3300013105 Unclassified 1364
111 Ga0157369_10658956 3300013105 Bacteria 1079
112 Ga0157369_11385049 3300013105 Bacteria 716
113 Ga0157374_10005280 3300013296 Bacteria 10844
114 Ga0157378_11186634 3300013297 Bacteria 802
115 Ga0163162_10090746 3300013306 Bacteria 3137
116 Ga0163162_11086850 3300013306 Bacteria 906
117 Ga0163162_11625323 3300013306 Unclassified 737
118 Ga0157372_10509356 3300013307 Unclassified 1403
119 Ga0157372_11830840 3300013307 Unclassified 698
120 Ga0157372_12284931 3300013307 Unclassified 621
121 Ga0157375_10138440 3300013308 Bacteria 2559
122 Ga0163163_10065440 3300014325 Bacteria 3609
123 Ga0157376_10077246 3300014969 Unclassified 2848
124 Ga0157376_11355092 3300014969 Bacteria 742
125 Ga0157376_12530970 3300014969 Unclassified 553
126 Ga0182007_10198755 3300015262 Bacteria 700
127 Ga0197907_10373791 3300020069 Unclassified 1760
128 Ga0206355_1394900 3300020076 Unclassified 1068
129 Ga0206350_10163834 3300020080 Bacteria 1332
130 Ga0154015_1103909 3300020610 Unclassified 619
131 Ga0213873_10282329 3300021358 Unclassified 532
132 Ga0213872_10329983 3300021361 Bacteria 629
133 Ga0213876_10006886 3300021384 Bacteria 6197
134 Ga0213876_10019556 3300021384 Bacteria 3578
135 Ga0213876_10099165 3300021384 Bacteria 1544
136 Ga0213875_10000005 3300021388 Bacteria 595146
137 Ga0213875_10000032 3300021388 Bacteria 172918
138 Ga0213875_10004701 3300021388 Bacteria 7433
139 Ga0213875_10012251 3300021388 Bacteria 4242
140 Ga0213875_10012833 3300021388 Bacteria 4127
141 Ga0213875_10034697 3300021388 Bacteria 2382
142 Ga0213875_10042572 3300021388 Bacteria 2133
143 Ga0213875_10075676 3300021388 Bacteria 1571
144 Ga0213875_10195875 3300021388 Unclassified 950
145 Ga0213875_10205237 3300021388 Bacteria 927
146 Ga0213875_10337905 3300021388 Bacteria 715
147 Ga0213875_10633782 3300021388 Unclassified 517
148 Ga0213875_10652051 3300021388 Unclassified 510
149 Ga0207647_10116807 3300025904 Bacteria 1575
150 Ga0207699_10574902 3300025906 Unclassified 819
151 Ga0207645_10979197 3300025907 Unclassified 573
152 Ga0207705_10134416 3300025909 Bacteria 1843
153 Ga0207707_10166522 3300025912 Bacteria 1926
154 Ga0207695_10001974 3300025913 Bacteria 31730
155 Ga0207695_10004561 3300025913 Bacteria 18833
156 Ga0207660_10899222 3300025917 Bacteria 722
157 Ga0207657_10021954 3300025919 Bacteria 5993
158 Ga0207657_10076829 3300025919 Unclassified 2816
159 Ga0207649_10099930 3300025920 Unclassified 1918
160 Ga0207649_10184029 3300025920 Bacteria 1464
161 Ga0207649_10410438 3300025920 Bacteria 1015
162 Ga0207649_10741162 3300025920 Bacteria 764
163 Ga0207652_10166205 3300025921 Bacteria 1978
164 Ga0207652_10290933 3300025921 Bacteria 1474
165 Ga0207652_11081205 3300025921 Unclassified 702
166 Ga0207694_10143144 3300025924 Bacteria 1923
167 Ga0207694_10867046 3300025924 Bacteria 763
168 Ga0207687_10552629 3300025927 Bacteria 966
169 Ga0207700_12003263 3300025928 Unclassified 506
170 Ga0207664_11320556 3300025929 Unclassified 641
171 Ga0207644_11669177 3300025931 Bacteria 534
172 Ga0207690_10074609 3300025932 Unclassified 2350
173 Ga0207690_10168001 3300025932 Unclassified 1641
174 Ga0207670_11309583 3300025936 Bacteria 614
175 Ga0207711_10251549 3300025941 Bacteria 1623
176 Ga0207711_10254791 3300025941 Bacteria 1612
177 Ga0207711_10488625 3300025941 Bacteria 1147
178 Ga0207711_10561689 3300025941 Bacteria 1065
179 Ga0207689_10589679 3300025942 Unclassified 935
180 Ga0207661_10181608 3300025944 Bacteria 1838
181 Ga0207661_10691050 3300025944 Unclassified 938
182 Ga0207679_10128680 3300025945 Unclassified 2028
183 Ga0207667_10248369 3300025949 Unclassified 1820
184 Ga0207667_10527005 3300025949 Bacteria 1196
185 Ga0207651_12125411 3300025960 Bacteria 504
186 Ga0207640_10103233 3300025981 Bacteria 2004
187 Ga0207677_10155372 3300026023 Bacteria 1771
188 Ga0207677_10333313 3300026023 Bacteria 1265
189 Ga0207677_11566951 3300026023 Bacteria 609
190 Ga0207703_11243608 3300026035 Unclassified 716
191 Ga0207703_11448066 3300026035 Bacteria 661
192 Ga0207639_10339896 3300026041 Unclassified 1338
193 Ga0207678_10066294 3300026067 Bacteria 3101
194 Ga0207678_10113586 3300026067 Bacteria 2311
195 Ga0207678_10558390 3300026067 Bacteria 1002
196 Ga0207678_12025826 3300026067 Unclassified 501
197 Ga0207702_10016322 3300026078 Bacteria 6146
198 Ga0207702_10043904 3300026078 Bacteria 3755
199 Ga0207702_10289568 3300026078 Unclassified 1551
200 Ga0207641_10066670 3300026088 Bacteria 3081
201 Ga0207641_10712280 3300026088 Unclassified 989
202 Ga0207683_10607272 3300026121 Unclassified 1013
203 Ga0207698_11777282 3300026142 Unclassified 632
204 Ga0268266_10058313 3300028379 Bacteria 3324
205 Ga0268266_10104211 3300028379 Bacteria 2504
206 Ga0268266_10783672 3300028379 Bacteria 921
207 Ga0268266_10794558 3300028379 Unclassified 914
208 Ga0265325_10201112 3300031241 Bacteria 919
209 Ga0265313_10133719 3300031595 Bacteria 1072
210 Ga0316579_10528032 3300031691 Unclassified 571
211 Ga0373954_0047120 3300035118 Bacteria 2016
212 Ga0373956_0053805 3300035119 Bacteria 1813
213 Ga0373935_0054828 3300035692 Bacteria 2540
214 Ga0373935_0394149 3300035692 Bacteria 993
215 Ga0373927_0001450 3300035695 Bacteria 17885
216 Ga0373927_0858968 3300035695 Unclassified 599
217 Ga0373933_0558303 3300035724 Bacteria 751
218 Ga0373947_0038514 3300035725 Bacteria 2841
219 Ga0373937_0026961 3300036401 Bacteria 5194
220 Ga0316582_1259725 3300036647 Bacteria 503
221 Ga0373925_0188390 3300037068 Bacteria 1636
222 Ga0395900_1515576 3300037418 Unclassified 582
223 Ga0436364_0115483 3300037853 Bacteria 5634
224 Ga0436364_0132953 3300037853 Bacteria 5490
225 Ga0436364_0157811 3300037853 Bacteria 430293
226 Ga0436364_0167917 3300037853 Bacteria 1011
227 Ga0436364_0226015 3300037853 Unclassified 725
228 Ga0436364_0245453 3300037853 Bacteria 1182
229 Ga0436364_0280635 3300037853 Bacteria 1409
230 Ga0436364_0297132 3300037853 Bacteria 839
231 Ga0436364_0457930 3300037853 Bacteria 8284
232 Ga0436364_0601128 3300037853 Bacteria 88345
233 Ga0436364_0767563 3300037853 Bacteria 4482
234 Ga0436364_0833005 3300037853 Bacteria 8565
235 Ga0436364_0836434 3300037853 Bacteria 6134
236 Ga0436364_0837803 3300037853 Unclassified 616
237 Ga0436364_0838259 3300037853 Bacteria 2006
238 Ga0436364_0931464 3300037853 Bacteria 2303
239 Ga0436364_1001815 3300037853 Bacteria 911
240 Ga0436364_1073870 3300037853 Bacteria 1275
241 Ga0436364_1091499 3300037853 Bacteria 2278
242 Ga0436364_1198079 3300037853 Unclassified 695
243 Ga0436364_1294855 3300037853 Bacteria 862
244 Ga0436364_1369713 3300037853 Bacteria 825
245 Ga0436364_1397089 3300037853 Bacteria 1429
246 Ga0436364_1432395 3300037853 Bacteria 1229
247 Ga0436365_0068008 3300039437 Bacteria 17073
248 Ga0436365_0101172 3300039437 Bacteria 10071
249 Ga0436365_0234072 3300039437 Bacteria 1141
250 Ga0436365_0268960 3300039437 Unclassified 528
251 Ga0436365_1342949 3300039437 Bacteria 2327
252 Ga0436365_1406589 3300039437 Bacteria 2068
253 Ga0436365_1859137 3300039437 Unclassified 595
254 Ga0436365_1868334 3300039437 Bacteria 1233
255 Ga0436360_0559645 3300039438 Bacteria 7688
256 Ga0436360_1345827 3300039438 Unclassified 502
257 Ga0436361_0377638 3300039447 Bacteria 39633
258 Ga0436361_0985588 3300039447 Bacteria 2513
259 Ga0436361_1168680 3300039447 Unclassified 949
260 Ga0436363_0423375 3300039450 Bacteria 1581
261 Ga0436363_0973591 3300039450 Bacteria 1410
262 Ga0436363_1595681 3300039450 Bacteria 788
263 Ga0436362_0101726 3300039453 Unclassified 518
264 Ga0436362_0145154 3300039453 Bacteria 818
265 Ga0436362_0274019 3300039453 Bacteria 1546
266 Ga0436362_0817581 3300039453 Bacteria 904
267 Ga0436362_1205175 3300039453 Bacteria 2022
268 Ga0436362_1290406 3300039453 Bacteria 872
269 Ga0451577_1027507 3300042876 Unclassified 739
270 Ga0451577_1031899 3300042876 Bacteria 738
271 Ga0466963_0253558 3300044694 Bacteria 1235
272 Ga0466963_0281516 3300044694 Bacteria 1169
273 Ga0466963_0512465 3300044694 Bacteria 847
274 Ga0453684_0005316 3300044712 Bacteria 25672
275 Ga0466959_0487545 3300045049 Bacteria 834
276 Ga0466959_0654813 3300045049 Bacteria 705
277 Ga0466967_0458172 3300045976 Bacteria 1247
278 Ga0466967_1043153 3300045976 Unclassified 814
279 Ga0466967_1121791 3300045976 Bacteria 784
280 Ga0495580_0003414 3300046472 Bacteria 13541
281 Ga0495580_0133669 3300046472 Bacteria 1720
282 Ga0495580_0166808 3300046472 Bacteria 1523
283 Ga0495608_0261288 3300046511 Bacteria 1078
284 Ga0495630_0812070 3300046517 Bacteria 714
285 Ga0495665_0165379 3300046531 Bacteria 1152
286 Ga0495587_0609343 3300046536 Unclassified 601
287 Ga0495588_0474330 3300046674 Unclassified 656
288 Ga0495623_0359374 3300046679 Bacteria 792
289 Ga0495647_0321135 3300046681 Bacteria 701
290 Ga0495613_0163039 3300046689 Bacteria 1585
291 Ga0495613_0954921 3300046689 Bacteria 552
292 Ga0495636_0569204 3300047318 Bacteria 552
293 Ga0495684_0209593 3300047471 Bacteria 1434
294 Ga0495684_0638935 3300047471 Bacteria 713
295 Ga0495602_0659486 3300048088 Bacteria 714
296 Ga0496106_1443298 3300048909 Bacteria 531
297 Ga0496110_1029658 3300048913 Unclassified 731
298 Ga0496114_0948500 3300048917 Bacteria 743
299 Ga0496115_0022736 3300048918 Bacteria 4861
300 Ga0496126_0047036 3300048929 Bacteria 3952
301 Ga0501032_0132624 3300049569 Bacteria 1643
302 Ga0501032_0347985 3300049569 Unclassified 955
303 Ga0501033_0174882 3300049570 Bacteria 1541
304 Ga0501034_0948189 3300049571 Bacteria 746
305 Ga0501034_1111460 3300049571 Unclassified 671
306 Ga0501037_0056898 3300049573 Bacteria 2856
307 Ga0501037_0523755 3300049573 Unclassified 802
308 Ga0501039_0721080 3300049575 Bacteria 779
309 Ga0501042_0714325 3300049578 Bacteria 729
310 Ga0501043_0423924 3300049579 Bacteria 1003
311 Ga0501047_0012100 3300049581 Bacteria 8166
312 Ga0501047_0528341 3300049581 Bacteria 1005
313 Ga0501070_0029125 3300049586 Bacteria 4631
314 Ga0501070_0386269 3300049586 Unclassified 1134
315 Ga0501073_0029796 3300049589 Bacteria 3900
316 Ga0501073_0363320 3300049589 Unclassified 1000
317 Ga0501238_061524 3300049671 Unclassified 574
318 Ga0501035_0018032 3300049822 Bacteria 6506
319 Ga0501035_0197102 3300049822 Bacteria 1729
320 Ga0501044_0000314 3300049823 Bacteria 61262
321 Ga0501044_0001731 3300049823 Bacteria 25525
322 Ga0501044_0064267 3300049823 Bacteria 3747
323 Ga0501045_1285015 3300049824 Bacteria 533
324 nmdc:mga06r32_1144444_c1 3300050510 Unclassified 726
325 nmdc:mga0n895_1449641_c1 3300050512 Bacteria 654
326 Ga0501082_1210703 3300060353 Bacteria 660

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10085011 Ga0157370_100850114 96
2 3300014969 Ga0157376_12530970 Ga0157376_125309701 96
3 3300036647 Ga0316582_1259725 Ga0316582_1259725_108_434 98
4 3300031241 Ga0265325_10201112 Ga0265325_102011121 99
5 3300042876 Ga0451577_1027507 Ga0451577_1027507_339_641 99
6 3300044712 Ga0453684_0005316 Ga0453684_0005316_15235_15537 99
7 3300005327 Ga0070658_10099841 Ga0070658_100998411 100
8 3300005334 Ga0068869_100750756 Ga0068869_1007507562 100
9 3300005335 Ga0070666_11263419 Ga0070666_112634191 100
10 3300005339 Ga0070660_100061391 Ga0070660_1000613913 100
11 3300005344 Ga0070661_100147419 Ga0070661_1001474191 100
12 3300005344 Ga0070661_100486084 Ga0070661_1004860841 100
13 3300005355 Ga0070671_100214619 Ga0070671_1002146193 100
14 3300005458 Ga0070681_10422202 Ga0070681_104222023 100
15 3300005530 Ga0070679_101340263 Ga0070679_1013402631 100
16 3300005539 Ga0068853_100345865 Ga0068853_1003458652 100
17 3300005547 Ga0070693_100101653 Ga0070693_1001016533 100
18 3300005563 Ga0068855_100007832 Ga0068855_1000078322 100
19 3300005563 Ga0068855_100420293 Ga0068855_1004202932 100
20 3300005564 Ga0070664_100051179 Ga0070664_1000511793 100
21 3300005577 Ga0068857_100003985 Ga0068857_10000398510 100
22 3300005614 Ga0068856_100067801 Ga0068856_1000678015 100
23 3300005616 Ga0068852_101193769 Ga0068852_1011937692 100
24 3300005616 Ga0068852_101762735 Ga0068852_1017627352 100
25 3300005618 Ga0068864_100024920 Ga0068864_1000249205 100
26 3300005841 Ga0068863_100031031 Ga0068863_1000310313 100
27 3300006871 Ga0075434_102461980 Ga0075434_1024619802 100
28 3300009093 Ga0105240_10006166 Ga0105240_1000616618 100
29 3300009093 Ga0105240_10893946 Ga0105240_108939462 100
30 3300009098 Ga0105245_10898902 Ga0105245_108989022 100
31 3300009174 Ga0105241_10909485 Ga0105241_109094852 100
32 3300009174 Ga0105241_10914607 Ga0105241_109146072 100
33 3300009176 Ga0105242_10638570 Ga0105242_106385701 100
34 3300009176 Ga0105242_11674566 Ga0105242_116745662 100
35 3300009177 Ga0105248_10279951 Ga0105248_102799511 100
36 3300009545 Ga0105237_10076056 Ga0105237_100760563 100
37 3300009545 Ga0105237_12372280 Ga0105237_123722801 100
38 3300009551 Ga0105238_10099786 Ga0105238_100997864 100
39 3300009551 Ga0105238_10357385 Ga0105238_103573853 100
40 3300010375 Ga0105239_10238696 Ga0105239_102386963 100
41 3300010375 Ga0105239_10374261 Ga0105239_103742613 100
42 3300010375 Ga0105239_11181057 Ga0105239_111810572 100
43 3300013102 Ga0157371_11480784 Ga0157371_114807841 100
44 3300013104 Ga0157370_10002904 Ga0157370_1000290421 100
45 3300013104 Ga0157370_10108276 Ga0157370_101082762 100
46 3300013105 Ga0157369_11385049 Ga0157369_113850491 100
47 3300013306 Ga0163162_10090746 Ga0163162_100907464 100
48 3300013308 Ga0157375_10138440 Ga0157375_101384404 100
49 3300014325 Ga0163163_10065440 Ga0163163_100654404 100
50 3300015262 Ga0182007_10198755 Ga0182007_101987551 100
51 3300025909 Ga0207705_10134416 Ga0207705_101344162 100
52 3300025913 Ga0207695_10001974 Ga0207695_100019744 100
53 3300025913 Ga0207695_10004561 Ga0207695_1000456118 100
54 3300025917 Ga0207660_10899222 Ga0207660_108992222 100
55 3300025919 Ga0207657_10021954 Ga0207657_100219548 100
56 3300025920 Ga0207649_10184029 Ga0207649_101840293 100
57 3300025920 Ga0207649_10410438 Ga0207649_104104382 100
58 3300025921 Ga0207652_11081205 Ga0207652_110812052 100
59 3300025924 Ga0207694_10867046 Ga0207694_108670461 100
60 3300025927 Ga0207687_10552629 Ga0207687_105526293 100
61 3300025931 Ga0207644_11669177 Ga0207644_116691771 100
62 3300025941 Ga0207711_10254791 Ga0207711_102547913 100
63 3300025942 Ga0207689_10589679 Ga0207689_105896792 100
64 3300025949 Ga0207667_10527005 Ga0207667_105270051 100
65 3300025981 Ga0207640_10103233 Ga0207640_101032331 100
66 3300026035 Ga0207703_11243608 Ga0207703_112436081 100
67 3300026078 Ga0207702_10043904 Ga0207702_100439041 100
68 3300026088 Ga0207641_10066670 Ga0207641_100666704 100
69 3300026142 Ga0207698_11777282 Ga0207698_117772822 100
70 3300031595 Ga0265313_10133719 Ga0265313_101337191 100
71 3300039453 Ga0436362_1290406 Ga0436362_1290406_113_529 100
72 3300046472 Ga0495580_0166808 Ga0495580_0166808_959_1291 100
73 3300046674 Ga0495588_0474330 Ga0495588_0474330_67_399 100
74 3300046681 Ga0495647_0321135 Ga0495647_0321135_25_357 100
75 3300046689 Ga0495613_0163039 Ga0495613_0163039_1154_1486 100
76 3300047318 Ga0495636_0569204 Ga0495636_0569204_59_382 100
77 3300047471 Ga0495684_0638935 Ga0495684_0638935_300_632 100
78 3300048088 Ga0495602_0659486 Ga0495602_0659486_144_476 100
79 3300048909 Ga0496106_1443298 Ga0496106_1443298_150_482 100
80 3300050512 nmdc:mga0n895_1449641_c1 nmdc:mga0n895_1449641_c1_186_515 100
81 3300005455 Ga0070663_100186304 Ga0070663_1001863042 101
82 3300005539 Ga0068853_100646420 Ga0068853_1006464201 101
83 3300005614 Ga0068856_101146917 Ga0068856_1011469172 101
84 3300005842 Ga0068858_101505774 Ga0068858_1015057741 101
85 3300006844 Ga0075428_102377375 Ga0075428_1023773751 101
86 3300009545 Ga0105237_11669851 Ga0105237_116698512 101
87 3300009551 Ga0105238_10155772 Ga0105238_101557723 101
88 3300014969 Ga0157376_11355092 Ga0157376_113550922 101
89 3300025906 Ga0207699_10574902 Ga0207699_105749022 101
90 3300025924 Ga0207694_10143144 Ga0207694_101431443 101
91 3300026023 Ga0207677_10155372 Ga0207677_101553721 101
92 3300026035 Ga0207703_11448066 Ga0207703_114480662 101
93 3300026067 Ga0207678_10066294 Ga0207678_100662943 101
94 3300028379 Ga0268266_10104211 Ga0268266_101042113 101
95 3300048917 Ga0496114_0948500 Ga0496114_0948500_230_565 101
96 3300005455 Ga0070663_100161455 Ga0070663_1001614551 102
97 3300009177 Ga0105248_10579917 Ga0105248_105799173 102
98 3300013104 Ga0157370_11025693 Ga0157370_110256932 102
99 3300013105 Ga0157369_10658956 Ga0157369_106589562 102
100 3300021388 Ga0213875_10012251 Ga0213875_100122513 102
101 3300021388 Ga0213875_10633782 Ga0213875_106337821 102
102 3300025941 Ga0207711_10488625 Ga0207711_104886252 102
103 3300026067 Ga0207678_10113586 Ga0207678_101135863 102
104 3300035118 Ga0373954_0047120 Ga0373954_0047120_1169_1492 102
105 3300035119 Ga0373956_0053805 Ga0373956_0053805_1314_1637 102
106 3300035692 Ga0373935_0394149 Ga0373935_0394149_309_632 102
107 3300035695 Ga0373927_0001450 Ga0373927_0001450_13848_14171 102
108 3300035724 Ga0373933_0558303 Ga0373933_0558303_133_456 102
109 3300035725 Ga0373947_0038514 Ga0373947_0038514_641_964 102
110 3300036401 Ga0373937_0026961 Ga0373937_0026961_1413_1736 102
111 3300037068 Ga0373925_0188390 Ga0373925_0188390_706_1029 102
112 3300037853 Ga0436364_0836434 Ga0436364_0836434_5685_6011 102
113 3300037853 Ga0436364_1369713 Ga0436364_1369713_10_351 102
114 3300044694 Ga0466963_0512465 Ga0466963_0512465_240_581 102
115 3300045049 Ga0466959_0487545 Ga0466959_0487545_249_590 102
116 3300046472 Ga0495580_0003414 Ga0495580_0003414_12680_13003 102
117 3300046511 Ga0495608_0261288 Ga0495608_0261288_539_862 102
118 3300046517 Ga0495630_0812070 Ga0495630_0812070_343_666 102
119 3300046531 Ga0495665_0165379 Ga0495665_0165379_644_967 102
120 3300046536 Ga0495587_0609343 Ga0495587_0609343_202_525 102
121 3300046679 Ga0495623_0359374 Ga0495623_0359374_198_521 102
122 3300046689 Ga0495613_0954921 Ga0495613_0954921_95_418 102
123 3300047471 Ga0495684_0209593 Ga0495684_0209593_605_928 102
124 3300049578 Ga0501042_0714325 Ga0501042_0714325_84_404 102
125 3300049824 Ga0501045_1285015 Ga0501045_1285015_118_438 102
126 3300005339 Ga0070660_100146040 Ga0070660_1001460402 103
127 3300005344 Ga0070661_100128174 Ga0070661_1001281742 103
128 3300005354 Ga0070675_100985661 Ga0070675_1009856612 103
129 3300005356 Ga0070674_102083335 Ga0070674_1020833351 103
130 3300005364 Ga0070673_100898478 Ga0070673_1008984782 103
131 3300005366 Ga0070659_100106791 Ga0070659_1001067912 103
132 3300005435 Ga0070714_101579772 Ga0070714_1015797722 103
133 3300005439 Ga0070711_100596085 Ga0070711_1005960852 103
134 3300005456 Ga0070678_100184680 Ga0070678_1001846802 103
135 3300005456 Ga0070678_100326250 Ga0070678_1003262501 103
136 3300005456 Ga0070678_101352110 Ga0070678_1013521102 103
137 3300005539 Ga0068853_100460247 Ga0068853_1004602472 103
138 3300005563 Ga0068855_100289979 Ga0068855_1002899792 103
139 3300005564 Ga0070664_100320457 Ga0070664_1003204571 103
140 3300005564 Ga0070664_100522839 Ga0070664_1005228391 103
141 3300005614 Ga0068856_100108089 Ga0068856_1001080892 103
142 3300005614 Ga0068856_101572426 Ga0068856_1015724262 103
143 3300006028 Ga0070717_10011438 Ga0070717_100114383 103
144 3300006237 Ga0097621_100119859 Ga0097621_1001198592 103
145 3300009545 Ga0105237_10461381 Ga0105237_104613811 103
146 3300010375 Ga0105239_10336375 Ga0105239_103363752 103
147 3300013102 Ga0157371_10415903 Ga0157371_104159032 103
148 3300013104 Ga0157370_10309726 Ga0157370_103097262 103
149 3300013105 Ga0157369_10007007 Ga0157369_100070072 103
150 3300013105 Ga0157369_10140498 Ga0157369_101404982 103
151 3300013296 Ga0157374_10005280 Ga0157374_100052802 103
152 3300013307 Ga0157372_10509356 Ga0157372_105093562 103
153 3300013307 Ga0157372_12284931 Ga0157372_122849311 103
154 3300014969 Ga0157376_10077246 Ga0157376_100772462 103
155 3300021358 Ga0213873_10282329 Ga0213873_102823291 103
156 3300021384 Ga0213876_10099165 Ga0213876_100991651 103
157 3300021388 Ga0213875_10012833 Ga0213875_100128334 103
158 3300021388 Ga0213875_10195875 Ga0213875_101958752 103
159 3300021388 Ga0213875_10652051 Ga0213875_106520511 103
160 3300025919 Ga0207657_10076829 Ga0207657_100768291 103
161 3300025920 Ga0207649_10099930 Ga0207649_100999302 103
162 3300025928 Ga0207700_12003263 Ga0207700_120032631 103
163 3300025929 Ga0207664_11320556 Ga0207664_113205561 103
164 3300025932 Ga0207690_10074609 Ga0207690_100746092 103
165 3300025932 Ga0207690_10168001 Ga0207690_101680012 103
166 3300025936 Ga0207670_11309583 Ga0207670_113095831 103
167 3300025945 Ga0207679_10128680 Ga0207679_101286802 103
168 3300025949 Ga0207667_10248369 Ga0207667_102483692 103
169 3300025960 Ga0207651_12125411 Ga0207651_121254112 103
170 3300026023 Ga0207677_11566951 Ga0207677_115669512 103
171 3300026041 Ga0207639_10339896 Ga0207639_103398961 103
172 3300026078 Ga0207702_10016322 Ga0207702_100163223 103
173 3300026078 Ga0207702_10289568 Ga0207702_102895681 103
174 3300028379 Ga0268266_10783672 Ga0268266_107836722 103
175 3300037853 Ga0436364_0132953 Ga0436364_0132953_539_883 103
176 3300037853 Ga0436364_0226015 Ga0436364_0226015_104_442 103
177 3300037853 Ga0436364_0767563 Ga0436364_0767563_271_615 103
178 3300037853 Ga0436364_1073870 Ga0436364_1073870_391_735 103
179 3300037853 Ga0436364_1198079 Ga0436364_1198079_169_513 103
180 3300039437 Ga0436365_0101172 Ga0436365_0101172_6277_6621 103
181 3300039437 Ga0436365_0268960 Ga0436365_0268960_148_492 103
182 3300039437 Ga0436365_1406589 Ga0436365_1406589_1083_1427 103
183 3300039450 Ga0436363_0423375 Ga0436363_0423375_490_834 103
184 3300039453 Ga0436362_1205175 Ga0436362_1205175_590_934 103
185 3300048918 Ga0496115_0022736 Ga0496115_0022736_825_1169 103
186 3300060353 Ga0501082_1210703 Ga0501082_1210703_258_587 103
187 3300004803 Ga0058862_12619578 Ga0058862_126195782 104
188 3300005328 Ga0070676_11248336 Ga0070676_112483361 104
189 3300005329 Ga0070683_100077339 Ga0070683_1000773393 104
190 3300005329 Ga0070683_100864192 Ga0070683_1008641922 104
191 3300005345 Ga0070692_10023895 Ga0070692_100238951 104
192 3300005455 Ga0070663_100781712 Ga0070663_1007817121 104
193 3300005458 Ga0070681_10256593 Ga0070681_102565933 104
194 3300005530 Ga0070679_100072729 Ga0070679_1000727292 104
195 3300005530 Ga0070679_100333742 Ga0070679_1003337422 104
196 3300005535 Ga0070684_100233245 Ga0070684_1002332452 104
197 3300005535 Ga0070684_100348129 Ga0070684_1003481292 104
198 3300005548 Ga0070665_100020189 Ga0070665_1000201894 104
199 3300005841 Ga0068863_100301934 Ga0068863_1003019342 104
200 3300009093 Ga0105240_10040196 Ga0105240_100401964 104
201 3300009177 Ga0105248_10360768 Ga0105248_103607683 104
202 3300009177 Ga0105248_10742905 Ga0105248_107429052 104
203 3300009177 Ga0105248_12125931 Ga0105248_121259312 104
204 3300009551 Ga0105238_10568699 Ga0105238_105686992 104
205 3300013102 Ga0157371_10554118 Ga0157371_105541182 104
206 3300013102 Ga0157371_10642851 Ga0157371_106428511 104
207 3300013104 Ga0157370_10202939 Ga0157370_102029392 104
208 3300013104 Ga0157370_10224531 Ga0157370_102245312 104
209 3300013104 Ga0157370_10376683 Ga0157370_103766832 104
210 3300013105 Ga0157369_10173443 Ga0157369_101734432 104
211 3300013105 Ga0157369_10432451 Ga0157369_104324512 104
212 3300013297 Ga0157378_11186634 Ga0157378_111866341 104
213 3300013306 Ga0163162_11086850 Ga0163162_110868501 104
214 3300013307 Ga0157372_11830840 Ga0157372_118308401 104
215 3300020069 Ga0197907_10373791 Ga0197907_103737911 104
216 3300020076 Ga0206355_1394900 Ga0206355_13949002 104
217 3300020080 Ga0206350_10163834 Ga0206350_101638341 104
218 3300020610 Ga0154015_1103909 Ga0154015_11039091 104
219 3300021361 Ga0213872_10329983 Ga0213872_103299831 104
220 3300021384 Ga0213876_10006886 Ga0213876_100068863 104
221 3300021384 Ga0213876_10019556 Ga0213876_100195562 104
222 3300021388 Ga0213875_10000005 Ga0213875_10000005367 104
223 3300021388 Ga0213875_10000032 Ga0213875_1000003266 104
224 3300021388 Ga0213875_10004701 Ga0213875_100047018 104
225 3300021388 Ga0213875_10034697 Ga0213875_100346972 104
226 3300021388 Ga0213875_10042572 Ga0213875_100425721 104
227 3300021388 Ga0213875_10075676 Ga0213875_100756762 104
228 3300021388 Ga0213875_10205237 Ga0213875_102052371 104
229 3300021388 Ga0213875_10337905 Ga0213875_103379052 104
230 3300025904 Ga0207647_10116807 Ga0207647_101168071 104
231 3300025907 Ga0207645_10979197 Ga0207645_109791972 104
232 3300025912 Ga0207707_10166522 Ga0207707_101665222 104
233 3300025920 Ga0207649_10741162 Ga0207649_107411622 104
234 3300025921 Ga0207652_10166205 Ga0207652_101662052 104
235 3300025921 Ga0207652_10290933 Ga0207652_102909332 104
236 3300025941 Ga0207711_10251549 Ga0207711_102515493 104
237 3300025941 Ga0207711_10561689 Ga0207711_105616892 104
238 3300025944 Ga0207661_10181608 Ga0207661_101816082 104
239 3300025944 Ga0207661_10691050 Ga0207661_106910501 104
240 3300026023 Ga0207677_10333313 Ga0207677_103333132 104
241 3300026067 Ga0207678_10558390 Ga0207678_105583902 104
242 3300026067 Ga0207678_12025826 Ga0207678_120258261 104
243 3300026088 Ga0207641_10712280 Ga0207641_107122802 104
244 3300028379 Ga0268266_10058313 Ga0268266_100583132 104
245 3300035692 Ga0373935_0054828 Ga0373935_0054828_878_1225 104
246 3300035695 Ga0373927_0858968 Ga0373927_0858968_233_559 104
247 3300037418 Ga0395900_1515576 Ga0395900_1515576_161_529 104
248 3300037853 Ga0436364_0115483 Ga0436364_0115483_1454_1801 104
249 3300037853 Ga0436364_0157811 Ga0436364_0157811_159606_159953 104
250 3300037853 Ga0436364_0167917 Ga0436364_0167917_480_851 104
251 3300037853 Ga0436364_0245453 Ga0436364_0245453_302_649 104
252 3300037853 Ga0436364_0280635 Ga0436364_0280635_863_1210 104
253 3300037853 Ga0436364_0457930 Ga0436364_0457930_269_616 104
254 3300037853 Ga0436364_0601128 Ga0436364_0601128_74897_75244 104
255 3300037853 Ga0436364_0833005 Ga0436364_0833005_5214_5561 104
256 3300037853 Ga0436364_0837803 Ga0436364_0837803_65_427 104
257 3300037853 Ga0436364_0838259 Ga0436364_0838259_1087_1437 104
258 3300037853 Ga0436364_0931464 Ga0436364_0931464_1202_1564 104
259 3300037853 Ga0436364_1001815 Ga0436364_1001815_349_699 104
260 3300037853 Ga0436364_1091499 Ga0436364_1091499_1298_1648 104
261 3300037853 Ga0436364_1294855 Ga0436364_1294855_468_821 104
262 3300037853 Ga0436364_1397089 Ga0436364_1397089_501_851 104
263 3300037853 Ga0436364_1432395 Ga0436364_1432395_56_403 104
264 3300039437 Ga0436365_0068008 Ga0436365_0068008_9438_9788 104
265 3300039437 Ga0436365_0234072 Ga0436365_0234072_364_711 104
266 3300039437 Ga0436365_1342949 Ga0436365_1342949_351_698 104
267 3300039437 Ga0436365_1868334 Ga0436365_1868334_664_1011 104
268 3300039438 Ga0436360_0559645 Ga0436360_0559645_6659_7006 104
269 3300039438 Ga0436360_1345827 Ga0436360_1345827_93_443 104
270 3300039447 Ga0436361_0377638 Ga0436361_0377638_5301_5648 104
271 3300039447 Ga0436361_0985588 Ga0436361_0985588_948_1295 104
272 3300039447 Ga0436361_1168680 Ga0436361_1168680_97_444 104
273 3300039450 Ga0436363_0973591 Ga0436363_0973591_746_1099 104
274 3300039450 Ga0436363_1595681 Ga0436363_1595681_353_700 104
275 3300039453 Ga0436362_0101726 Ga0436362_0101726_103_450 104
276 3300039453 Ga0436362_0145154 Ga0436362_0145154_185_559 104
277 3300039453 Ga0436362_0274019 Ga0436362_0274019_454_801 104
278 3300042876 Ga0451577_1031899 Ga0451577_1031899_221_544 104
279 3300044694 Ga0466963_0281516 Ga0466963_0281516_296_643 104
280 3300045049 Ga0466959_0654813 Ga0466959_0654813_33_380 104
281 3300045976 Ga0466967_1043153 Ga0466967_1043153_332_679 104
282 3300045976 Ga0466967_1121791 Ga0466967_1121791_93_440 104
283 3300046472 Ga0495580_0133669 Ga0495580_0133669_236_583 104
284 3300048913 Ga0496110_1029658 Ga0496110_1029658_21_347 104
285 3300048929 Ga0496126_0047036 Ga0496126_0047036_2564_2911 104
286 3300049569 Ga0501032_0132624 Ga0501032_0132624_249_596 104
287 3300049569 Ga0501032_0347985 Ga0501032_0347985_196_543 104
288 3300049570 Ga0501033_0174882 Ga0501033_0174882_68_415 104
289 3300049571 Ga0501034_0948189 Ga0501034_0948189_46_393 104
290 3300049571 Ga0501034_1111460 Ga0501034_1111460_267_614 104
291 3300049573 Ga0501037_0056898 Ga0501037_0056898_928_1275 104
292 3300049573 Ga0501037_0523755 Ga0501037_0523755_367_714 104
293 3300049575 Ga0501039_0721080 Ga0501039_0721080_226_573 104
294 3300049579 Ga0501043_0423924 Ga0501043_0423924_589_936 104
295 3300049581 Ga0501047_0012100 Ga0501047_0012100_6879_7226 104
296 3300049581 Ga0501047_0528341 Ga0501047_0528341_16_363 104
297 3300049586 Ga0501070_0029125 Ga0501070_0029125_3938_4285 104
298 3300049586 Ga0501070_0386269 Ga0501070_0386269_487_834 104
299 3300049589 Ga0501073_0029796 Ga0501073_0029796_2709_3056 104
300 3300049589 Ga0501073_0363320 Ga0501073_0363320_410_757 104
301 3300049671 Ga0501238_061524 Ga0501238_061524_99_440 104
302 3300049822 Ga0501035_0018032 Ga0501035_0018032_5314_5661 104
303 3300049822 Ga0501035_0197102 Ga0501035_0197102_321_668 104
304 3300049823 Ga0501044_0000314 Ga0501044_0000314_34264_34611 104
305 3300049823 Ga0501044_0001731 Ga0501044_0001731_7395_7742 104
306 3300049823 Ga0501044_0064267 Ga0501044_0064267_2756_3103 104
307 3300005456 Ga0070678_100281156 Ga0070678_1002811562 106
308 3300005548 Ga0070665_102590593 Ga0070665_1025905932 106
309 3300005841 Ga0068863_101103098 Ga0068863_1011030982 106
310 3300009177 Ga0105248_11877783 Ga0105248_118777832 106
311 3300009177 Ga0105248_12068741 Ga0105248_120687411 106
312 3300013104 Ga0157370_11668438 Ga0157370_116684382 106
313 3300013306 Ga0163162_11625323 Ga0163162_116253233 106
314 3300026121 Ga0207683_10607272 Ga0207683_106072722 106
315 3300028379 Ga0268266_10794558 Ga0268266_107945582 106
316 3300031691 Ga0316579_10528032 Ga0316579_105280321 106
317 3300037853 Ga0436364_0297132 Ga0436364_0297132_469_822 106
318 3300039437 Ga0436365_1859137 Ga0436365_1859137_70_423 106
319 3300039453 Ga0436362_0817581 Ga0436362_0817581_328_681 106
320 3300044694 Ga0466963_0253558 Ga0466963_0253558_369_692 106
321 3300045976 Ga0466967_0458172 Ga0466967_0458172_857_1180 106
322 3300004798 Ga0058859_11084040 Ga0058859_110840402 107
323 3300005295 Ga0065707_10652586 Ga0065707_106525862 107
324 3300006844 Ga0075428_101735439 Ga0075428_1017354392 107
325 3300006847 Ga0075431_100677795 Ga0075431_1006777952 107
326 3300050510 nmdc:mga06r32_1144444_c1 nmdc:mga06r32_1144444_c1_204_527 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02617

ClpS

ATP-dependent Clp protease adaptor protein ClpS

18

93

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d34-assembly1.cif.gz_B atclps1-peptide complex 0.9398 21 107
7ef7-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase complex with xmp 0.9286 35 63
4o2x-assembly2.cif.gz_B structure of a malarial protein 0.9272 22 105
5cbf-assembly2.cif.gz_C structural and functional characterization of a calcium-activated cation channel from tsukamurella paurometabola 0.9245 35 60
7d34-assembly1.cif.gz_B atclps1-peptide complex 0.9058 21 107
ID Description Score Start End Superfamily
1rykA00 Mainly Alpha;Orthogonal Bundle;Protein Yjbj; Chain: A;;YjbJ 0.9619 34 63 1.10.1470.10
5cbgF00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.938 35 60 1.10.287.70
af_A0A0R0IJ84_76_154_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9326 22 105 3.30.1390.10
af_Q8IEB2_84_184_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.931 21 107 3.30.1390.10
5cbgC00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9294 35 60 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A6B0WAT3-F1-model_v4 ATP-dependent Clp protease adaptor ClpS 0.9666 21 106 GO:0006508
GO:0008233
GO:0030163
AF-A0A4P5Y3L7-F1-model_v4 ATP-dependent Clp protease ClpS 0.9631 21 107 GO:0006508
GO:0008233
GO:0030163
AF-A0A7C3SFC0-F1-model_v4 ATP-dependent Clp protease adaptor ClpS 0.9613 21 107 GO:0006508
GO:0008233
GO:0030163
AF-A0A4Z0LTS9-F1-model_v4 ATP-dependent Clp protease adaptor ClpS 0.9573 21 107 GO:0006508
GO:0008233
GO:0030163
AF-A0A7X6UXN4-F1-model_v4 ATP-dependent Clp protease adaptor ClpS 0.9569 19 107 GO:0006508
GO:0008233
GO:0030163

Feature Viewer

pLDDT pTM Quality
79.55 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map