F408154

General Info

Members Datasets Scaffolds Average Seq Length
326 170 652 318

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10058325|Ga0070666_100583253
Length 318
Sequence MLIKKPSDIPSSDITSRSVYLRRREFLQAAGLTTAAALTGVLGSERDASAGEKLVTKFRIVTTEDRISPLKDISTYNNYYEFGAEKSDPSRNSGAFKTSPWSVTVEGLCNKPGTYTLEDILKPHPLEERVYRMRCVEAWSMVIPWDGFPLRDLLNRFEPQGKATFVEFTTVARPSEMPGMRVTFPKPILPWPYREGLRMDEAMNPLTIIAVGMWGETLANQNGAPLRLVVPWKYGFKGIKSIVKIRFVDKQPSTTWVEAYGRLYGFYANVNPNVPHPNWSQDKERRLGDLRPRPTLMFNGYEDAVASMYSGMDLKRNF

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
109 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.29
Nodule 0
Rhizoplane 2.76
Rhizosphere 92.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10058325 3300005335 Bacteria 2610
2 Ga0065704_10001443 3300005289 Bacteria 9312
3 Ga0065712_10078797 3300005290 Bacteria 3298
4 Ga0065712_10085214 3300005290 Bacteria 2711
5 Ga0065712_10099287 3300005290 Bacteria 2095
6 Ga0065712_10109791 3300005290 Bacteria 1849
7 Ga0065712_10110975 3300005290 Bacteria 1818
8 Ga0065715_10004770 3300005293 Bacteria 3926
9 Ga0065715_10128537 3300005293 Bacteria 2064
10 Ga0065715_10201764 3300005293 Bacteria 1358
11 Ga0065707_10091932 3300005295 Bacteria 3857
12 Ga0070683_100000626 3300005329 Bacteria 25453
13 Ga0070670_100012565 3300005331 Bacteria 7249
14 Ga0070670_100056226 3300005331 Bacteria 3377
15 Ga0070670_100076371 3300005331 Bacteria 2878
16 Ga0070670_100213274 3300005331 Bacteria 1679
17 Ga0068869_100069205 3300005334 Bacteria 2609
18 Ga0070666_10220884 3300005335 Bacteria 1336
19 Ga0070680_100098597 3300005336 Bacteria 2424
20 Ga0070689_100023574 3300005340 Bacteria 4608
21 Ga0070689_100037975 3300005340 Bacteria 3683
22 Ga0070691_10120315 3300005341 Bacteria 1321
23 Ga0070661_100014821 3300005344 Bacteria 5498
24 Ga0070669_100000228 3300005353 Bacteria 46855
25 Ga0070673_100033340 3300005364 Bacteria 3887
26 Ga0070688_100008181 3300005365 Bacteria 5665
27 Ga0070688_100109634 3300005365 Bacteria 1834
28 Ga0070659_100100295 3300005366 Bacteria 2330
29 Ga0070701_10033582 3300005438 Bacteria 2565
30 Ga0070700_100010556 3300005441 Bacteria 5102
31 Ga0070663_100030402 3300005455 Bacteria 3701
32 Ga0070678_100070149 3300005456 Bacteria 2619
33 Ga0070678_100112643 3300005456 Bacteria 2131
34 Ga0070678_100313121 3300005456 Bacteria 1338
35 Ga0068867_100033523 3300005459 Bacteria 3720
36 Ga0070685_10024457 3300005466 Bacteria 3318
37 Ga0070698_100002340 3300005471 Bacteria 20946
38 Ga0070699_100000690 3300005518 Bacteria 31478
39 Ga0070699_100027632 3300005518 Bacteria 4893
40 Ga0070684_100000260 3300005535 Bacteria 36672
41 Ga0070684_100342654 3300005535 Bacteria 1374
42 Ga0070697_100018991 3300005536 Bacteria 5423
43 Ga0070697_100117685 3300005536 Bacteria 2220
44 Ga0070672_100006780 3300005543 Bacteria 7732
45 Ga0070672_100097428 3300005543 Bacteria 2381
46 Ga0070686_100024828 3300005544 Bacteria 3596
47 Ga0070686_100036135 3300005544 Bacteria 3057
48 Ga0070696_100025686 3300005546 Bacteria 4006
49 Ga0070693_100130997 3300005547 Bacteria 1568
50 Ga0070665_100005104 3300005548 Bacteria 13618
51 Ga0070665_100138195 3300005548 Bacteria 2440
52 Ga0070704_100055596 3300005549 Bacteria 2807
53 Ga0070664_100002748 3300005564 Bacteria 14202
54 Ga0070664_100064341 3300005564 Bacteria 3128
55 Ga0070664_100210929 3300005564 Bacteria 1736
56 Ga0068857_100006581 3300005577 Bacteria 9975
57 Ga0068857_100183955 3300005577 Bacteria 1902
58 Ga0068856_100356172 3300005614 Bacteria 1482
59 Ga0070702_100016710 3300005615 Bacteria 3770
60 Ga0068852_100073769 3300005616 Bacteria 3003
61 Ga0068852_100208532 3300005616 Bacteria 1852
62 Ga0068859_100043379 3300005617 Bacteria 4520
63 Ga0068864_100278986 3300005618 Bacteria 1559
64 Ga0068866_10035523 3300005718 Bacteria 2435
65 Ga0068866_10037371 3300005718 Bacteria 2384
66 Ga0068861_100150540 3300005719 Bacteria 1909
67 Ga0068860_100135054 3300005843 Bacteria 2369
68 Ga0075362_10001726 3300006177 Bacteria 7099
69 Ga0075367_10006730 3300006178 Bacteria 5833
70 Ga0075366_10001893 3300006195 Bacteria 10574
71 Ga0075366_10006438 3300006195 Bacteria 6434
72 Ga0075366_10093873 3300006195 Bacteria 1798
73 Ga0097621_100045380 3300006237 Bacteria 3550
74 Ga0097621_100135225 3300006237 Bacteria 2102
75 Ga0075428_100008118 3300006844 Bacteria 11656
76 Ga0075428_100008830 3300006844 Bacteria 11180
77 Ga0075428_100049193 3300006844 Bacteria 4625
78 Ga0075428_100113937 3300006844 Bacteria 2946
79 Ga0075430_100026250 3300006846 Bacteria 4956
80 Ga0075430_100026461 3300006846 Bacteria 4935
81 Ga0075430_100075189 3300006846 Bacteria 2832
82 Ga0075430_100294856 3300006846 Bacteria 1341
83 Ga0075431_100010292 3300006847 Bacteria 9399
84 Ga0075431_100029401 3300006847 Bacteria 5657
85 Ga0075431_100037975 3300006847 Bacteria 4958
86 Ga0075433_10001564 3300006852 Bacteria 16925
87 Ga0075433_10223861 3300006852 Bacteria 1671
88 Ga0075434_100025586 3300006871 Bacteria 5775
89 Ga0075434_100081540 3300006871 Bacteria 3232
90 Ga0075434_100224525 3300006871 Bacteria 1898
91 Ga0075429_100007171 3300006880 Bacteria 9675
92 Ga0075429_100094292 3300006880 Bacteria 2610
93 Ga0075429_100130776 3300006880 Bacteria 2196
94 Ga0075429_100219375 3300006880 Bacteria 1666
95 Ga0097620_100043380 3300006931 Bacteria 4520
96 Ga0111539_10000909 3300009094 Bacteria 38680
97 Ga0111539_10001677 3300009094 Bacteria 29534
98 Ga0111539_10010284 3300009094 Bacteria 11778
99 Ga0111539_10164141 3300009094 Bacteria 2598
100 Ga0111539_10391750 3300009094 Bacteria 1618
101 Ga0105245_10007867 3300009098 Bacteria 9323
102 Ga0114129_10001360 3300009147 Bacteria 32853
103 Ga0114129_10003321 3300009147 Bacteria 22603
104 Ga0114129_10008744 3300009147 Bacteria 14440
105 Ga0114129_10015406 3300009147 Bacteria 10877
106 Ga0114129_10018948 3300009147 Bacteria 9802
107 Ga0114129_10317526 3300009147 Bacteria 2072
108 Ga0105242_10020181 3300009176 Bacteria 5224
109 Ga0105242_10153586 3300009176 Bacteria 2009
110 Ga0105248_10036055 3300009177 Bacteria 5532
111 Ga0105248_10038926 3300009177 Bacteria 5324
112 Ga0105248_10089692 3300009177 Bacteria 3461
113 Ga0105248_10115407 3300009177 Bacteria 3029
114 Ga0105249_10001512 3300009553 Bacteria 20401
115 Ga0105246_10290833 3300011119 Bacteria 1315
116 Ga0105246_10401195 3300011119 Bacteria 1139
117 Ga0157369_10206627 3300013105 Bacteria 2059
118 Ga0157374_10077845 3300013296 Bacteria 3139
119 Ga0163162_10220784 3300013306 Bacteria 2025
120 Ga0163163_10070111 3300014325 Bacteria 3491
121 Ga0163163_10087206 3300014325 Bacteria 3131
122 Ga0157377_10097503 3300014745 Bacteria 1746
123 Ga0157379_10209541 3300014968 Bacteria 1764
124 Ga0157376_10287612 3300014969 Bacteria 1551
125 Ga0207642_10017776 3300025899 Bacteria 2713
126 Ga0207684_10133877 3300025910 Bacteria 2128
127 Ga0207707_10172328 3300025912 Bacteria 1891
128 Ga0207695_10120375 3300025913 Bacteria 2594
129 Ga0207662_10060952 3300025918 Bacteria 2264
130 Ga0207649_10072325 3300025920 Bacteria 2206
131 Ga0207652_10363795 3300025921 Bacteria 1305
132 Ga0207681_10006953 3300025923 Bacteria 6940
133 Ga0207650_10004066 3300025925 Bacteria 10000
134 Ga0207650_10035433 3300025925 Bacteria 3624
135 Ga0207650_10179714 3300025925 Bacteria 1686
136 Ga0207650_10203417 3300025925 Bacteria 1587
137 Ga0207650_10321031 3300025925 Bacteria 1268
138 Ga0207659_10068538 3300025926 Bacteria 2580
139 Ga0207700_10082309 3300025928 Bacteria 2517
140 Ga0207644_10059607 3300025931 Bacteria 2760
141 Ga0207686_10129794 3300025934 Bacteria 1727
142 Ga0207691_10031782 3300025940 Bacteria 4926
143 Ga0207691_10054005 3300025940 Bacteria 3666
144 Ga0207711_10025258 3300025941 Bacteria 4985
145 Ga0207711_10103046 3300025941 Bacteria 2527
146 Ga0207711_10108319 3300025941 Bacteria 2468
147 Ga0207689_10132489 3300025942 Bacteria 2052
148 Ga0207689_10280052 3300025942 Bacteria 1381
149 Ga0207661_10011692 3300025944 Bacteria 6370
150 Ga0207679_10008818 3300025945 Bacteria 6428
151 Ga0207679_10139313 3300025945 Bacteria 1959
152 Ga0207651_10094080 3300025960 Bacteria 2203
153 Ga0207651_10130046 3300025960 Bacteria 1925
154 Ga0207668_10094687 3300025972 Bacteria 2203
155 Ga0207708_10008305 3300026075 Bacteria 7689
156 Ga0207648_10040387 3300026089 Bacteria 4100
157 Ga0207648_10089509 3300026089 Bacteria 2689
158 Ga0207674_10034676 3300026116 Bacteria 5273
159 Ga0207674_10058591 3300026116 Bacteria 3900
160 Ga0207675_100165647 3300026118 Bacteria 2111
161 Ga0207675_100292847 3300026118 Bacteria 1584
162 Ga0207683_10140016 3300026121 Bacteria 2180
163 Ga0207683_10336740 3300026121 Bacteria 1383
164 Ga0207698_10169239 3300026142 Bacteria 1922
165 Ga0209970_1014858 3300027614 Bacteria 1294
166 Ga0207428_10003184 3300027907 Bacteria 16067
167 Ga0207428_10022982 3300027907 Bacteria 5251
168 Ga0207428_10057157 3300027907 Bacteria 3098
169 Ga0268266_10013838 3300028379 Bacteria 6946
170 Ga0268264_10184189 3300028381 Bacteria 1899
171 Ga0307408_100020439 3300031548 Bacteria 4469
172 Ga0307408_100029495 3300031548 Bacteria 3802
173 Ga0307408_100423614 3300031548 Bacteria 1148
174 Ga0307410_10112870 3300031852 Bacteria 1969
175 Ga0307406_10122716 3300031901 Bacteria 1809
176 Ga0307412_10033207 3300031911 Bacteria 3278
177 Ga0307409_100060723 3300031995 Bacteria 2950
178 Ga0307416_100005088 3300032002 Bacteria 8023
179 Ga0307416_100016321 3300032002 Bacteria 5157
180 Ga0307416_100043833 3300032002 Bacteria 3507
181 Ga0307416_100057824 3300032002 Bacteria 3140
182 Ga0307416_100077552 3300032002 Bacteria 2791
183 Ga0307416_100156703 3300032002 Bacteria 2098
184 Ga0307411_10008743 3300032005 Bacteria 5268
185 Ga0307411_10018306 3300032005 Bacteria 4015
186 Ga0307415_100177363 3300032126 Bacteria 1668
187 Ga0307415_100238841 3300032126 Bacteria 1468
188 Ga0373931_0152187 3300035691 Bacteria 1349
189 Ga0373937_0075762 3300036401 Bacteria 3107
190 Ga0373937_0187692 3300036401 Bacteria 1942
191 Ga0439453_0011738 3300041408 Bacteria 1466
192 Ga0450896_008527 3300042133 Bacteria 1424
193 Ga0439435_0018729 3300042436 Bacteria 1765
194 Ga0439435_0059493 3300042436 Bacteria 1111
195 Ga0439460_0038689 3300042461 Bacteria 1392
196 Ga0451576_0121570 3300045051 Bacteria 2719
197 Ga0495659_0004137 3300046664 Bacteria 4582
198 Ga0495647_0112686 3300046681 Bacteria 1137
199 Ga0495636_0111506 3300047318 Bacteria 1204
200 Ga0495674_0067523 3300047319 Bacteria 3098
201 Ga0496104_0001113 3300048907 Bacteria 22978
202 Ga0496105_0048684 3300048908 Bacteria 3499
203 Ga0496105_0127868 3300048908 Bacteria 2094
204 Ga0496107_0386576 3300048910 Bacteria 1041
205 Ga0496108_0011787 3300048911 Bacteria 7111
206 Ga0496109_0002013 3300048912 Bacteria 16857
207 Ga0496110_0034711 3300048913 Bacteria 4371
208 Ga0496111_0006821 3300048914 Bacteria 7448
209 Ga0496112_0163429 3300048915 Bacteria 2192
210 Ga0501299_002399 3300049522 Bacteria 2588
211 Ga0501032_0227588 3300049569 Bacteria 1213
212 Ga0501034_0016615 3300049571 Bacteria 7547
213 Ga0501036_0009057 3300049572 Bacteria 8187
214 Ga0501036_0050120 3300049572 Bacteria 3536
215 Ga0501036_0241694 3300049572 Bacteria 1514
216 Ga0501036_0337099 3300049572 Bacteria 1259
217 Ga0501037_0181597 3300049573 Bacteria 1493
218 Ga0501037_0260654 3300049573 Bacteria 1211
219 Ga0501038_0066920 3300049574 Bacteria 3058
220 Ga0501038_0397859 3300049574 Bacteria 1066
221 Ga0501039_0003841 3300049575 Bacteria 11284
222 Ga0501039_0029216 3300049575 Bacteria 4246
223 Ga0501039_0143148 3300049575 Bacteria 1878
224 Ga0501040_0009204 3300049576 Bacteria 6433
225 Ga0501040_0011728 3300049576 Bacteria 5733
226 Ga0501040_0049026 3300049576 Bacteria 2887
227 Ga0501040_0078070 3300049576 Bacteria 2291
228 Ga0501041_0001201 3300049577 Bacteria 14166
229 Ga0501041_0003398 3300049577 Bacteria 9163
230 Ga0501042_0003335 3300049578 Bacteria 10061
231 Ga0501042_0050046 3300049578 Bacteria 2980
232 Ga0501046_0050335 3300049580 Bacteria 3291
233 Ga0501046_0060262 3300049580 Bacteria 2970
234 Ga0501048_0029894 3300049582 Bacteria 3946
235 Ga0501048_0042736 3300049582 Bacteria 3244
236 Ga0501048_0138108 3300049582 Bacteria 1723
237 Ga0501069_0027467 3300049585 Bacteria 3118
238 Ga0501069_0048671 3300049585 Bacteria 2355
239 Ga0501071_0004295 3300049587 Bacteria 9032
240 Ga0501072_0028976 3300049588 Bacteria 4322
241 Ga0501072_0033254 3300049588 Bacteria 4041
242 Ga0501072_0042013 3300049588 Bacteria 3592
243 Ga0501072_0104937 3300049588 Bacteria 2247
244 Ga0501072_0121642 3300049588 Bacteria 2080
245 Ga0501073_0091188 3300049589 Bacteria 2118
246 Ga0501074_0116276 3300049590 Bacteria 1913
247 Ga0501075_0001092 3300049591 Bacteria 17467
248 Ga0501075_0001326 3300049591 Bacteria 16066
249 Ga0501075_0060902 3300049591 Bacteria 2843
250 Ga0501075_0061849 3300049591 Bacteria 2822
251 Ga0501075_0092947 3300049591 Bacteria 2290
252 Ga0501076_0007760 3300049592 Bacteria 7821
253 Ga0501076_0010664 3300049592 Bacteria 6826
254 Ga0501076_0011534 3300049592 Bacteria 6588
255 Ga0501076_0045395 3300049592 Bacteria 3469
256 Ga0501077_0179027 3300049593 Bacteria 1347
257 Ga0501079_0007344 3300049741 Bacteria 8331
258 Ga0501079_0040280 3300049741 Bacteria 3603
259 Ga0501079_0049001 3300049741 Bacteria 3260
260 Ga0501079_0125250 3300049741 Bacteria 1999
261 Ga0501080_0252114 3300049742 Bacteria 1609
262 Ga0501081_0001038 3300049743 Bacteria 16619
263 Ga0501081_0005807 3300049743 Bacteria 7992
264 Ga0501081_0095689 3300049743 Bacteria 2094
265 Ga0501083_0149215 3300049744 Bacteria 1531
266 Ga0501035_0079536 3300049822 Bacteria 2896
267 Ga0501045_0000165 3300049824 Bacteria 36095
268 Ga0501045_0004100 3300049824 Bacteria 10060
269 Ga0501045_0018041 3300049824 Bacteria 5013
270 Ga0501045_0057032 3300049824 Bacteria 2857
271 nmdc:mga03683_1057_c1 3300050489 Bacteria 8060
272 nmdc:mga00v17_20155_c1 3300050491 Bacteria 3817
273 nmdc:mga00v17_25068_c1 3300050491 Bacteria 3463
274 nmdc:mga00v17_3602_c1 3300050491 Bacteria 8004
275 nmdc:mga0k408_15730_c1 3300050493 Bacteria 4188
276 nmdc:mga0k408_4336_c1 3300050493 Bacteria 7534
277 nmdc:mga06z11_11086_c1 3300050494 Bacteria 3872
278 nmdc:mga06z11_69901_c1 3300050494 Bacteria 1855
279 nmdc:mga07m45_73603_c1 3300050496 Bacteria 1945
280 nmdc:mga05p37_10580_c1 3300050507 Bacteria 10941
281 nmdc:mga05p37_3057_c1 3300050507 Bacteria 19440
282 nmdc:mga05p37_34522_c1 3300050507 Bacteria 6195
283 nmdc:mga05p37_660775_c1 3300050507 Bacteria 1168
284 nmdc:mga05p37_8293_c1 3300050507 Bacteria 12284
285 nmdc:mga05p37_8617_c1 3300050507 Bacteria 12055
286 nmdc:mga05p37_96880_c1 3300050507 Bacteria 3635
287 nmdc:mga05p37_98639_c1 3300050507 Bacteria 3598
288 nmdc:mga09592_212765_c1 3300050508 Bacteria 1675
289 nmdc:mga09592_3661_c1 3300050508 Bacteria 12389
290 nmdc:mga09592_98156_c1 3300050508 Bacteria 2507
291 nmdc:mga09592_99788_c1 3300050508 Bacteria 2486
292 nmdc:mga0qj67_16502_c1 3300050509 Bacteria 5603
293 nmdc:mga0qj67_290963_c1 3300050509 Bacteria 1324
294 nmdc:mga0qj67_8162_c1 3300050509 Bacteria 7757
295 nmdc:mga06r32_104478_c1 3300050510 Bacteria 2782
296 nmdc:mga06r32_190149_c1 3300050510 Bacteria 2041
297 nmdc:mga06r32_3300_c1 3300050510 Bacteria 7770
298 nmdc:mga06r32_5251_c1 3300050510 Bacteria 11650
299 nmdc:mga08y16_1316_c1 3300050511 Bacteria 24685
300 nmdc:mga08y16_13964_c1 3300050511 Bacteria 8454
301 nmdc:mga08y16_178269_c1 3300050511 Bacteria 2207
302 nmdc:mga08y16_414_c1 3300050511 Bacteria 39166
303 nmdc:mga0n895_280661_c1 3300050512 Bacteria 1689
304 nmdc:mga0n895_302521_c1 3300050512 Bacteria 1621
305 nmdc:mga0n895_52371_c1 3300050512 Bacteria 4006
306 nmdc:mga0n895_87971_c1 3300050512 Bacteria 3105
307 nmdc:mga0rr50_3458_c1 3300050513 Bacteria 9093
308 nmdc:mga0a205_14233_c1 3300050515 Bacteria 7419
309 nmdc:mga0a205_382326_c1 3300050515 Bacteria 1273
310 nmdc:mga0a205_6122_c3 3300050515 Bacteria 9725
311 Ga0501084_0001823 3300054114 Bacteria 16993
312 Ga0501084_0002151 3300054114 Bacteria 15764
313 Ga0501084_0045212 3300054114 Bacteria 3687
314 Ga0501084_0052110 3300054114 Bacteria 3425
315 Ga0501084_0622247 3300054114 Bacteria 912
316 Ga0590071_013839 3300059421 Bacteria 1891
317 Ga0590074_024759 3300059423 Bacteria 1045
318 Ga0590075_000391 3300059424 Bacteria 11989
319 Ga0590075_004551 3300059424 Bacteria 3286
320 Ga0590077_002101 3300059426 Bacteria 4357
321 Ga0501082_0002142 3300060353 Bacteria 17307
322 Ga0501082_0009999 3300060353 Bacteria 8179
323 Ga0530510_0037955 3300061734 Bacteria 3475
324 Ga0530510_0044443 3300061734 Bacteria 3210
325 Ga0530510_0044596 3300061734 Bacteria 3204
326 Ga0530510_0250248 3300061734 Bacteria 1320
327 Ga0070666_10058325
328 Ga0065704_10001443
329 Ga0065712_10078797
330 Ga0065712_10085214
331 Ga0065712_10099287
332 Ga0065712_10109791
333 Ga0065712_10110975
334 Ga0065715_10004770
335 Ga0065715_10128537
336 Ga0065715_10201764
337 Ga0065707_10091932
338 Ga0070683_100000626
339 Ga0070670_100012565
340 Ga0070670_100056226
341 Ga0070670_100076371
342 Ga0070670_100213274
343 Ga0068869_100069205
344 Ga0070666_10220884
345 Ga0070680_100098597
346 Ga0070689_100023574
347 Ga0070689_100037975
348 Ga0070691_10120315
349 Ga0070661_100014821
350 Ga0070669_100000228
351 Ga0070673_100033340
352 Ga0070688_100008181
353 Ga0070688_100109634
354 Ga0070659_100100295
355 Ga0070701_10033582
356 Ga0070700_100010556
357 Ga0070663_100030402
358 Ga0070678_100070149
359 Ga0070678_100112643
360 Ga0070678_100313121
361 Ga0068867_100033523
362 Ga0070685_10024457
363 Ga0070698_100002340
364 Ga0070699_100000690
365 Ga0070699_100027632
366 Ga0070684_100000260
367 Ga0070684_100342654
368 Ga0070697_100018991
369 Ga0070697_100117685
370 Ga0070672_100006780
371 Ga0070672_100097428
372 Ga0070686_100024828
373 Ga0070686_100036135
374 Ga0070696_100025686
375 Ga0070693_100130997
376 Ga0070665_100005104
377 Ga0070665_100138195
378 Ga0070704_100055596
379 Ga0070664_100002748
380 Ga0070664_100064341
381 Ga0070664_100210929
382 Ga0068857_100006581
383 Ga0068857_100183955
384 Ga0068856_100356172
385 Ga0070702_100016710
386 Ga0068852_100073769
387 Ga0068852_100208532
388 Ga0068859_100043379
389 Ga0068864_100278986
390 Ga0068866_10035523
391 Ga0068866_10037371
392 Ga0068861_100150540
393 Ga0068860_100135054
394 Ga0075362_10001726
395 Ga0075367_10006730
396 Ga0075366_10001893
397 Ga0075366_10006438
398 Ga0075366_10093873
399 Ga0097621_100045380
400 Ga0097621_100135225
401 Ga0075428_100008118
402 Ga0075428_100008830
403 Ga0075428_100049193
404 Ga0075428_100113937
405 Ga0075430_100026250
406 Ga0075430_100026461
407 Ga0075430_100075189
408 Ga0075430_100294856
409 Ga0075431_100010292
410 Ga0075431_100029401
411 Ga0075431_100037975
412 Ga0075433_10001564
413 Ga0075433_10223861
414 Ga0075434_100025586
415 Ga0075434_100081540
416 Ga0075434_100224525
417 Ga0075429_100007171
418 Ga0075429_100094292
419 Ga0075429_100130776
420 Ga0075429_100219375
421 Ga0097620_100043380
422 Ga0111539_10000909
423 Ga0111539_10001677
424 Ga0111539_10010284
425 Ga0111539_10164141
426 Ga0111539_10391750
427 Ga0105245_10007867
428 Ga0114129_10001360
429 Ga0114129_10003321
430 Ga0114129_10008744
431 Ga0114129_10015406
432 Ga0114129_10018948
433 Ga0114129_10317526
434 Ga0105242_10020181
435 Ga0105242_10153586
436 Ga0105248_10036055
437 Ga0105248_10038926
438 Ga0105248_10089692
439 Ga0105248_10115407
440 Ga0105249_10001512
441 Ga0105246_10290833
442 Ga0105246_10401195
443 Ga0157369_10206627
444 Ga0157374_10077845
445 Ga0163162_10220784
446 Ga0163163_10070111
447 Ga0163163_10087206
448 Ga0157377_10097503
449 Ga0157379_10209541
450 Ga0157376_10287612
451 Ga0207642_10017776
452 Ga0207684_10133877
453 Ga0207707_10172328
454 Ga0207695_10120375
455 Ga0207662_10060952
456 Ga0207649_10072325
457 Ga0207652_10363795
458 Ga0207681_10006953
459 Ga0207650_10004066
460 Ga0207650_10035433
461 Ga0207650_10179714
462 Ga0207650_10203417
463 Ga0207650_10321031
464 Ga0207659_10068538
465 Ga0207700_10082309
466 Ga0207644_10059607
467 Ga0207686_10129794
468 Ga0207691_10031782
469 Ga0207691_10054005
470 Ga0207711_10025258
471 Ga0207711_10103046
472 Ga0207711_10108319
473 Ga0207689_10132489
474 Ga0207689_10280052
475 Ga0207661_10011692
476 Ga0207679_10008818
477 Ga0207679_10139313
478 Ga0207651_10094080
479 Ga0207651_10130046
480 Ga0207668_10094687
481 Ga0207708_10008305
482 Ga0207648_10040387
483 Ga0207648_10089509
484 Ga0207674_10034676
485 Ga0207674_10058591
486 Ga0207675_100165647
487 Ga0207675_100292847
488 Ga0207683_10140016
489 Ga0207683_10336740
490 Ga0207698_10169239
491 Ga0209970_1014858
492 Ga0207428_10003184
493 Ga0207428_10022982
494 Ga0207428_10057157
495 Ga0268266_10013838
496 Ga0268264_10184189
497 Ga0307408_100020439
498 Ga0307408_100029495
499 Ga0307408_100423614
500 Ga0307410_10112870
501 Ga0307406_10122716
502 Ga0307412_10033207
503 Ga0307409_100060723
504 Ga0307416_100005088
505 Ga0307416_100016321
506 Ga0307416_100043833
507 Ga0307416_100057824
508 Ga0307416_100077552
509 Ga0307416_100156703
510 Ga0307411_10008743
511 Ga0307411_10018306
512 Ga0307415_100177363
513 Ga0307415_100238841
514 Ga0373931_0152187
515 Ga0373937_0075762
516 Ga0373937_0187692
517 Ga0439453_0011738
518 Ga0450896_008527
519 Ga0439435_0018729
520 Ga0439435_0059493
521 Ga0439460_0038689
522 Ga0451576_0121570
523 Ga0495659_0004137
524 Ga0495647_0112686
525 Ga0495636_0111506
526 Ga0495674_0067523
527 Ga0496104_0001113
528 Ga0496105_0048684
529 Ga0496105_0127868
530 Ga0496107_0386576
531 Ga0496108_0011787
532 Ga0496109_0002013
533 Ga0496110_0034711
534 Ga0496111_0006821
535 Ga0496112_0163429
536 Ga0501299_002399
537 Ga0501032_0227588
538 Ga0501034_0016615
539 Ga0501036_0009057
540 Ga0501036_0050120
541 Ga0501036_0241694
542 Ga0501036_0337099
543 Ga0501037_0181597
544 Ga0501037_0260654
545 Ga0501038_0066920
546 Ga0501038_0397859
547 Ga0501039_0003841
548 Ga0501039_0029216
549 Ga0501039_0143148
550 Ga0501040_0009204
551 Ga0501040_0011728
552 Ga0501040_0049026
553 Ga0501040_0078070
554 Ga0501041_0001201
555 Ga0501041_0003398
556 Ga0501042_0003335
557 Ga0501042_0050046
558 Ga0501046_0050335
559 Ga0501046_0060262
560 Ga0501048_0029894
561 Ga0501048_0042736
562 Ga0501048_0138108
563 Ga0501069_0027467
564 Ga0501069_0048671
565 Ga0501071_0004295
566 Ga0501072_0028976
567 Ga0501072_0033254
568 Ga0501072_0042013
569 Ga0501072_0104937
570 Ga0501072_0121642
571 Ga0501073_0091188
572 Ga0501074_0116276
573 Ga0501075_0001092
574 Ga0501075_0001326
575 Ga0501075_0060902
576 Ga0501075_0061849
577 Ga0501075_0092947
578 Ga0501076_0007760
579 Ga0501076_0010664
580 Ga0501076_0011534
581 Ga0501076_0045395
582 Ga0501077_0179027
583 Ga0501079_0007344
584 Ga0501079_0040280
585 Ga0501079_0049001
586 Ga0501079_0125250
587 Ga0501080_0252114
588 Ga0501081_0001038
589 Ga0501081_0005807
590 Ga0501081_0095689
591 Ga0501083_0149215
592 Ga0501035_0079536
593 Ga0501045_0000165
594 Ga0501045_0004100
595 Ga0501045_0018041
596 Ga0501045_0057032
597 nmdc:mga03683_1057_c1
598 nmdc:mga00v17_20155_c1
599 nmdc:mga00v17_25068_c1
600 nmdc:mga00v17_3602_c1
601 nmdc:mga0k408_15730_c1
602 nmdc:mga0k408_4336_c1
603 nmdc:mga06z11_11086_c1
604 nmdc:mga06z11_69901_c1
605 nmdc:mga07m45_73603_c1
606 nmdc:mga05p37_10580_c1
607 nmdc:mga05p37_3057_c1
608 nmdc:mga05p37_34522_c1
609 nmdc:mga05p37_660775_c1
610 nmdc:mga05p37_8293_c1
611 nmdc:mga05p37_8617_c1
612 nmdc:mga05p37_96880_c1
613 nmdc:mga05p37_98639_c1
614 nmdc:mga09592_212765_c1
615 nmdc:mga09592_3661_c1
616 nmdc:mga09592_98156_c1
617 nmdc:mga09592_99788_c1
618 nmdc:mga0qj67_16502_c1
619 nmdc:mga0qj67_290963_c1
620 nmdc:mga0qj67_8162_c1
621 nmdc:mga06r32_104478_c1
622 nmdc:mga06r32_190149_c1
623 nmdc:mga06r32_3300_c1
624 nmdc:mga06r32_5251_c1
625 nmdc:mga08y16_1316_c1
626 nmdc:mga08y16_13964_c1
627 nmdc:mga08y16_178269_c1
628 nmdc:mga08y16_414_c1
629 nmdc:mga0n895_280661_c1
630 nmdc:mga0n895_302521_c1
631 nmdc:mga0n895_52371_c1
632 nmdc:mga0n895_87971_c1
633 nmdc:mga0rr50_3458_c1
634 nmdc:mga0a205_14233_c1
635 nmdc:mga0a205_382326_c1
636 nmdc:mga0a205_6122_c3
637 Ga0501084_0001823
638 Ga0501084_0002151
639 Ga0501084_0045212
640 Ga0501084_0052110
641 Ga0501084_0622247
642 Ga0590071_013839
643 Ga0590074_024759
644 Ga0590075_000391
645 Ga0590075_004551
646 Ga0590077_002101
647 Ga0501082_0002142
648 Ga0501082_0009999
649 Ga0530510_0037955
650 Ga0530510_0044443
651 Ga0530510_0044596
652 Ga0530510_0250248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

91

256

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9317 54 312
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9297 52 312
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9215 54 312
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9163 52 312
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.81 96 257
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9305 52 312 3.90.420.10
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.917 52 312 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8183 96 255 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8141 96 255 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.81 96 257 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A2S8CF43-F1-model_v4 Protein-methionine-sulfoxide reductase catalytic subunit MsrP 0.9706 100 243
AF-A0A162C394-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9698 82 230
AF-A0A7S1GSH0-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9662 97 269
AF-A0A162C394-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9634 82 230
AF-A0A7S1GSH0-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9607 97 269

Map