F408123

General Info

Members Datasets Scaffolds Average Seq Length
326 201 652 465

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10309210|rootH1_103092106
Length 521
Sequence MPKKIPLKLYNTETREKEELTPLDGRTVRMYTCGPTVYNFAHIGNFRTYVFEDLLRRTIKFFGFSVKQAMNLTDIDDKTIRGALEKKITLDSFTATYKRAFFEDLRTLSIEPVEHYPEATDYISEMISIIEKLLAEGTAYKGHDGSIYFAIAKFPSYGRLSHLHLDELKAGASERVSHDEYDKEHVSDFVLWKAYDSDRDGTIFWESPFGKGRPGWHIECSAMAMKLLGQSIDIHVGGVDNIFPHHENEIAQSESFSGCRFVSHWLHAEHLLVDHKKMSKSLGNFYTLRDLLQRGYSGRAVRYLLLQTHYRTQLNFTFAGLDGAVSALERFSDFITRLHAIRREKVHKALDLILEKALPETGKKKEIHERILFDVQAEKGRDILDPTVLHGHVDGEKGSDILMEAFTSHLADDLNISPALAALFDMVREVNSLCDAGQIGISEAEDVLDFLRVIDQVLGVLPLELAKEEIPAELEEALQEREKARCAKDWKKADYFRDKIHAHGYLIEDTPQGARLKRRMP

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
186 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
197 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
198 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 2718217752 Candidatus Xiphinematobacter sp. Idaho Grape Isolate Unclassified
201 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 97.55
Metatranscriptomes 1.84
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.6
Nodule 0
Rhizoplane 2.45
Rhizosphere 91.1
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10309210 3300003323 Bacteria 8650
2 JGI25406J46586_10005363 3300003203 Bacteria 5950
3 Ga0065715_10016526 3300005293 Bacteria 4685
4 Ga0070658_10002935 3300005327 Bacteria 14138
5 Ga0070658_10007223 3300005327 Bacteria 8964
6 Ga0070690_100120355 3300005330 Bacteria 1761
7 Ga0070670_100002935 3300005331 Bacteria 14116
8 Ga0070670_100032618 3300005331 Bacteria 4486
9 Ga0070666_10001392 3300005335 Bacteria 14639
10 Ga0070666_10017018 3300005335 Bacteria 4657
11 Ga0070680_100052502 3300005336 Bacteria 3327
12 Ga0068868_100027978 3300005338 Bacteria 4304
13 Ga0068868_100028095 3300005338 Bacteria 4297
14 Ga0070689_100040452 3300005340 Bacteria 3575
15 Ga0070687_100006823 3300005343 Bacteria 4709
16 Ga0070661_100020428 3300005344 Bacteria 4722
17 Ga0070661_100022870 3300005344 Bacteria 4477
18 Ga0070668_100050805 3300005347 Bacteria 3193
19 Ga0070669_100004473 3300005353 Bacteria 10072
20 Ga0070669_100004715 3300005353 Bacteria 9830
21 Ga0070669_100053604 3300005353 Bacteria 2952
22 Ga0070675_100002340 3300005354 Bacteria 14081
23 Ga0070675_100035791 3300005354 Bacteria 4037
24 Ga0070671_100092240 3300005355 Bacteria 2537
25 Ga0070674_100003572 3300005356 Bacteria 8743
26 Ga0070674_100123712 3300005356 Bacteria 1918
27 Ga0070673_100004370 3300005364 Bacteria 8927
28 Ga0070673_100010098 3300005364 Bacteria 6372
29 Ga0070667_100003728 3300005367 Bacteria 12939
30 Ga0070667_100003848 3300005367 Bacteria 12745
31 Ga0070667_100021187 3300005367 Bacteria 5401
32 Ga0070714_100092497 3300005435 Bacteria 2651
33 Ga0070714_100183760 3300005435 Bacteria 1904
34 Ga0070713_100141400 3300005436 Bacteria 2132
35 Ga0070711_100011284 3300005439 Bacteria 5543
36 Ga0070711_100027657 3300005439 Bacteria 3725
37 Ga0070694_100005213 3300005444 Bacteria 7851
38 Ga0070708_100006107 3300005445 Bacteria 9582
39 Ga0070708_100244249 3300005445 Bacteria 1686
40 Ga0070662_100005237 3300005457 Bacteria 8274
41 Ga0070681_10007174 3300005458 Bacteria 10857
42 Ga0070681_10080958 3300005458 Bacteria 3203
43 Ga0070681_10262765 3300005458 Bacteria 1638
44 Ga0070706_100000682 3300005467 Bacteria 38464
45 Ga0070706_100000974 3300005467 Bacteria 31233
46 Ga0070706_100007463 3300005467 Bacteria 10252
47 Ga0070706_100010401 3300005467 Bacteria 8641
48 Ga0070706_100083338 3300005467 Bacteria 2962
49 Ga0070707_100000271 3300005468 Bacteria 51367
50 Ga0070707_100001496 3300005468 Bacteria 22762
51 Ga0070707_100011741 3300005468 Bacteria 8176
52 Ga0070707_100017415 3300005468 Bacteria 6755
53 Ga0070707_100186366 3300005468 Bacteria 2023
54 Ga0070698_100005547 3300005471 Bacteria 13793
55 Ga0070698_100006201 3300005471 Bacteria 13022
56 Ga0070698_100007511 3300005471 Bacteria 11794
57 Ga0070698_100021726 3300005471 Bacteria 6718
58 Ga0070699_100007087 3300005518 Bacteria 9735
59 Ga0070679_100008013 3300005530 Bacteria 9922
60 Ga0070697_100003187 3300005536 Bacteria 12608
61 Ga0070697_100005919 3300005536 Bacteria 9444
62 Ga0070697_100026126 3300005536 Bacteria 4661
63 Ga0068853_100133213 3300005539 Bacteria 2226
64 Ga0070672_100003269 3300005543 Bacteria 10492
65 Ga0070672_100018615 3300005543 Bacteria 5026
66 Ga0070695_100021548 3300005545 Bacteria 3946
67 Ga0070695_100163209 3300005545 Bacteria 1566
68 Ga0070696_100006671 3300005546 Bacteria 7710
69 Ga0070696_100015271 3300005546 Bacteria 5155
70 Ga0070693_100000012 3300005547 Bacteria 71975
71 Ga0070665_100012818 3300005548 Bacteria 8441
72 Ga0070704_100003038 3300005549 Bacteria 9551
73 Ga0070704_100019071 3300005549 Bacteria 4401
74 Ga0068855_100013480 3300005563 Bacteria 9854
75 Ga0068855_100138522 3300005563 Bacteria 2775
76 Ga0070664_100002387 3300005564 Bacteria 15086
77 Ga0070664_100065195 3300005564 Bacteria 3108
78 Ga0068864_100000266 3300005618 Bacteria 46438
79 Ga0068864_100134820 3300005618 Bacteria 2222
80 Ga0068866_10000025 3300005718 Bacteria 59717
81 Ga0068863_100082625 3300005841 Bacteria 3044
82 Ga0068863_100094872 3300005841 Bacteria 2832
83 Ga0068858_100275987 3300005842 Bacteria 1600
84 Ga0068860_100001302 3300005843 Bacteria 27105
85 Ga0068860_100007054 3300005843 Bacteria 11248
86 Ga0068860_100007170 3300005843 Bacteria 11151
87 Ga0068862_100007106 3300005844 Bacteria 9300
88 Ga0081539_10000511 3300005985 Bacteria 80587
89 Ga0081539_10041777 3300005985 Bacteria 2677
90 Ga0070717_10003147 3300006028 Bacteria 11792
91 Ga0070717_10010286 3300006028 Bacteria 7052
92 Ga0070717_10066992 3300006028 Unclassified 2986
93 Ga0070717_10081858 3300006028 Bacteria 2711
94 Ga0075364_10000238 3300006051 Bacteria 26259
95 Ga0070712_100023909 3300006175 Bacteria 4041
96 Ga0070712_100037367 3300006175 Bacteria 3310
97 Ga0075362_10000010 3300006177 Bacteria 109823
98 Ga0075362_10010410 3300006177 Bacteria 3630
99 Ga0075367_10093225 3300006178 Bacteria 1834
100 Ga0097621_100017982 3300006237 Bacteria 5386
101 Ga0097621_100035425 3300006237 Bacteria 3988
102 Ga0075370_10015569 3300006353 Bacteria 4074
103 Ga0075370_10024564 3300006353 Bacteria 3330
104 Ga0068871_100031993 3300006358 Bacteria 4151
105 Ga0075434_100052147 3300006871 Bacteria 4064
106 Ga0075434_100184184 3300006871 Bacteria 2109
107 Ga0068865_100042706 3300006881 Bacteria 3093
108 Ga0075435_100029799 3300007076 Bacteria 4286
109 Ga0075435_100149581 3300007076 Bacteria 1962
110 Ga0099795_10007885 3300007788 Bacteria 3002
111 Ga0105240_10045962 3300009093 Bacteria 5536
112 Ga0105240_10074479 3300009093 Bacteria 4190
113 Ga0105240_10366434 3300009093 Bacteria 1630
114 Ga0105245_10074220 3300009098 Bacteria 3095
115 Ga0114129_10083087 3300009147 Bacteria 4450
116 Ga0105243_10000140 3300009148 Bacteria 82929
117 Ga0105242_10000754 3300009176 Bacteria 25163
118 Ga0105242_10002946 3300009176 Bacteria 13307
119 Ga0105242_10045895 3300009176 Bacteria 3543
120 Ga0105248_10002077 3300009177 Bacteria 22165
121 Ga0105248_10028517 3300009177 Bacteria 6220
122 Ga0105237_10010073 3300009545 Bacteria 10083
123 Ga0105237_10031216 3300009545 Bacteria 5404
124 Ga0105249_10000915 3300009553 Bacteria 26085
125 Ga0105249_10017905 3300009553 Bacteria 6296
126 Ga0105239_10002183 3300010375 Bacteria 25163
127 Ga0105239_10067672 3300010375 Bacteria 3924
128 Ga0105239_10086472 3300010375 Bacteria 3455
129 Ga0157370_10015804 3300013104 Bacteria 7660
130 Ga0157369_10001481 3300013105 Bacteria 28793
131 Ga0157374_10292965 3300013296 Bacteria 1609
132 Ga0157378_10000087 3300013297 Bacteria 86860
133 Ga0157378_10015746 3300013297 Bacteria 6622
134 Ga0157378_10024307 3300013297 Bacteria 5329
135 Ga0163162_10001075 3300013306 Bacteria 25424
136 Ga0163162_10001318 3300013306 Bacteria 23171
137 Ga0163162_10006357 3300013306 Bacteria 11436
138 Ga0157372_10134381 3300013307 Bacteria 2848
139 Ga0157375_10007929 3300013308 Bacteria 9297
140 Ga0157375_10022935 3300013308 Bacteria 5752
141 Ga0157375_10101168 3300013308 Bacteria 2964
142 Ga0157375_10133221 3300013308 Bacteria 2606
143 Ga0163163_10001709 3300014325 Bacteria 18542
144 Ga0163163_10020691 3300014325 Bacteria 6201
145 Ga0163163_10083910 3300014325 Bacteria 3192
146 Ga0163163_10165039 3300014325 Bacteria 2261
147 Ga0157379_10035042 3300014968 Bacteria 4474
148 Ga0157379_10036132 3300014968 Bacteria 4406
149 Ga0157376_10015112 3300014969 Bacteria 5819
150 Ga0157376_10017598 3300014969 Bacteria 5458
151 Ga0213872_10018787 3300021361 Bacteria 3185
152 Ga0207697_10000137 3300025315 Bacteria 35201
153 Ga0207697_10001178 3300025315 Bacteria 14353
154 Ga0207642_10000081 3300025899 Bacteria 25151
155 Ga0207688_10002946 3300025901 Bacteria 9262
156 Ga0207680_10003284 3300025903 Bacteria 7619
157 Ga0207699_10046265 3300025906 Bacteria 2544
158 Ga0207645_10000845 3300025907 Bacteria 25538
159 Ga0207645_10002900 3300025907 Bacteria 13250
160 Ga0207705_10011036 3300025909 Bacteria 6553
161 Ga0207684_10000736 3300025910 Bacteria 38478
162 Ga0207684_10004418 3300025910 Bacteria 13241
163 Ga0207684_10050336 3300025910 Bacteria 3533
164 Ga0207707_10011482 3300025912 Bacteria 7713
165 Ga0207695_10004520 3300025913 Bacteria 18925
166 Ga0207695_10021024 3300025913 Bacteria 7454
167 Ga0207671_10007308 3300025914 Bacteria 9597
168 Ga0207671_10046319 3300025914 Bacteria 3217
169 Ga0207693_10012702 3300025915 Bacteria 6801
170 Ga0207663_10007897 3300025916 Bacteria 5549
171 Ga0207663_10047323 3300025916 Bacteria 2655
172 Ga0207662_10000384 3300025918 Bacteria 19794
173 Ga0207649_10005666 3300025920 Bacteria 6763
174 Ga0207649_10137168 3300025920 Bacteria 1669
175 Ga0207652_10011119 3300025921 Bacteria 7255
176 Ga0207646_10000054 3300025922 Bacteria 160414
177 Ga0207646_10006210 3300025922 Bacteria 12417
178 Ga0207646_10011704 3300025922 Bacteria 8483
179 Ga0207646_10037070 3300025922 Bacteria 4398
180 Ga0207646_10097442 3300025922 Bacteria 2635
181 Ga0207646_10129204 3300025922 Bacteria 2273
182 Ga0207681_10001329 3300025923 Bacteria 15926
183 Ga0207681_10004961 3300025923 Bacteria 8176
184 Ga0207681_10012840 3300025923 Bacteria 5179
185 Ga0207650_10001412 3300025925 Bacteria 17305
186 Ga0207659_10040068 3300025926 Bacteria 3273
187 Ga0207687_10050983 3300025927 Bacteria 2883
188 Ga0207664_10158678 3300025929 Bacteria 1928
189 Ga0207644_10006722 3300025931 Bacteria 7492
190 Ga0207706_10000509 3300025933 Bacteria 41327
191 Ga0207686_10000076 3300025934 Bacteria 90345
192 Ga0207709_10024355 3300025935 Bacteria 3455
193 Ga0207670_10028096 3300025936 Bacteria 3566
194 Ga0207669_10007961 3300025937 Bacteria 4944
195 Ga0207704_10024814 3300025938 Bacteria 3260
196 Ga0207691_10000149 3300025940 Bacteria 64627
197 Ga0207691_10007349 3300025940 Bacteria 10621
198 Ga0207711_10064566 3300025941 Bacteria 3163
199 Ga0207711_10125464 3300025941 Bacteria 2296
200 Ga0207711_10204900 3300025941 Bacteria 1801
201 Ga0207661_10042491 3300025944 Bacteria 3584
202 Ga0207679_10047548 3300025945 Bacteria 3118
203 Ga0207668_10001807 3300025972 Bacteria 12479
204 Ga0207668_10014578 3300025972 Bacteria 4865
205 Ga0207658_10049990 3300025986 Bacteria 3074
206 Ga0207677_10013095 3300026023 Bacteria 4794
207 Ga0207703_10093043 3300026035 Bacteria 2539
208 Ga0207641_10025552 3300026088 Bacteria 4870
209 Ga0207641_10079682 3300026088 Bacteria 2840
210 Ga0207641_10204940 3300026088 Bacteria 1821
211 Ga0207676_10003907 3300026095 Bacteria 10524
212 Ga0207683_10000892 3300026121 Bacteria 27438
213 Ga0209588_1004717 3300027671 Bacteria 3864
214 Ga0265354_1000372 3300028016 Bacteria 7925
215 Ga0268266_10024354 3300028379 Bacteria 5148
216 Ga0268264_10000659 3300028381 Bacteria 40567
217 Ga0268264_10021428 3300028381 Bacteria 5278
218 Ga0268264_10035717 3300028381 Bacteria 4092
219 Ga0265334_10021712 3300028573 Bacteria 2621
220 Ga0265338_10031537 3300028800 Bacteria 5194
221 Ga0265338_10108099 3300028800 Bacteria 2247
222 Ga0265770_1003362 3300030878 Bacteria 2174
223 Ga0265770_1006530 3300030878 Bacteria 1623
224 Ga0265765_1002039 3300030879 Bacteria 1923
225 Ga0265760_10002947 3300031090 Bacteria 4976
226 Ga0265760_10007448 3300031090 Bacteria 3129
227 Ga0265760_10015609 3300031090 Bacteria 2177
228 Ga0265320_10005333 3300031240 Bacteria 8268
229 Ga0265325_10003057 3300031241 Bacteria 11058
230 Ga0265339_10054360 3300031249 Bacteria 2175
231 Ga0265316_10054269 3300031344 Bacteria 3138
232 Ga0265313_10031285 3300031595 Bacteria 2730
233 Ga0265314_10066566 3300031711 Bacteria 2429
234 Ga0316578_10107954 3300031728 Archaea 1671
235 Ga0373926_0026646 3300035083 Bacteria 2023
236 Ga0373954_0009981 3300035118 Bacteria 4182
237 Ga0373931_0049138 3300035691 Bacteria 2239
238 Ga0373935_0067081 3300035692 Bacteria 2306
239 Ga0373927_0001864 3300035695 Bacteria 15625
240 Ga0373927_0048473 3300035695 Bacteria 2748
241 Ga0373933_0000123 3300035724 Bacteria 50134
242 Ga0373937_0000109 3300036401 Bacteria 78815
243 Ga0373937_0043536 3300036401 Bacteria 4099
244 Ga0373937_0084753 3300036401 Bacteria 2932
245 Ga0373937_0103301 3300036401 Bacteria 2647
246 Ga0373937_0103435 3300036401 Bacteria 2645
247 Ga0316582_0001678 3300036647 Archaea 9928
248 Ga0316584_0050421 3300036712 Bacteria 3112
249 Ga0373925_0006893 3300037068 Bacteria 8318
250 Ga0373925_0043827 3300037068 Bacteria 3322
251 Ga0436360_0041517 3300039438 Unclassified 3182
252 Ga0436360_1201732 3300039438 Bacteria 6356
253 Ga0436361_0365873 3300039447 Bacteria 4341
254 Ga0436361_0473098 3300039447 Bacteria 21318
255 Ga0436361_0930174 3300039447 Unclassified 1697
256 Ga0436363_1147530 3300039450 Bacteria 3411
257 Ga0451577_0174106 3300042876 Bacteria 1939
258 Ga0451577_0184716 3300042876 Bacteria 1880
259 Ga0451577_0235654 3300042876 Bacteria 1655
260 Ga0453683_0002478 3300044673 Bacteria 14265
261 Ga0453683_0039631 3300044673 Bacteria 2960
262 Ga0453684_0000017 3300044712 Bacteria 925696
263 Ga0453684_0010549 3300044712 Bacteria 15770
264 Ga0453684_0013253 3300044712 Bacteria 13427
265 Ga0453684_0043511 3300044712 Bacteria 6034
266 Ga0453684_0161245 3300044712 Bacteria 2653
267 Ga0453684_0230423 3300044712 Bacteria 2139
268 Ga0451576_0043577 3300045051 Bacteria 4734
269 Ga0466967_0186677 3300045976 Bacteria 1958
270 Ga0495592_0011134 3300046454 Bacteria 6794
271 Ga0495592_0184358 3300046454 Bacteria 1419
272 Ga0495651_0004769 3300046462 Bacteria 10380
273 Ga0495580_0005798 3300046472 Bacteria 10139
274 Ga0495580_0010278 3300046472 Bacteria 7301
275 Ga0495582_0010525 3300046473 Bacteria 5088
276 Ga0495582_0020628 3300046473 Bacteria 3608
277 Ga0495594_0005716 3300046499 Bacteria 6390
278 Ga0495643_0000611 3300046522 Bacteria 42764
279 Ga0495640_0114505 3300046533 Bacteria 1758
280 Ga0495587_0000113 3300046536 Bacteria 61684
281 Ga0495587_0029618 3300046536 Bacteria 3323
282 Ga0495598_0016213 3300046537 Bacteria 1897
283 Ga0495667_0067339 3300046559 Bacteria 2340
284 Ga0495635_0063217 3300046663 Bacteria 2542
285 Ga0495657_0019301 3300046675 Bacteria 4920
286 Ga0495669_0001772 3300046684 Bacteria 8819
287 Ga0495624_0024492 3300046690 Bacteria 3971
288 Ga0495604_0032003 3300047317 Bacteria 4170
289 Ga0495636_0041177 3300047318 Bacteria 1917
290 Ga0495674_0027545 3300047319 Bacteria 5192
291 Ga0495675_0000332 3300047444 Bacteria 33242
292 Ga0495602_0000340 3300048088 Bacteria 43136
293 Ga0496102_0044469 3300048905 Bacteria 4031
294 Ga0496102_0244996 3300048905 Bacteria 1690
295 Ga0496105_0253177 3300048908 Bacteria 1426
296 Ga0496108_0061593 3300048911 Bacteria 3158
297 Ga0496109_0116563 3300048912 Bacteria 2486
298 Ga0496109_0181276 3300048912 Bacteria 1978
299 Ga0496115_0139518 3300048918 Bacteria 2000
300 Ga0496116_0069937 3300048919 Bacteria 2230
301 Ga0496125_0000017 3300048928 Bacteria 508217
302 Ga0496126_0173447 3300048929 Bacteria 1836
303 Ga0501034_0221825 3300049571 Bacteria 1843
304 Ga0501259_000325 3300049688 Bacteria 7533
305 Ga0501080_0139588 3300049742 Bacteria 2241
306 nmdc:mga03683_5_c1 3300050489 Bacteria 157897
307 nmdc:mga03n38_11293_c1 3300050490 Bacteria 3321
308 nmdc:mga00v17_95_c1 3300050491 Bacteria 52432
309 nmdc:mga07m45_1877_c1 3300050496 Bacteria 9711
310 nmdc:mga05p37_360722_c1 3300050507 Bacteria 1708
311 nmdc:mga05p37_41985_c2 3300050507 Bacteria 5275
312 nmdc:mga0n895_193786_c1 3300050512 Bacteria 2063
313 nmdc:mga0n895_41052_c1 3300050512 Bacteria 4497
314 nmdc:mga0rr50_137577_c1 3300050513 Bacteria 1962
315 nmdc:mga0rr50_95593_c1 3300050513 Bacteria 2323
316 nmdc:mga08x19_193_c1 3300050514 Bacteria 47757
317 nmdc:mga08x19_20655_c1 3300050514 Bacteria 4056
318 Ga0495601_0112561 3300053077 Bacteria 1763
319 Ga0500555_000176 3300053103 Bacteria 29367
320 Ga0500556_0001216 3300053104 Bacteria 12057
321 Ga0500595_000035 3300053119 Bacteria 106463
322 Ga0500642_0000424 3300053130 Bacteria 13781
323 Ga0500638_000002 3300053162 Bacteria 188968
324 Ga0501082_0000151 3300060353 Bacteria 58286
325 2718716185 2718217752 Bacteria 915884
326 2787437890 2786546517 Bacteria 6614109
327 rootH1_10309210
328 JGI25406J46586_10005363
329 Ga0065715_10016526
330 Ga0070658_10002935
331 Ga0070658_10007223
332 Ga0070690_100120355
333 Ga0070670_100002935
334 Ga0070670_100032618
335 Ga0070666_10001392
336 Ga0070666_10017018
337 Ga0070680_100052502
338 Ga0068868_100027978
339 Ga0068868_100028095
340 Ga0070689_100040452
341 Ga0070687_100006823
342 Ga0070661_100020428
343 Ga0070661_100022870
344 Ga0070668_100050805
345 Ga0070669_100004473
346 Ga0070669_100004715
347 Ga0070669_100053604
348 Ga0070675_100002340
349 Ga0070675_100035791
350 Ga0070671_100092240
351 Ga0070674_100003572
352 Ga0070674_100123712
353 Ga0070673_100004370
354 Ga0070673_100010098
355 Ga0070667_100003728
356 Ga0070667_100003848
357 Ga0070667_100021187
358 Ga0070714_100092497
359 Ga0070714_100183760
360 Ga0070713_100141400
361 Ga0070711_100011284
362 Ga0070711_100027657
363 Ga0070694_100005213
364 Ga0070708_100006107
365 Ga0070708_100244249
366 Ga0070662_100005237
367 Ga0070681_10007174
368 Ga0070681_10080958
369 Ga0070681_10262765
370 Ga0070706_100000682
371 Ga0070706_100000974
372 Ga0070706_100007463
373 Ga0070706_100010401
374 Ga0070706_100083338
375 Ga0070707_100000271
376 Ga0070707_100001496
377 Ga0070707_100011741
378 Ga0070707_100017415
379 Ga0070707_100186366
380 Ga0070698_100005547
381 Ga0070698_100006201
382 Ga0070698_100007511
383 Ga0070698_100021726
384 Ga0070699_100007087
385 Ga0070679_100008013
386 Ga0070697_100003187
387 Ga0070697_100005919
388 Ga0070697_100026126
389 Ga0068853_100133213
390 Ga0070672_100003269
391 Ga0070672_100018615
392 Ga0070695_100021548
393 Ga0070695_100163209
394 Ga0070696_100006671
395 Ga0070696_100015271
396 Ga0070693_100000012
397 Ga0070665_100012818
398 Ga0070704_100003038
399 Ga0070704_100019071
400 Ga0068855_100013480
401 Ga0068855_100138522
402 Ga0070664_100002387
403 Ga0070664_100065195
404 Ga0068864_100000266
405 Ga0068864_100134820
406 Ga0068866_10000025
407 Ga0068863_100082625
408 Ga0068863_100094872
409 Ga0068858_100275987
410 Ga0068860_100001302
411 Ga0068860_100007054
412 Ga0068860_100007170
413 Ga0068862_100007106
414 Ga0081539_10000511
415 Ga0081539_10041777
416 Ga0070717_10003147
417 Ga0070717_10010286
418 Ga0070717_10066992
419 Ga0070717_10081858
420 Ga0075364_10000238
421 Ga0070712_100023909
422 Ga0070712_100037367
423 Ga0075362_10000010
424 Ga0075362_10010410
425 Ga0075367_10093225
426 Ga0097621_100017982
427 Ga0097621_100035425
428 Ga0075370_10015569
429 Ga0075370_10024564
430 Ga0068871_100031993
431 Ga0075434_100052147
432 Ga0075434_100184184
433 Ga0068865_100042706
434 Ga0075435_100029799
435 Ga0075435_100149581
436 Ga0099795_10007885
437 Ga0105240_10045962
438 Ga0105240_10074479
439 Ga0105240_10366434
440 Ga0105245_10074220
441 Ga0114129_10083087
442 Ga0105243_10000140
443 Ga0105242_10000754
444 Ga0105242_10002946
445 Ga0105242_10045895
446 Ga0105248_10002077
447 Ga0105248_10028517
448 Ga0105237_10010073
449 Ga0105237_10031216
450 Ga0105249_10000915
451 Ga0105249_10017905
452 Ga0105239_10002183
453 Ga0105239_10067672
454 Ga0105239_10086472
455 Ga0157370_10015804
456 Ga0157369_10001481
457 Ga0157374_10292965
458 Ga0157378_10000087
459 Ga0157378_10015746
460 Ga0157378_10024307
461 Ga0163162_10001075
462 Ga0163162_10001318
463 Ga0163162_10006357
464 Ga0157372_10134381
465 Ga0157375_10007929
466 Ga0157375_10022935
467 Ga0157375_10101168
468 Ga0157375_10133221
469 Ga0163163_10001709
470 Ga0163163_10020691
471 Ga0163163_10083910
472 Ga0163163_10165039
473 Ga0157379_10035042
474 Ga0157379_10036132
475 Ga0157376_10015112
476 Ga0157376_10017598
477 Ga0213872_10018787
478 Ga0207697_10000137
479 Ga0207697_10001178
480 Ga0207642_10000081
481 Ga0207688_10002946
482 Ga0207680_10003284
483 Ga0207699_10046265
484 Ga0207645_10000845
485 Ga0207645_10002900
486 Ga0207705_10011036
487 Ga0207684_10000736
488 Ga0207684_10004418
489 Ga0207684_10050336
490 Ga0207707_10011482
491 Ga0207695_10004520
492 Ga0207695_10021024
493 Ga0207671_10007308
494 Ga0207671_10046319
495 Ga0207693_10012702
496 Ga0207663_10007897
497 Ga0207663_10047323
498 Ga0207662_10000384
499 Ga0207649_10005666
500 Ga0207649_10137168
501 Ga0207652_10011119
502 Ga0207646_10000054
503 Ga0207646_10006210
504 Ga0207646_10011704
505 Ga0207646_10037070
506 Ga0207646_10097442
507 Ga0207646_10129204
508 Ga0207681_10001329
509 Ga0207681_10004961
510 Ga0207681_10012840
511 Ga0207650_10001412
512 Ga0207659_10040068
513 Ga0207687_10050983
514 Ga0207664_10158678
515 Ga0207644_10006722
516 Ga0207706_10000509
517 Ga0207686_10000076
518 Ga0207709_10024355
519 Ga0207670_10028096
520 Ga0207669_10007961
521 Ga0207704_10024814
522 Ga0207691_10000149
523 Ga0207691_10007349
524 Ga0207711_10064566
525 Ga0207711_10125464
526 Ga0207711_10204900
527 Ga0207661_10042491
528 Ga0207679_10047548
529 Ga0207668_10001807
530 Ga0207668_10014578
531 Ga0207658_10049990
532 Ga0207677_10013095
533 Ga0207703_10093043
534 Ga0207641_10025552
535 Ga0207641_10079682
536 Ga0207641_10204940
537 Ga0207676_10003907
538 Ga0207683_10000892
539 Ga0209588_1004717
540 Ga0265354_1000372
541 Ga0268266_10024354
542 Ga0268264_10000659
543 Ga0268264_10021428
544 Ga0268264_10035717
545 Ga0265334_10021712
546 Ga0265338_10031537
547 Ga0265338_10108099
548 Ga0265770_1003362
549 Ga0265770_1006530
550 Ga0265765_1002039
551 Ga0265760_10002947
552 Ga0265760_10007448
553 Ga0265760_10015609
554 Ga0265320_10005333
555 Ga0265325_10003057
556 Ga0265339_10054360
557 Ga0265316_10054269
558 Ga0265313_10031285
559 Ga0265314_10066566
560 Ga0316578_10107954
561 Ga0373926_0026646
562 Ga0373954_0009981
563 Ga0373931_0049138
564 Ga0373935_0067081
565 Ga0373927_0001864
566 Ga0373927_0048473
567 Ga0373933_0000123
568 Ga0373937_0000109
569 Ga0373937_0043536
570 Ga0373937_0084753
571 Ga0373937_0103301
572 Ga0373937_0103435
573 Ga0316582_0001678
574 Ga0316584_0050421
575 Ga0373925_0006893
576 Ga0373925_0043827
577 Ga0436360_0041517
578 Ga0436360_1201732
579 Ga0436361_0365873
580 Ga0436361_0473098
581 Ga0436361_0930174
582 Ga0436363_1147530
583 Ga0451577_0174106
584 Ga0451577_0184716
585 Ga0451577_0235654
586 Ga0453683_0002478
587 Ga0453683_0039631
588 Ga0453684_0000017
589 Ga0453684_0010549
590 Ga0453684_0013253
591 Ga0453684_0043511
592 Ga0453684_0161245
593 Ga0453684_0230423
594 Ga0451576_0043577
595 Ga0466967_0186677
596 Ga0495592_0011134
597 Ga0495592_0184358
598 Ga0495651_0004769
599 Ga0495580_0005798
600 Ga0495580_0010278
601 Ga0495582_0010525
602 Ga0495582_0020628
603 Ga0495594_0005716
604 Ga0495643_0000611
605 Ga0495640_0114505
606 Ga0495587_0000113
607 Ga0495587_0029618
608 Ga0495598_0016213
609 Ga0495667_0067339
610 Ga0495635_0063217
611 Ga0495657_0019301
612 Ga0495669_0001772
613 Ga0495624_0024492
614 Ga0495604_0032003
615 Ga0495636_0041177
616 Ga0495674_0027545
617 Ga0495675_0000332
618 Ga0495602_0000340
619 Ga0496102_0044469
620 Ga0496102_0244996
621 Ga0496105_0253177
622 Ga0496108_0061593
623 Ga0496109_0116563
624 Ga0496109_0181276
625 Ga0496115_0139518
626 Ga0496116_0069937
627 Ga0496125_0000017
628 Ga0496126_0173447
629 Ga0501034_0221825
630 Ga0501259_000325
631 Ga0501080_0139588
632 nmdc:mga03683_5_c1
633 nmdc:mga03n38_11293_c1
634 nmdc:mga00v17_95_c1
635 nmdc:mga07m45_1877_c1
636 nmdc:mga05p37_360722_c1
637 nmdc:mga05p37_41985_c2
638 nmdc:mga0n895_193786_c1
639 nmdc:mga0n895_41052_c1
640 nmdc:mga0rr50_137577_c1
641 nmdc:mga0rr50_95593_c1
642 nmdc:mga08x19_193_c1
643 nmdc:mga08x19_20655_c1
644 Ga0495601_0112561
645 Ga0500555_000176
646 Ga0500556_0001216
647 Ga0500595_000035
648 Ga0500642_0000424
649 Ga0500638_000002
650 Ga0501082_0000151
651 2718716185
652 2787437890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01406

tRNA-synt_1e

tRNA synthetases class I (C) catalytic domain

19

326

0.96

PF09190

DALR_2

DALR domain

405

462

0.96

PF23493

467

515

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1li5-assembly2.cif.gz_B crystal structure of cysteinyl-trna synthetase 0.9407 3 409
1li7-assembly1.cif.gz_A crystal structure of cysteinyl-trna synthetase with cysteine substrate bound 0.9316 3 409
3tqo-assembly1.cif.gz_A structure of the cysteinyl-trna synthetase (cyss) from coxiella burnetii. 0.9268 1 406
1li5-assembly2.cif.gz_B crystal structure of cysteinyl-trna synthetase 0.9234 3 409
1li7-assembly2.cif.gz_B crystal structure of cysteinyl-trna synthetase with cysteine substrate bound 0.9213 3 409
ID Description Score Start End Superfamily
1li7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9632 18 313 3.40.50.620
1li7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9597 18 313 3.40.50.620
af_Q2G2M6_1_304_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9476 3 313 3.40.50.620
af_Q2G2M6_1_304_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9415 3 313 3.40.50.620
af_C0PHQ1_15_336_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9406 2 313 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2E5HGJ1-F1-model_v4 Cysteine--tRNA ligase (EC 6.1.1.16) 0.9826 3 294 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A2E5HNF3-F1-model_v4 Cysteine--tRNA ligase 0.9801 1 217 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-J1F6D8-F1-model_v4 Cysteinyl-tRNA synthetase 0.9779 3 137 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A3N5PRA2-F1-model_v4 Cysteine--tRNA ligase (EC 6.1.1.16) 0.9775 3 165 GO:0004817
GO:0005524
GO:0005829
GO:0006423
AF-A0A6I1ISA6-F1-model_v4 deleted 0.9771 1 140

Map