F407905

General Info

Members Datasets Scaffolds Average Seq Length
325 80 325 58

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_101411999|Ga0307415_1014119992
Length 58
Sequence MPRRLIWQIDMGDGTWAVCCMACRLPLYRGPKLATAERVFANHLCEPVVPLGRRRRRR

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
4 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
5 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
6 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
7 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
8 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
9 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
10 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
11 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
12 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
13 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
15 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
16 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
17 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
18 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
19 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
20 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
21 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
22 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
23 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
24 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
25 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
26 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
27 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
28 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
29 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
30 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
31 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
32 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
33 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
34 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
35 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
36 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
37 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
38 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
39 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
40 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
41 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
42 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
43 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
44 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
45 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
46 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
47 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
49 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
50 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
51 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
52 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
58 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
59 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
60 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
61 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
62 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
63 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
64 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
65 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
66 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
67 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
68 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
69 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
72 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
73 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
74 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
75 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
76 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
77 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
78 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
79 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
80 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10008820 3300005981 Bacteria 8494
2 Ga0081538_10013484 3300005981 Bacteria 6464
3 Ga0081538_10017663 3300005981 Bacteria 5402
4 Ga0081538_10039890 3300005981 Bacteria 3004
5 Ga0081538_10052220 3300005981 Bacteria 2445
6 Ga0081538_10112935 3300005981 Bacteria 1328
7 Ga0081538_10172723 3300005981 Unclassified 940
8 Ga0081538_10227141 3300005981 Unclassified 733
9 Ga0081538_10363007 3300005981 Bacteria 523
10 Ga0081539_10001512 3300005985 Bacteria 39176
11 Ga0081539_10499546 3300005985 Bacteria 504
12 Ga0075428_100011693 3300006844 Bacteria 9769
13 Ga0075428_100022229 3300006844 Bacteria 7022
14 Ga0075428_100915566 3300006844 Bacteria 930
15 Ga0075428_101328700 3300006844 Bacteria 756
16 Ga0075430_100296240 3300006846 Bacteria 1338
17 Ga0075430_100315359 3300006846 Bacteria 1293
18 Ga0075430_100431468 3300006846 Bacteria 1088
19 Ga0075431_100113976 3300006847 Bacteria 2790
20 Ga0075431_100168552 3300006847 Bacteria 2251
21 Ga0075431_100467944 3300006847 Unclassified 1254
22 Ga0075431_100542112 3300006847 Bacteria 1151
23 Ga0075433_10658244 3300006852 Bacteria 918
24 Ga0075429_100010819 3300006880 Bacteria 7889
25 Ga0075429_100017242 3300006880 Bacteria 6247
26 Ga0075429_100029027 3300006880 Bacteria 4803
27 Ga0075429_100223372 3300006880 Unclassified 1650
28 Ga0111539_10310215 3300009094 Bacteria 1836
29 Ga0111539_10718341 3300009094 Bacteria 1163
30 Ga0111539_10992362 3300009094 Unclassified 976
31 Ga0111539_11731198 3300009094 Unclassified 725
32 Ga0114129_10016362 3300009147 Bacteria 10559
33 Ga0114129_10017333 3300009147 Bacteria 10253
34 Ga0114129_10044773 3300009147 Bacteria 6224
35 Ga0114129_10062172 3300009147 Bacteria 5217
36 Ga0114129_10168248 3300009147 Bacteria 2990
37 Ga0114129_10265393 3300009147 Bacteria 2299
38 Ga0114129_10319938 3300009147 Bacteria 2063
39 Ga0114129_10336176 3300009147 Bacteria 2004
40 Ga0114129_11090453 3300009147 Bacteria 1000
41 Ga0114129_12944313 3300009147 Unclassified 562
42 Ga0114129_13414787 3300009147 Bacteria 510
43 Ga0105249_10447657 3300009553 Bacteria 1330
44 Ga0157372_12841471 3300013307 Bacteria 555
45 Ga0182008_10391135 3300014497 Bacteria 745
46 Ga0207712_10911486 3300025961 Bacteria 777
47 Ga0307408_100201051 3300031548 Unclassified 1613
48 Ga0307405_10018373 3300031731 Bacteria 3856
49 Ga0307405_10039419 3300031731 Bacteria 2855
50 Ga0307405_10048890 3300031731 Bacteria 2611
51 Ga0307405_10072262 3300031731 Bacteria 2223
52 Ga0307405_10102882 3300031731 Bacteria 1919
53 Ga0307405_10160784 3300031731 Bacteria 1590
54 Ga0307405_10198808 3300031731 Unclassified 1454
55 Ga0307405_10235299 3300031731 Bacteria 1353
56 Ga0307405_10300091 3300031731 Bacteria 1218
57 Ga0307405_10324499 3300031731 Bacteria 1177
58 Ga0307405_10344322 3300031731 Unclassified 1147
59 Ga0307405_11509033 3300031731 Unclassified 591
60 Ga0307413_10037744 3300031824 Bacteria 2793
61 Ga0307413_10265130 3300031824 Unclassified 1283
62 Ga0307413_10296643 3300031824 Unclassified 1224
63 Ga0307413_10657221 3300031824 Bacteria 865
64 Ga0307413_11194673 3300031824 Unclassified 661
65 Ga0307413_11283882 3300031824 Bacteria 640
66 Ga0307413_11570238 3300031824 Unclassified 584
67 Ga0307410_10065311 3300031852 Bacteria 2503
68 Ga0307410_10191860 3300031852 Unclassified 1554
69 Ga0307410_10330853 3300031852 Bacteria 1211
70 Ga0307410_10378529 3300031852 Bacteria 1138
71 Ga0307410_10527536 3300031852 Bacteria 975
72 Ga0307410_10696388 3300031852 Bacteria 856
73 Ga0307410_10786136 3300031852 Bacteria 808
74 Ga0307410_11156680 3300031852 Bacteria 673
75 Ga0307410_11997616 3300031852 Bacteria 517
76 Ga0307406_10003416 3300031901 Bacteria 8652
77 Ga0307406_10056643 3300031901 Bacteria 2511
78 Ga0307406_10120990 3300031901 Bacteria 1820
79 Ga0307406_10283274 3300031901 Unclassified 1265
80 Ga0307406_10303219 3300031901 Bacteria 1228
81 Ga0307406_10363880 3300031901 Unclassified 1135
82 Ga0307406_10639304 3300031901 Unclassified 882
83 Ga0307406_10641893 3300031901 Unclassified 880
84 Ga0307406_10685042 3300031901 Unclassified 854
85 Ga0307406_10712651 3300031901 Bacteria 839
86 Ga0307406_11401285 3300031901 Unclassified 613
87 Ga0307406_11450178 3300031901 Bacteria 603
88 Ga0307406_11679118 3300031901 Bacteria 562
89 Ga0307407_10005148 3300031903 Bacteria 5640
90 Ga0307407_10552557 3300031903 Bacteria 851
91 Ga0307407_10651332 3300031903 Bacteria 789
92 Ga0307407_10680269 3300031903 Bacteria 773
93 Ga0307407_10923549 3300031903 Unclassified 671
94 Ga0307407_11663804 3300031903 Bacteria 508
95 Ga0307412_10024434 3300031911 Bacteria 3730
96 Ga0307412_10142017 3300031911 Bacteria 1760
97 Ga0307412_10408113 3300031911 Bacteria 1108
98 Ga0307412_10572927 3300031911 Bacteria 952
99 Ga0307412_10688759 3300031911 Unclassified 876
100 Ga0307412_10693833 3300031911 Bacteria 873
101 Ga0307412_10897029 3300031911 Unclassified 777
102 Ga0307409_100000747 3300031995 Bacteria 14649
103 Ga0307409_100005460 3300031995 Bacteria 7322
104 Ga0307409_100007667 3300031995 Bacteria 6478
105 Ga0307409_100042889 3300031995 Unclassified 3392
106 Ga0307409_100053108 3300031995 Unclassified 3112
107 Ga0307409_100076850 3300031995 Bacteria 2679
108 Ga0307409_100111126 3300031995 Bacteria 2298
109 Ga0307409_100112887 3300031995 Bacteria 2283
110 Ga0307409_100122963 3300031995 Bacteria 2202
111 Ga0307409_100141156 3300031995 Bacteria 2076
112 Ga0307409_100220745 3300031995 Bacteria 1711
113 Ga0307409_100272274 3300031995 Unclassified 1560
114 Ga0307409_100343059 3300031995 Bacteria 1406
115 Ga0307409_100390297 3300031995 Unclassified 1326
116 Ga0307409_100468944 3300031995 Bacteria 1219
117 Ga0307409_100527162 3300031995 Bacteria 1155
118 Ga0307409_100903159 3300031995 Bacteria 897
119 Ga0307409_100911239 3300031995 Unclassified 893
120 Ga0307409_100946655 3300031995 Bacteria 877
121 Ga0307409_101019054 3300031995 Bacteria 846
122 Ga0307409_101269959 3300031995 Bacteria 761
123 Ga0307409_101754936 3300031995 Unclassified 650
124 Ga0307409_102213166 3300031995 Bacteria 579
125 Ga0307409_102562441 3300031995 Bacteria 538
126 Ga0307416_100000939 3300032002 Bacteria 15432
127 Ga0307416_100014058 3300032002 Bacteria 5466
128 Ga0307416_100014370 3300032002 Bacteria 5422
129 Ga0307416_100016504 3300032002 Bacteria 5135
130 Ga0307416_100030539 3300032002 Bacteria 4044
131 Ga0307416_100042291 3300032002 Unclassified 3556
132 Ga0307416_100083739 3300032002 Bacteria 2707
133 Ga0307416_100106019 3300032002 Bacteria 2462
134 Ga0307416_100214277 3300032002 Bacteria 1840
135 Ga0307416_100261284 3300032002 Bacteria 1692
136 Ga0307416_100280511 3300032002 Bacteria 1642
137 Ga0307416_100305740 3300032002 Unclassified 1583
138 Ga0307416_100486089 3300032002 Bacteria 1296
139 Ga0307416_100626132 3300032002 Bacteria 1158
140 Ga0307416_100820858 3300032002 Bacteria 1027
141 Ga0307416_100897831 3300032002 Bacteria 986
142 Ga0307416_101665930 3300032002 Bacteria 743
143 Ga0307416_101797937 3300032002 Unclassified 717
144 Ga0307416_102108647 3300032002 Bacteria 666
145 Ga0307416_102456633 3300032002 Unclassified 620
146 Ga0307416_103017121 3300032002 Unclassified 563
147 Ga0307416_103896352 3300032002 Unclassified 500
148 Ga0307414_10262533 3300032004 Bacteria 1442
149 Ga0307414_10263765 3300032004 Unclassified 1439
150 Ga0307414_10429066 3300032004 Unclassified 1154
151 Ga0307414_10786970 3300032004 Bacteria 867
152 Ga0307414_10793838 3300032004 Unclassified 863
153 Ga0307414_10999244 3300032004 Bacteria 770
154 Ga0307414_11188796 3300032004 Bacteria 706
155 Ga0307414_11285959 3300032004 Bacteria 678
156 Ga0307414_11969282 3300032004 Bacteria 545
157 Ga0307411_10171418 3300032005 Bacteria 1637
158 Ga0307411_10347301 3300032005 Unclassified 1208
159 Ga0307411_10653206 3300032005 Bacteria 911
160 Ga0307411_10960991 3300032005 Bacteria 763
161 Ga0307411_11234145 3300032005 Bacteria 679
162 Ga0307411_12187273 3300032005 Bacteria 518
163 Ga0307411_12263242 3300032005 Unclassified 510
164 Ga0307415_100001020 3300032126 Bacteria 12935
165 Ga0307415_100002750 3300032126 Bacteria 8792
166 Ga0307415_100003244 3300032126 Bacteria 8256
167 Ga0307415_100005004 3300032126 Bacteria 6976
168 Ga0307415_100009013 3300032126 Bacteria 5565
169 Ga0307415_100009172 3300032126 Bacteria 5526
170 Ga0307415_100025598 3300032126 Bacteria 3706
171 Ga0307415_100026109 3300032126 Bacteria 3678
172 Ga0307415_100041642 3300032126 Bacteria 3051
173 Ga0307415_100045239 3300032126 Bacteria 2949
174 Ga0307415_100086526 3300032126 Bacteria 2255
175 Ga0307415_100106568 3300032126 Unclassified 2069
176 Ga0307415_100143531 3300032126 Bacteria 1827
177 Ga0307415_100181063 3300032126 Unclassified 1653
178 Ga0307415_100223297 3300032126 Unclassified 1512
179 Ga0307415_100305126 3300032126 Bacteria 1320
180 Ga0307415_100318061 3300032126 Bacteria 1296
181 Ga0307415_100342768 3300032126 Bacteria 1255
182 Ga0307415_100352965 3300032126 Unclassified 1239
183 Ga0307415_100353433 3300032126 Bacteria 1238
184 Ga0307415_100365995 3300032126 Bacteria 1219
185 Ga0307415_100474705 3300032126 Bacteria 1087
186 Ga0307415_100483820 3300032126 Unclassified 1078
187 Ga0307415_100578371 3300032126 Bacteria 996
188 Ga0307415_100583620 3300032126 Bacteria 992
189 Ga0307415_100795820 3300032126 Bacteria 862
190 Ga0307415_100811312 3300032126 Bacteria 855
191 Ga0307415_100991466 3300032126 Bacteria 780
192 Ga0307415_101138154 3300032126 Unclassified 732
193 Ga0307415_101411999 3300032126 Unclassified 663
194 Ga0307415_101758709 3300032126 Bacteria 599
195 Ga0307415_101880995 3300032126 Bacteria 581
196 Ga0307415_102013889 3300032126 Bacteria 562
197 Ga0307415_102547163 3300032126 Unclassified 504
198 Ga0395899_0165631 3300037312 Bacteria 1559
199 Ga0395899_0238388 3300037312 Unclassified 1253
200 Ga0395899_0481717 3300037312 Unclassified 808
201 Ga0395899_0491634 3300037312 Bacteria 797
202 Ga0395899_0581547 3300037312 Bacteria 716
203 Ga0395900_0055566 3300037418 Bacteria 4077
204 Ga0395900_0163918 3300037418 Bacteria 2266
205 Ga0395900_0192345 3300037418 Bacteria 2069
206 Ga0395900_0221078 3300037418 Bacteria 1909
207 Ga0395900_0298539 3300037418 Unclassified 1598
208 Ga0395900_0407777 3300037418 Bacteria 1322
209 Ga0395900_0590504 3300037418 Unclassified 1052
210 Ga0395900_0651668 3300037418 Bacteria 990
211 Ga0395900_0910056 3300037418 Bacteria 803
212 Ga0395900_0997833 3300037418 Unclassified 757
213 Ga0395900_1226046 3300037418 Unclassified 665
214 Ga0395900_1403479 3300037418 Unclassified 611
215 Ga0395898_0039606 3300037466 Bacteria 4663
216 Ga0395898_0163423 3300037466 Bacteria 2129
217 Ga0395898_0766572 3300037466 Unclassified 906
218 Ga0395898_0785764 3300037466 Bacteria 893
219 Ga0395898_1375706 3300037466 Bacteria 634
220 Ga0395898_1602255 3300037466 Bacteria 575
221 Ga0395905_0122761 3300037471 Bacteria 2442
222 Ga0395905_0157147 3300037471 Bacteria 2138
223 Ga0395905_0374284 3300037471 Bacteria 1318
224 Ga0395905_0462588 3300037471 Bacteria 1167
225 Ga0395905_1096677 3300037471 Bacteria 699
226 Ga0395901_0014511 3300038443 Bacteria 8012
227 Ga0395901_0016230 3300038443 Bacteria 7586
228 Ga0395901_0098390 3300038443 Bacteria 3067
229 Ga0395901_0187058 3300038443 Unclassified 2172
230 Ga0395901_0257011 3300038443 Bacteria 1819
231 Ga0395901_0257130 3300038443 Bacteria 1818
232 Ga0395901_0296657 3300038443 Unclassified 1676
233 Ga0395901_0727834 3300038443 Bacteria 987
234 Ga0395901_1016881 3300038443 Bacteria 804
235 Ga0395901_1331332 3300038443 Unclassified 679
236 Ga0439448_0001615 3300042005 Bacteria 5909
237 Ga0439448_0107881 3300042005 Bacteria 950
238 Ga0439450_004787 3300042008 Bacteria 2338
239 Ga0439450_048062 3300042008 Bacteria 1007
240 Ga0439450_228878 3300042008 Unclassified 502
241 Ga0439454_016141 3300042011 Bacteria 1053
242 Ga0439454_061238 3300042011 Bacteria 653
243 Ga0439455_0044851 3300042012 Bacteria 1141
244 Ga0439463_001806 3300042016 Bacteria 5570
245 Ga0439463_057328 3300042016 Bacteria 995
246 Ga0450889_017697 3300042144 Unclassified 776
247 Ga0439458_0188676 3300042157 Unclassified 561
248 Ga0439464_0022201 3300042439 Bacteria 1747
249 Ga0439460_0005252 3300042461 Bacteria 3173
250 Ga0439460_0089776 3300042461 Bacteria 975
251 Ga0439460_0249912 3300042461 Bacteria 613
252 Ga0439460_0292168 3300042461 Bacteria 569
253 Ga0450916_000823 3300042530 Bacteria 2908
254 Ga0439440_0003953 3300042993 Bacteria 2889
255 Ga0439440_0098139 3300042993 Bacteria 794
256 Ga0439440_0193984 3300042993 Bacteria 600
257 Ga0495677_0410611 3300047445 Bacteria 536
258 Ga0501031_0003059 3300049568 Bacteria 10697
259 Ga0501032_0451810 3300049569 Bacteria 823
260 Ga0501033_0037439 3300049570 Bacteria 3631
261 Ga0501036_0007233 3300049572 Bacteria 9038
262 Ga0501037_0135862 3300049573 Bacteria 1761
263 Ga0501038_0015212 3300049574 Bacteria 6997
264 Ga0501039_0005113 3300049575 Bacteria 9939
265 Ga0501040_0001390 3300049576 Bacteria 15290
266 Ga0501040_0093897 3300049576 Bacteria 2087
267 Ga0501040_0749991 3300049576 Bacteria 706
268 Ga0501041_0001395 3300049577 Bacteria 13356
269 Ga0501042_0002510 3300049578 Bacteria 11301
270 Ga0501042_0547482 3300049578 Bacteria 841
271 Ga0501043_0161150 3300049579 Bacteria 1752
272 Ga0501046_0002116 3300049580 Bacteria 18792
273 Ga0501046_0236892 3300049580 Bacteria 1347
274 Ga0501047_0219865 3300049581 Bacteria 1756
275 Ga0501048_0002062 3300049582 Bacteria 15288
276 Ga0501068_0267312 3300049584 Bacteria 1091
277 Ga0501069_0023517 3300049585 Bacteria 3361
278 Ga0501071_0103044 3300049587 Bacteria 2105
279 Ga0501071_0174970 3300049587 Bacteria 1607
280 Ga0501072_0004799 3300049588 Bacteria 10298
281 Ga0501072_0385785 3300049588 Unclassified 1112
282 Ga0501073_0941749 3300049589 Unclassified 594
283 Ga0501074_0005686 3300049590 Bacteria 8983
284 Ga0501075_0001640 3300049591 Bacteria 14697
285 Ga0501075_0745907 3300049591 Bacteria 745
286 Ga0501076_0009879 3300049592 Bacteria 7054
287 Ga0501076_0479546 3300049592 Bacteria 1025
288 Ga0501077_0020123 3300049593 Bacteria 4224
289 Ga0501079_0008406 3300049741 Bacteria 7824
290 Ga0501081_0001446 3300049743 Bacteria 14528
291 Ga0501083_0202080 3300049744 Bacteria 1296
292 Ga0501035_0016083 3300049822 Bacteria 6904
293 Ga0501044_0694448 3300049823 Bacteria 903
294 Ga0501044_0950283 3300049823 Bacteria 733
295 Ga0501045_0002601 3300049824 Bacteria 12305
296 nmdc:mga05p37_12846_c1 3300050507 Bacteria 10015
297 nmdc:mga05p37_13614_c1 3300050507 Bacteria 9748
298 nmdc:mga05p37_1441544_c1 3300050507 Unclassified 690
299 nmdc:mga05p37_147964_c1 3300050507 Unclassified 2875
300 nmdc:mga05p37_199941_c2 3300050507 Bacteria 2030
301 nmdc:mga05p37_25757_c1 3300050507 Bacteria 7154
302 nmdc:mga05p37_39526_c1 3300050507 Bacteria 5793
303 nmdc:mga05p37_477268_c1 3300050507 Unclassified 1437
304 nmdc:mga05p37_551434_c1 3300050507 Bacteria 1312
305 nmdc:mga05p37_73928_c1 3300050507 Bacteria 4195
306 nmdc:mga05p37_90363_c1 3300050507 Bacteria 3774
307 nmdc:mga05p37_91193_c1 3300050507 Bacteria 3755
308 nmdc:mga09592_14598_c1 3300050508 Bacteria 6411
309 nmdc:mga09592_182994_c1 3300050508 Bacteria 1813
310 nmdc:mga09592_240693_c1 3300050508 Unclassified 1568
311 nmdc:mga09592_24475_c1 3300050508 Bacteria 4994
312 nmdc:mga09592_755231_c1 3300050508 Unclassified 825
313 nmdc:mga0qj67_620661_c1 3300050509 Unclassified 864
314 nmdc:mga06r32_159629_c1 3300050510 Unclassified 2237
315 nmdc:mga06r32_296609_c1 3300050510 Bacteria 1603
316 nmdc:mga06r32_994057_c1 3300050510 Bacteria 792
317 nmdc:mga06r32_99986_c1 3300050510 Bacteria 2845
318 nmdc:mga08y16_307272_c1 3300050511 Bacteria 1633
319 nmdc:mga08y16_852387_c1 3300050511 Unclassified 900
320 nmdc:mga08y16_87991_c1 3300050511 Bacteria 3236
321 nmdc:mga0a205_10698_c1 3300050515 Bacteria 8435
322 Ga0501084_0002261 3300054114 Bacteria 15472
323 Ga0501082_0002532 3300060353 Bacteria 16010
324 Ga0501082_0208704 3300060353 Bacteria 1699
325 Ga0530510_0002583 3300061734 Bacteria 12445

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_1441544_c1 nmdc:mga05p37_1441544_c1_55_204 49
2 3300049580 Ga0501046_0236892 Ga0501046_0236892_256_408 50
3 3300049587 Ga0501071_0103044 Ga0501071_0103044_1710_1862 50
4 3300049591 Ga0501075_0745907 Ga0501075_0745907_576_728 50
5 3300049592 Ga0501076_0479546 Ga0501076_0479546_537_689 50
6 3300037418 Ga0395900_0651668 Ga0395900_0651668_459_620 52
7 3300037471 Ga0395905_0462588 Ga0395905_0462588_207_368 52
8 3300042993 Ga0439440_0193984 Ga0439440_0193984_35_196 53
9 3300032126 Ga0307415_100811312 Ga0307415_1008113122 55
10 3300005981 Ga0081538_10039890 Ga0081538_100398906 56
11 3300009094 Ga0111539_10718341 Ga0111539_107183413 56
12 3300009147 Ga0114129_10265393 Ga0114129_102653934 56
13 3300009147 Ga0114129_11090453 Ga0114129_110904531 56
14 3300009147 Ga0114129_13414787 Ga0114129_134147872 56
15 3300031731 Ga0307405_10018373 Ga0307405_100183735 56
16 3300031731 Ga0307405_10324499 Ga0307405_103244993 56
17 3300031824 Ga0307413_10296643 Ga0307413_102966432 56
18 3300031852 Ga0307410_10696388 Ga0307410_106963881 56
19 3300031901 Ga0307406_10303219 Ga0307406_103032193 56
20 3300031903 Ga0307407_10680269 Ga0307407_106802691 56
21 3300031903 Ga0307407_11663804 Ga0307407_116638042 56
22 3300031911 Ga0307412_10572927 Ga0307412_105729271 56
23 3300031911 Ga0307412_10897029 Ga0307412_108970292 56
24 3300031995 Ga0307409_100076850 Ga0307409_1000768502 56
25 3300031995 Ga0307409_100122963 Ga0307409_1001229632 56
26 3300031995 Ga0307409_102213166 Ga0307409_1022131662 56
27 3300032002 Ga0307416_100305740 Ga0307416_1003057405 56
28 3300032002 Ga0307416_100626132 Ga0307416_1006261321 56
29 3300032002 Ga0307416_103017121 Ga0307416_1030171212 56
30 3300032004 Ga0307414_10429066 Ga0307414_104290661 56
31 3300032004 Ga0307414_10786970 Ga0307414_107869703 56
32 3300032005 Ga0307411_10171418 Ga0307411_101714183 56
33 3300032126 Ga0307415_100025598 Ga0307415_1000255984 56
34 3300032126 Ga0307415_100143531 Ga0307415_1001435314 56
35 3300032126 Ga0307415_100318061 Ga0307415_1003180611 56
36 3300032126 Ga0307415_100342768 Ga0307415_1003427681 56
37 3300032126 Ga0307415_100353433 Ga0307415_1003534332 56
38 3300032126 Ga0307415_100365995 Ga0307415_1003659952 56
39 3300032126 Ga0307415_100483820 Ga0307415_1004838202 56
40 3300032126 Ga0307415_101138154 Ga0307415_1011381542 56
41 3300032126 Ga0307415_101758709 Ga0307415_1017587092 56
42 3300037312 Ga0395899_0481717 Ga0395899_0481717_62_235 56
43 3300037312 Ga0395899_0491634 Ga0395899_0491634_358_531 56
44 3300037418 Ga0395900_0163918 Ga0395900_0163918_962_1135 56
45 3300037418 Ga0395900_0192345 Ga0395900_0192345_730_900 56
46 3300037418 Ga0395900_0407777 Ga0395900_0407777_1033_1206 56
47 3300037418 Ga0395900_0590504 Ga0395900_0590504_13_186 56
48 3300037418 Ga0395900_0910056 Ga0395900_0910056_573_743 56
49 3300037418 Ga0395900_1403479 Ga0395900_1403479_168_341 56
50 3300037466 Ga0395898_0039606 Ga0395898_0039606_3374_3547 56
51 3300037466 Ga0395898_0163423 Ga0395898_0163423_325_498 56
52 3300037471 Ga0395905_0122761 Ga0395905_0122761_999_1172 56
53 3300038443 Ga0395901_0016230 Ga0395901_0016230_5983_6156 56
54 3300038443 Ga0395901_0098390 Ga0395901_0098390_2207_2377 56
55 3300038443 Ga0395901_0257130 Ga0395901_0257130_442_615 56
56 3300038443 Ga0395901_0296657 Ga0395901_0296657_1235_1408 56
57 3300038443 Ga0395901_0727834 Ga0395901_0727834_746_919 56
58 3300042011 Ga0439454_016141 Ga0439454_016141_610_780 56
59 3300042461 Ga0439460_0089776 Ga0439460_0089776_455_625 56
60 3300049568 Ga0501031_0003059 Ga0501031_0003059_6961_7131 56
61 3300049569 Ga0501032_0451810 Ga0501032_0451810_72_242 56
62 3300049570 Ga0501033_0037439 Ga0501033_0037439_2323_2493 56
63 3300049572 Ga0501036_0007233 Ga0501036_0007233_6006_6176 56
64 3300049573 Ga0501037_0135862 Ga0501037_0135862_768_938 56
65 3300049574 Ga0501038_0015212 Ga0501038_0015212_4321_4491 56
66 3300049575 Ga0501039_0005113 Ga0501039_0005113_7296_7466 56
67 3300049576 Ga0501040_0001390 Ga0501040_0001390_6056_6226 56
68 3300049577 Ga0501041_0001395 Ga0501041_0001395_5110_5280 56
69 3300049578 Ga0501042_0002510 Ga0501042_0002510_6066_6236 56
70 3300049579 Ga0501043_0161150 Ga0501043_0161150_1331_1501 56
71 3300049580 Ga0501046_0002116 Ga0501046_0002116_8811_8981 56
72 3300049581 Ga0501047_0219865 Ga0501047_0219865_1466_1636 56
73 3300049582 Ga0501048_0002062 Ga0501048_0002062_9842_10012 56
74 3300049584 Ga0501068_0267312 Ga0501068_0267312_329_499 56
75 3300049585 Ga0501069_0023517 Ga0501069_0023517_1835_2005 56
76 3300049587 Ga0501071_0174970 Ga0501071_0174970_63_233 56
77 3300049588 Ga0501072_0004799 Ga0501072_0004799_1994_2164 56
78 3300049589 Ga0501073_0941749 Ga0501073_0941749_129_299 56
79 3300049590 Ga0501074_0005686 Ga0501074_0005686_1439_1609 56
80 3300049591 Ga0501075_0001640 Ga0501075_0001640_7830_8000 56
81 3300049592 Ga0501076_0009879 Ga0501076_0009879_819_989 56
82 3300049593 Ga0501077_0020123 Ga0501077_0020123_2580_2750 56
83 3300049741 Ga0501079_0008406 Ga0501079_0008406_6430_6600 56
84 3300049743 Ga0501081_0001446 Ga0501081_0001446_5188_5358 56
85 3300049744 Ga0501083_0202080 Ga0501083_0202080_852_1022 56
86 3300049822 Ga0501035_0016083 Ga0501035_0016083_741_911 56
87 3300049823 Ga0501044_0694448 Ga0501044_0694448_224_394 56
88 3300049824 Ga0501045_0002601 Ga0501045_0002601_6040_6210 56
89 3300050507 nmdc:mga05p37_199941_c2 nmdc:mga05p37_199941_c2_800_970 56
90 3300050511 nmdc:mga08y16_852387_c1 nmdc:mga08y16_852387_c1_653_823 56
91 3300054114 Ga0501084_0002261 Ga0501084_0002261_2519_2689 56
92 3300060353 Ga0501082_0002532 Ga0501082_0002532_6066_6236 56
93 3300061734 Ga0530510_0002583 Ga0530510_0002583_2590_2760 56
94 3300005981 Ga0081538_10013484 Ga0081538_100134845 57
95 3300005981 Ga0081538_10017663 Ga0081538_100176634 57
96 3300005981 Ga0081538_10052220 Ga0081538_100522204 57
97 3300005981 Ga0081538_10112935 Ga0081538_101129353 57
98 3300005981 Ga0081538_10172723 Ga0081538_101727233 57
99 3300005985 Ga0081539_10001512 Ga0081539_1000151213 57
100 3300006844 Ga0075428_100011693 Ga0075428_1000116936 57
101 3300006844 Ga0075428_100915566 Ga0075428_1009155661 57
102 3300006844 Ga0075428_101328700 Ga0075428_1013287002 57
103 3300006846 Ga0075430_100296240 Ga0075430_1002962402 57
104 3300006846 Ga0075430_100315359 Ga0075430_1003153593 57
105 3300006847 Ga0075431_100113976 Ga0075431_1001139761 57
106 3300006880 Ga0075429_100010819 Ga0075429_1000108199 57
107 3300006880 Ga0075429_100223372 Ga0075429_1002233722 57
108 3300009094 Ga0111539_10310215 Ga0111539_103102154 57
109 3300009147 Ga0114129_10017333 Ga0114129_100173336 57
110 3300009147 Ga0114129_10062172 Ga0114129_100621723 57
111 3300009147 Ga0114129_10336176 Ga0114129_103361763 57
112 3300009147 Ga0114129_12944313 Ga0114129_129443132 57
113 3300009553 Ga0105249_10447657 Ga0105249_104476574 57
114 3300013307 Ga0157372_12841471 Ga0157372_128414711 57
115 3300014497 Ga0182008_10391135 Ga0182008_103911352 57
116 3300025961 Ga0207712_10911486 Ga0207712_109114862 57
117 3300031548 Ga0307408_100201051 Ga0307408_1002010513 57
118 3300031731 Ga0307405_10039419 Ga0307405_100394194 57
119 3300031731 Ga0307405_10072262 Ga0307405_100722623 57
120 3300031731 Ga0307405_10102882 Ga0307405_101028821 57
121 3300031731 Ga0307405_10344322 Ga0307405_103443222 57
122 3300031824 Ga0307413_10037744 Ga0307413_100377442 57
123 3300031824 Ga0307413_10265130 Ga0307413_102651303 57
124 3300031824 Ga0307413_10657221 Ga0307413_106572212 57
125 3300031824 Ga0307413_11283882 Ga0307413_112838822 57
126 3300031852 Ga0307410_10191860 Ga0307410_101918603 57
127 3300031852 Ga0307410_10330853 Ga0307410_103308534 57
128 3300031852 Ga0307410_10527536 Ga0307410_105275362 57
129 3300031852 Ga0307410_11156680 Ga0307410_111566801 57
130 3300031852 Ga0307410_11997616 Ga0307410_119976162 57
131 3300031901 Ga0307406_10003416 Ga0307406_1000341612 57
132 3300031901 Ga0307406_10056643 Ga0307406_100566434 57
133 3300031901 Ga0307406_10120990 Ga0307406_101209903 57
134 3300031901 Ga0307406_10363880 Ga0307406_103638803 57
135 3300031901 Ga0307406_10639304 Ga0307406_106393042 57
136 3300031901 Ga0307406_10641893 Ga0307406_106418933 57
137 3300031901 Ga0307406_11450178 Ga0307406_114501781 57
138 3300031903 Ga0307407_10005148 Ga0307407_100051484 57
139 3300031903 Ga0307407_10552557 Ga0307407_105525572 57
140 3300031903 Ga0307407_10651332 Ga0307407_106513322 57
141 3300031903 Ga0307407_10923549 Ga0307407_109235492 57
142 3300031911 Ga0307412_10024434 Ga0307412_100244344 57
143 3300031911 Ga0307412_10408113 Ga0307412_104081133 57
144 3300031911 Ga0307412_10693833 Ga0307412_106938332 57
145 3300031995 Ga0307409_100000747 Ga0307409_1000007477 57
146 3300031995 Ga0307409_100005460 Ga0307409_1000054606 57
147 3300031995 Ga0307409_100007667 Ga0307409_1000076671 57
148 3300031995 Ga0307409_100272274 Ga0307409_1002722743 57
149 3300031995 Ga0307409_100343059 Ga0307409_1003430592 57
150 3300031995 Ga0307409_100390297 Ga0307409_1003902972 57
151 3300031995 Ga0307409_100468944 Ga0307409_1004689442 57
152 3300031995 Ga0307409_100527162 Ga0307409_1005271622 57
153 3300031995 Ga0307409_100903159 Ga0307409_1009031592 57
154 3300031995 Ga0307409_100911239 Ga0307409_1009112392 57
155 3300031995 Ga0307409_101019054 Ga0307409_1010190543 57
156 3300031995 Ga0307409_101754936 Ga0307409_1017549362 57
157 3300031995 Ga0307409_102562441 Ga0307409_1025624412 57
158 3300032002 Ga0307416_100000939 Ga0307416_10000093917 57
159 3300032002 Ga0307416_100014370 Ga0307416_1000143703 57
160 3300032002 Ga0307416_100016504 Ga0307416_1000165046 57
161 3300032002 Ga0307416_100042291 Ga0307416_1000422916 57
162 3300032002 Ga0307416_100083739 Ga0307416_1000837392 57
163 3300032002 Ga0307416_100261284 Ga0307416_1002612844 57
164 3300032002 Ga0307416_100486089 Ga0307416_1004860892 57
165 3300032002 Ga0307416_100820858 Ga0307416_1008208583 57
166 3300032002 Ga0307416_100897831 Ga0307416_1008978312 57
167 3300032002 Ga0307416_101797937 Ga0307416_1017979371 57
168 3300032004 Ga0307414_10262533 Ga0307414_102625333 57
169 3300032004 Ga0307414_10263765 Ga0307414_102637652 57
170 3300032004 Ga0307414_11285959 Ga0307414_112859591 57
171 3300032005 Ga0307411_10347301 Ga0307411_103473013 57
172 3300032005 Ga0307411_11234145 Ga0307411_112341452 57
173 3300032005 Ga0307411_12187273 Ga0307411_121872731 57
174 3300032126 Ga0307415_100001020 Ga0307415_10000102012 57
175 3300032126 Ga0307415_100002750 Ga0307415_1000027502 57
176 3300032126 Ga0307415_100005004 Ga0307415_1000050044 57
177 3300032126 Ga0307415_100009013 Ga0307415_1000090135 57
178 3300032126 Ga0307415_100009172 Ga0307415_1000091727 57
179 3300032126 Ga0307415_100041642 Ga0307415_1000416427 57
180 3300032126 Ga0307415_100086526 Ga0307415_1000865263 57
181 3300032126 Ga0307415_100106568 Ga0307415_1001065684 57
182 3300032126 Ga0307415_100223297 Ga0307415_1002232973 57
183 3300032126 Ga0307415_100352965 Ga0307415_1003529653 57
184 3300032126 Ga0307415_100474705 Ga0307415_1004747053 57
185 3300032126 Ga0307415_100583620 Ga0307415_1005836202 57
186 3300032126 Ga0307415_101411999 Ga0307415_1014119992 57
187 3300032126 Ga0307415_101880995 Ga0307415_1018809952 57
188 3300037312 Ga0395899_0165631 Ga0395899_0165631_79_255 57
189 3300037312 Ga0395899_0238388 Ga0395899_0238388_732_908 57
190 3300037312 Ga0395899_0581547 Ga0395899_0581547_72_269 57
191 3300037418 Ga0395900_0055566 Ga0395900_0055566_2068_2244 57
192 3300037418 Ga0395900_0298539 Ga0395900_0298539_874_1050 57
193 3300037418 Ga0395900_0997833 Ga0395900_0997833_286_459 57
194 3300037418 Ga0395900_1226046 Ga0395900_1226046_244_420 57
195 3300037466 Ga0395898_0766572 Ga0395898_0766572_655_831 57
196 3300037466 Ga0395898_0785764 Ga0395898_0785764_638_811 57
197 3300037466 Ga0395898_1375706 Ga0395898_1375706_323_520 57
198 3300037466 Ga0395898_1602255 Ga0395898_1602255_343_519 57
199 3300037471 Ga0395905_0157147 Ga0395905_0157147_1226_1402 57
200 3300037471 Ga0395905_0374284 Ga0395905_0374284_1007_1180 57
201 3300037471 Ga0395905_1096677 Ga0395905_1096677_344_520 57
202 3300038443 Ga0395901_0014511 Ga0395901_0014511_3758_3934 57
203 3300038443 Ga0395901_0187058 Ga0395901_0187058_1219_1395 57
204 3300038443 Ga0395901_0257011 Ga0395901_0257011_321_494 57
205 3300038443 Ga0395901_1331332 Ga0395901_1331332_426_599 57
206 3300042008 Ga0439450_228878 Ga0439450_228878_309_482 57
207 3300042993 Ga0439440_0098139 Ga0439440_0098139_585_758 57
208 3300049576 Ga0501040_0749991 Ga0501040_0749991_117_293 57
209 3300049823 Ga0501044_0950283 Ga0501044_0950283_511_684 57
210 3300050507 nmdc:mga05p37_12846_c1 nmdc:mga05p37_12846_c1_4194_4367 57
211 3300050507 nmdc:mga05p37_39526_c1 nmdc:mga05p37_39526_c1_2932_3105 57
212 3300050507 nmdc:mga05p37_477268_c1 nmdc:mga05p37_477268_c1_1093_1266 57
213 3300050507 nmdc:mga05p37_90363_c1 nmdc:mga05p37_90363_c1_888_1061 57
214 3300050507 nmdc:mga05p37_91193_c1 nmdc:mga05p37_91193_c1_2480_2653 57
215 3300050508 nmdc:mga09592_182994_c1 nmdc:mga09592_182994_c1_1059_1232 57
216 3300050508 nmdc:mga09592_240693_c1 nmdc:mga09592_240693_c1_1105_1278 57
217 3300050510 nmdc:mga06r32_99986_c1 nmdc:mga06r32_99986_c1_2642_2815 57
218 3300050511 nmdc:mga08y16_87991_c1 nmdc:mga08y16_87991_c1_367_540 57
219 3300005981 Ga0081538_10363007 Ga0081538_103630071 58
220 3300009094 Ga0111539_10992362 Ga0111539_109923621 58
221 3300009147 Ga0114129_10319938 Ga0114129_103199384 58
222 3300031731 Ga0307405_10048890 Ga0307405_100488904 58
223 3300031852 Ga0307410_10786136 Ga0307410_107861361 58
224 3300032002 Ga0307416_100106019 Ga0307416_1001060194 58
225 3300032002 Ga0307416_102108647 Ga0307416_1021086472 58
226 3300032004 Ga0307414_11969282 Ga0307414_119692822 58
227 3300032126 Ga0307415_100795820 Ga0307415_1007958201 58
228 3300050507 nmdc:mga05p37_25757_c1 nmdc:mga05p37_25757_c1_4267_4443 58
229 3300050508 nmdc:mga09592_755231_c1 nmdc:mga09592_755231_c1_478_654 58
230 3300050515 nmdc:mga0a205_10698_c1 nmdc:mga0a205_10698_c1_1934_2110 58
231 3300005981 Ga0081538_10227141 Ga0081538_102271411 59
232 3300006847 Ga0075431_100168552 Ga0075431_1001685524 59
233 3300006880 Ga0075429_100017242 Ga0075429_1000172429 59
234 3300009094 Ga0111539_11731198 Ga0111539_117311981 59
235 3300009147 Ga0114129_10016362 Ga0114129_1001636211 59
236 3300031731 Ga0307405_10160784 Ga0307405_101607843 59
237 3300031731 Ga0307405_10235299 Ga0307405_102352992 59
238 3300031852 Ga0307410_10378529 Ga0307410_103785292 59
239 3300031901 Ga0307406_10685042 Ga0307406_106850422 59
240 3300031995 Ga0307409_100111126 Ga0307409_1001111265 59
241 3300031995 Ga0307409_100141156 Ga0307409_1001411563 59
242 3300032002 Ga0307416_100214277 Ga0307416_1002142772 59
243 3300032002 Ga0307416_100280511 Ga0307416_1002805112 59
244 3300032002 Ga0307416_101665930 Ga0307416_1016659301 59
245 3300032002 Ga0307416_102456633 Ga0307416_1024566332 59
246 3300032002 Ga0307416_103896352 Ga0307416_1038963521 59
247 3300032004 Ga0307414_10793838 Ga0307414_107938382 59
248 3300032004 Ga0307414_10999244 Ga0307414_109992442 59
249 3300032005 Ga0307411_10653206 Ga0307411_106532061 59
250 3300032005 Ga0307411_10960991 Ga0307411_109609911 59
251 3300032126 Ga0307415_100045239 Ga0307415_1000452396 59
252 3300032126 Ga0307415_100305126 Ga0307415_1003051261 59
253 3300032126 Ga0307415_100578371 Ga0307415_1005783711 59
254 3300032126 Ga0307415_100991466 Ga0307415_1009914662 59
255 3300042005 Ga0439448_0107881 Ga0439448_0107881_544_723 59
256 3300042157 Ga0439458_0188676 Ga0439458_0188676_314_493 59
257 3300050507 nmdc:mga05p37_13614_c1 nmdc:mga05p37_13614_c1_6091_6270 59
258 3300050507 nmdc:mga05p37_551434_c1 nmdc:mga05p37_551434_c1_742_921 59
259 3300050508 nmdc:mga09592_24475_c1 nmdc:mga09592_24475_c1_1205_1384 59
260 3300050510 nmdc:mga06r32_296609_c1 nmdc:mga06r32_296609_c1_77_256 59
261 3300050510 nmdc:mga06r32_994057_c1 nmdc:mga06r32_994057_c1_282_461 59
262 3300050511 nmdc:mga08y16_307272_c1 nmdc:mga08y16_307272_c1_129_308 59
263 3300005981 Ga0081538_10008820 Ga0081538_1000882014 60
264 3300005985 Ga0081539_10499546 Ga0081539_104995461 60
265 3300006844 Ga0075428_100022229 Ga0075428_1000222293 60
266 3300006846 Ga0075430_100431468 Ga0075430_1004314681 60
267 3300006847 Ga0075431_100467944 Ga0075431_1004679442 60
268 3300006847 Ga0075431_100542112 Ga0075431_1005421121 60
269 3300006852 Ga0075433_10658244 Ga0075433_106582442 60
270 3300006880 Ga0075429_100029027 Ga0075429_1000290279 60
271 3300009147 Ga0114129_10044773 Ga0114129_100447735 60
272 3300009147 Ga0114129_10168248 Ga0114129_101682485 60
273 3300031731 Ga0307405_10198808 Ga0307405_101988082 60
274 3300031731 Ga0307405_10300091 Ga0307405_103000912 60
275 3300031731 Ga0307405_11509033 Ga0307405_115090331 60
276 3300031824 Ga0307413_11194673 Ga0307413_111946731 60
277 3300031824 Ga0307413_11570238 Ga0307413_115702381 60
278 3300031852 Ga0307410_10065311 Ga0307410_100653112 60
279 3300031901 Ga0307406_10283274 Ga0307406_102832743 60
280 3300031901 Ga0307406_10712651 Ga0307406_107126512 60
281 3300031901 Ga0307406_11401285 Ga0307406_114012851 60
282 3300031901 Ga0307406_11679118 Ga0307406_116791182 60
283 3300031911 Ga0307412_10142017 Ga0307412_101420174 60
284 3300031911 Ga0307412_10688759 Ga0307412_106887592 60
285 3300031995 Ga0307409_100042889 Ga0307409_1000428893 60
286 3300031995 Ga0307409_100053108 Ga0307409_1000531084 60
287 3300031995 Ga0307409_100112887 Ga0307409_1001128874 60
288 3300031995 Ga0307409_100220745 Ga0307409_1002207454 60
289 3300031995 Ga0307409_100946655 Ga0307409_1009466552 60
290 3300031995 Ga0307409_101269959 Ga0307409_1012699592 60
291 3300032002 Ga0307416_100014058 Ga0307416_1000140586 60
292 3300032002 Ga0307416_100030539 Ga0307416_10003053910 60
293 3300032004 Ga0307414_11188796 Ga0307414_111887962 60
294 3300032005 Ga0307411_12263242 Ga0307411_122632422 60
295 3300032126 Ga0307415_100003244 Ga0307415_1000032446 60
296 3300032126 Ga0307415_100026109 Ga0307415_1000261098 60
297 3300032126 Ga0307415_100181063 Ga0307415_1001810632 60
298 3300032126 Ga0307415_102013889 Ga0307415_1020138892 60
299 3300032126 Ga0307415_102547163 Ga0307415_1025471632 60
300 3300037418 Ga0395900_0221078 Ga0395900_0221078_1201_1383 60
301 3300038443 Ga0395901_1016881 Ga0395901_1016881_316_498 60
302 3300042005 Ga0439448_0001615 Ga0439448_0001615_3717_3899 60
303 3300042008 Ga0439450_004787 Ga0439450_004787_1078_1260 60
304 3300042008 Ga0439450_048062 Ga0439450_048062_584_766 60
305 3300042011 Ga0439454_061238 Ga0439454_061238_441_623 60
306 3300042012 Ga0439455_0044851 Ga0439455_0044851_100_282 60
307 3300042016 Ga0439463_001806 Ga0439463_001806_1594_1776 60
308 3300042016 Ga0439463_057328 Ga0439463_057328_134_316 60
309 3300042144 Ga0450889_017697 Ga0450889_017697_385_567 60
310 3300042439 Ga0439464_0022201 Ga0439464_0022201_733_915 60
311 3300042461 Ga0439460_0005252 Ga0439460_0005252_2217_2399 60
312 3300042461 Ga0439460_0249912 Ga0439460_0249912_178_360 60
313 3300042461 Ga0439460_0292168 Ga0439460_0292168_122_304 60
314 3300042530 Ga0450916_000823 Ga0450916_000823_1943_2125 60
315 3300042993 Ga0439440_0003953 Ga0439440_0003953_2493_2675 60
316 3300047445 Ga0495677_0410611 Ga0495677_0410611_66_248 60
317 3300049576 Ga0501040_0093897 Ga0501040_0093897_184_366 60
318 3300049578 Ga0501042_0547482 Ga0501042_0547482_486_668 60
319 3300049588 Ga0501072_0385785 Ga0501072_0385785_880_1062 60
320 3300050507 nmdc:mga05p37_147964_c1 nmdc:mga05p37_147964_c1_1721_1903 60
321 3300050507 nmdc:mga05p37_73928_c1 nmdc:mga05p37_73928_c1_197_379 60
322 3300050508 nmdc:mga09592_14598_c1 nmdc:mga09592_14598_c1_3126_3308 60
323 3300050509 nmdc:mga0qj67_620661_c1 nmdc:mga0qj67_620661_c1_59_241 60
324 3300050510 nmdc:mga06r32_159629_c1 nmdc:mga06r32_159629_c1_208_390 60
325 3300060353 Ga0501082_0208704 Ga0501082_0208704_1384_1566 60

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rfh-assembly1.cif.gz_A crystal structure of the yeast rack1 dimer in space group p21 0.8513 5 32
4zb4-assembly2.cif.gz_B spliceosome component 0.8511 5 31
3rfh-assembly2.cif.gz_B crystal structure of the yeast rack1 dimer in space group p21 0.8487 5 32
4zb4-assembly1.cif.gz_A spliceosome component 0.8288 5 31
8t55-assembly3.cif.gz_C co-crystal structure of the wd-repeat domain of human wdr91 in complex with mr46654 0.8286 3 29
ID Description Score Start End Superfamily
af_Q54FW9_1_133_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8616 6 29 2.130.10.10
af_Q2QYQ7_94_312_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8448 4 27 2.130.10.10
af_Q04177_28_294_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8425 5 31 2.130.10.10
af_A0A2R8QD67_756_881_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8416 5 31 2.130.10.10
af_Q4DEV1_328_446_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8391 5 29 2.130.10.10
ID Description Score Start End GO Terms
AF-X6LMH7-F1-model_v4 Uncharacterized protein 0.849 4 29
AF-A0A816SAE2-F1-model_v4 Uncharacterized protein 0.827 4 42
AF-A0A5E6R751-F1-model_v4 Uncharacterized protein 0.8248 5 41
AF-A0A5N5NRQ7-F1-model_v4 Uncharacterized protein 0.8226 5 33
AF-A0A287QSG3-F1-model_v4 deleted 0.8225 5 29

Feature Viewer

pLDDT pTM Quality
76.67 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map