F407876

General Info

Members Datasets Scaffolds Average Seq Length
325 170 650 158

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_10311435|Ga0207658_103114352
Length 175
Sequence MEVGSPYLPIHKDQTMKRASTIFLQIVIAVIGVGVLTFLLWEPQLEGRNVNATQFEIYFKDPFLAYIYLAFVPFFVGLYQAFRMLGYARRDEVFSPPAVRALRVIKYCACLLAIFIVGAEVYIFIFVRGTDDVAGGVMMGVFIIFVSAVIGTAAAVFERILQKAVDIKSENDLTV

Samples

Sample ID Description Type Environment
1 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
146 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
154 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
155 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
156 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
157 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
158 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
159 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
160 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
161 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 0.62
Rhizosphere 97.23
Stem 0
Stem Tuber 0
Unclassified 24.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207658_10311435 3300025986 Bacteria 1360
2 LJNas_1008447 3300000546 Bacteria 1106
3 Ga0065704_10099697 3300005289 Bacteria 2301
4 Ga0065704_10109676 3300005289 Bacteria 1998
5 Ga0065704_10355847 3300005289 Bacteria 804
6 Ga0065712_10379922 3300005290 Unclassified 753
7 Ga0065715_10147175 3300005293 Bacteria 1774
8 Ga0065715_10266329 3300005293 Bacteria 1123
9 Ga0065707_10014083 3300005295 Bacteria 2115
10 Ga0065707_10348144 3300005295 Unclassified 922
11 Ga0070676_10170564 3300005328 Bacteria 1407
12 Ga0070690_100007168 3300005330 Bacteria 6377
13 Ga0070690_100155803 3300005330 Bacteria 1562
14 Ga0070690_100392192 3300005330 Bacteria 1017
15 Ga0070690_100823756 3300005330 Unclassified 721
16 Ga0070670_100033272 3300005331 Plasmid 4440
17 Ga0070670_100051550 3300005331 Bacteria 3534
18 Ga0070670_100135395 3300005331 Bacteria 2129
19 Ga0070670_101233078 3300005331 Bacteria 684
20 Ga0070677_10193722 3300005333 Bacteria 976
21 Ga0068869_100018204 3300005334 Bacteria 4778
22 Ga0068869_100026607 3300005334 Bacteria 4028
23 Ga0068869_100178139 3300005334 Bacteria 1665
24 Ga0070666_10745546 3300005335 Bacteria 720
25 Ga0070666_10772177 3300005335 Unclassified 707
26 Ga0070680_100066877 3300005336 Bacteria 2947
27 Ga0070682_101373300 3300005337 Unclassified 603
28 Ga0070689_100004295 3300005340 Bacteria 9615
29 Ga0070689_100079095 3300005340 Bacteria 2578
30 Ga0070689_100355597 3300005340 Bacteria 1229
31 Ga0070689_100431850 3300005340 Bacteria 1118
32 Ga0070687_100151422 3300005343 Bacteria 1362
33 Ga0070687_100843101 3300005343 Bacteria 653
34 Ga0070661_100309999 3300005344 Unclassified 1230
35 Ga0070668_100072580 3300005347 Bacteria 2682
36 Ga0070675_100073655 3300005354 Bacteria 2836
37 Ga0070675_100579066 3300005354 Bacteria 1017
38 Ga0070675_101107921 3300005354 Unclassified 728
39 Ga0070675_101280762 3300005354 Unclassified 675
40 Ga0070671_100141336 3300005355 Bacteria 2031
41 Ga0070671_100312422 3300005355 Bacteria 1339
42 Ga0070688_100157786 3300005365 Bacteria 1556
43 Ga0070688_100286357 3300005365 Bacteria 1186
44 Ga0070659_100697893 3300005366 Unclassified 877
45 Ga0070700_100077784 3300005441 Bacteria 2134
46 Ga0070694_100397205 3300005444 Bacteria 1079
47 Ga0070678_100179495 3300005456 Bacteria 1732
48 Ga0070678_100347176 3300005456 Bacteria 1275
49 Ga0070662_100491310 3300005457 Bacteria 1023
50 Ga0070681_10012179 3300005458 Bacteria 8529
51 Ga0068867_100270363 3300005459 Bacteria 1389
52 Ga0068867_100458715 3300005459 Bacteria 1088
53 Ga0068867_101308948 3300005459 Unclassified 669
54 Ga0070685_10062121 3300005466 Bacteria 2190
55 Ga0070685_10188814 3300005466 Bacteria 1331
56 Ga0070707_100001213 3300005468 Bacteria 25377
57 Ga0070707_101293490 3300005468 Unclassified 695
58 Ga0070698_100003096 3300005471 Bacteria 18338
59 Ga0070698_100031211 3300005471 Bacteria 5524
60 Ga0070698_100077312 3300005471 Unclassified 3328
61 Ga0070699_100169451 3300005518 Bacteria 1934
62 Ga0070699_100523242 3300005518 Bacteria 1078
63 Ga0070679_100172491 3300005530 Bacteria 2136
64 Ga0070679_100410884 3300005530 Bacteria 1299
65 Ga0070697_100000170 3300005536 Bacteria 52782
66 Ga0068853_100006875 3300005539 Bacteria 9076
67 Ga0068853_100291111 3300005539 Unclassified 1507
68 Ga0070672_100197404 3300005543 Bacteria 1682
69 Ga0070686_100000980 3300005544 Bacteria 16454
70 Ga0070686_100012088 3300005544 Bacteria 4911
71 Ga0070686_100227373 3300005544 Bacteria 1351
72 Ga0070686_100334751 3300005544 Bacteria 1133
73 Ga0070695_100638589 3300005545 Unclassified 839
74 Ga0070695_101299875 3300005545 Unclassified 601
75 Ga0070704_100065117 3300005549 Bacteria 2622
76 Ga0070704_101307683 3300005549 Unclassified 663
77 Ga0068855_100174520 3300005563 Bacteria 2433
78 Ga0068855_100414887 3300005563 Bacteria 1473
79 Ga0070664_100028135 3300005564 Bacteria 4675
80 Ga0070664_100444282 3300005564 Unclassified 1190
81 Ga0070664_100770070 3300005564 Bacteria 899
82 Ga0068857_100546559 3300005577 Unclassified 1091
83 Ga0068857_101030082 3300005577 Unclassified 793
84 Ga0068857_101434966 3300005577 Bacteria 672
85 Ga0068854_100166435 3300005578 Unclassified 1712
86 Ga0068854_100812998 3300005578 Unclassified 815
87 Ga0068856_100476367 3300005614 Unclassified 1269
88 Ga0068859_100094224 3300005617 Bacteria 3046
89 Ga0068859_100165347 3300005617 Bacteria 2292
90 Ga0068859_100564975 3300005617 Bacteria 1232
91 Ga0068859_102516596 3300005617 Bacteria 567
92 Ga0068864_100126324 3300005618 Bacteria 2292
93 Ga0068864_100275466 3300005618 Bacteria 1569
94 Ga0068864_100499037 3300005618 Bacteria 1170
95 Ga0068864_101299279 3300005618 Bacteria 728
96 Ga0068861_101917731 3300005719 Unclassified 590
97 Ga0068870_10235499 3300005840 Unclassified 1128
98 Ga0068863_100138357 3300005841 Bacteria 2327
99 Ga0068863_100714486 3300005841 Unclassified 996
100 Ga0068863_100955665 3300005841 Unclassified 858
101 Ga0068858_100103508 3300005842 Bacteria 2656
102 Ga0068858_100860046 3300005842 Bacteria 886
103 Ga0068860_100053906 3300005843 Bacteria 3822
104 Ga0068860_100364800 3300005843 Bacteria 1424
105 Ga0068860_100510769 3300005843 Bacteria 1201
106 Ga0068862_100026444 3300005844 Bacteria 4877
107 Ga0068862_100112094 3300005844 Bacteria 2395
108 Ga0070716_100000002 3300006173 Bacteria 396037
109 Ga0097621_100058647 3300006237 Bacteria 3149
110 Ga0097621_100084537 3300006237 Bacteria 2646
111 Ga0097621_100087452 3300006237 Bacteria 2602
112 Ga0097621_100326774 3300006237 Bacteria 1359
113 Ga0068871_100107897 3300006358 Bacteria 2339
114 Ga0075429_100422393 3300006880 Bacteria 1168
115 Ga0068865_100401498 3300006881 Bacteria 1123
116 Ga0068865_100643357 3300006881 Unclassified 900
117 Ga0097620_100094227 3300006931 Bacteria 3046
118 Ga0097620_100165345 3300006931 Bacteria 2292
119 Ga0097620_100564993 3300006931 Bacteria 1232
120 Ga0097620_102516611 3300006931 Bacteria 567
121 Ga0105244_10132454 3300009036 Bacteria 1203
122 Ga0105240_10724340 3300009093 Unclassified 1084
123 Ga0105245_10345549 3300009098 Bacteria 1472
124 Ga0105247_10017863 3300009101 Bacteria 4255
125 Ga0105247_10709856 3300009101 Bacteria 758
126 Ga0105243_10048603 3300009148 Bacteria 3345
127 Ga0105243_11231237 3300009148 Bacteria 763
128 Ga0105241_10295680 3300009174 Bacteria 1388
129 Ga0105241_11052090 3300009174 Bacteria 764
130 Ga0105242_10218937 3300009176 Bacteria 1700
131 Ga0105248_10057750 3300009177 Bacteria 4356
132 Ga0105248_10505678 3300009177 Bacteria 1362
133 Ga0105248_12064995 3300009177 Bacteria 648
134 Ga0105237_10098772 3300009545 Unclassified 2910
135 Ga0105237_10435385 3300009545 Bacteria 1317
136 Ga0105249_10070902 3300009553 Bacteria 3218
137 Ga0105249_10149990 3300009553 Bacteria 2244
138 Ga0105249_10301930 3300009553 Bacteria 1606
139 Ga0105249_11364452 3300009553 Bacteria 781
140 Ga0099796_10237352 3300010159 Bacteria 752
141 Ga0105239_10031757 3300010375 Bacteria 5803
142 Ga0105239_10652915 3300010375 Bacteria 1202
143 Ga0105239_11632881 3300010375 Bacteria 746
144 Ga0157373_10337199 3300013100 Unclassified 1074
145 Ga0157373_10553871 3300013100 Unclassified 834
146 Ga0157371_10647554 3300013102 Unclassified 788
147 Ga0157370_10325223 3300013104 Unclassified 1418
148 Ga0157370_10478133 3300013104 Unclassified 1145
149 Ga0157374_10047576 3300013296 Bacteria 3977
150 Ga0157374_10365704 3300013296 Unclassified 1435
151 Ga0157374_11052832 3300013296 Bacteria 833
152 Ga0157378_10154706 3300013297 Bacteria 2139
153 Ga0157378_10298955 3300013297 Bacteria 1557
154 Ga0157378_10369469 3300013297 Bacteria 1406
155 Ga0157378_10973184 3300013297 Bacteria 882
156 Ga0163162_10521916 3300013306 Unclassified 1317
157 Ga0163162_10790264 3300013306 Bacteria 1067
158 Ga0163162_10836146 3300013306 Bacteria 1036
159 Ga0157372_10179246 3300013307 Unclassified 2453
160 Ga0157372_10622550 3300013307 Bacteria 1258
161 Ga0157372_10651679 3300013307 Archaea 1226
162 Ga0157372_11223418 3300013307 Bacteria 868
163 Ga0157375_10187698 3300013308 Bacteria 2221
164 Ga0157375_10799264 3300013308 Unclassified 1092
165 Ga0163163_10062349 3300014325 Bacteria 3694
166 Ga0163163_10228679 3300014325 Unclassified 1909
167 Ga0163163_10425666 3300014325 Bacteria 1387
168 Ga0163163_10646288 3300014325 Bacteria 1121
169 Ga0163163_10655615 3300014325 Bacteria 1113
170 Ga0163163_10681868 3300014325 Bacteria 1091
171 Ga0163163_10773888 3300014325 Unclassified 1023
172 Ga0157380_10042416 3300014326 Bacteria 3557
173 Ga0157380_10185474 3300014326 Bacteria 1832
174 Ga0157380_11585798 3300014326 Bacteria 710
175 Ga0157380_12409178 3300014326 Bacteria 592
176 Ga0157377_10223826 3300014745 Bacteria 1206
177 Ga0157379_10738696 3300014968 Bacteria 926
178 Ga0157379_11125022 3300014968 Unclassified 753
179 Ga0157379_11942726 3300014968 Unclassified 580
180 Ga0157376_10258232 3300014969 Bacteria 1631
181 Ga0157376_10445721 3300014969 Bacteria 1262
182 Ga0157376_10611860 3300014969 Bacteria 1085
183 Ga0163161_10035730 3300017792 Bacteria 3557
184 Ga0207710_10016171 3300025900 Bacteria 3156
185 Ga0207680_10138914 3300025903 Bacteria 1609
186 Ga0207680_10150981 3300025903 Bacteria 1549
187 Ga0207699_10478730 3300025906 Bacteria 896
188 Ga0207643_10145031 3300025908 Bacteria 1420
189 Ga0207684_10347983 3300025910 Bacteria 1276
190 Ga0207654_10758851 3300025911 Bacteria 699
191 Ga0207707_10062292 3300025912 Unclassified 3245
192 Ga0207695_10344015 3300025913 Unclassified 1379
193 Ga0207671_10099403 3300025914 Unclassified 2202
194 Ga0207671_10427959 3300025914 Bacteria 1053
195 Ga0207660_10213707 3300025917 Unclassified 1511
196 Ga0207662_10204156 3300025918 Bacteria 1280
197 Ga0207649_10325229 3300025920 Bacteria 1131
198 Ga0207649_10333712 3300025920 Unclassified 1118
199 Ga0207652_10143041 3300025921 Bacteria 2139
200 Ga0207646_10009624 3300025922 Bacteria 9534
201 Ga0207681_10332999 3300025923 Bacteria 1211
202 Ga0207650_10041247 3300025925 Bacteria 3381
203 Ga0207650_10113075 3300025925 Bacteria 2104
204 Ga0207650_10218070 3300025925 Unclassified 1534
205 Ga0207650_10305478 3300025925 Bacteria 1300
206 Ga0207650_10867346 3300025925 Bacteria 766
207 Ga0207650_11125832 3300025925 Unclassified 668
208 Ga0207659_10095526 3300025926 Unclassified 2229
209 Ga0207659_10499815 3300025926 Bacteria 1029
210 Ga0207659_10792578 3300025926 Bacteria 814
211 Ga0207644_11303176 3300025931 Unclassified 610
212 Ga0207706_10097956 3300025933 Bacteria 2580
213 Ga0207706_11367280 3300025933 Unclassified 583
214 Ga0207706_11368765 3300025933 Unclassified 582
215 Ga0207686_10383054 3300025934 Bacteria 1067
216 Ga0207670_10046127 3300025936 Bacteria 2893
217 Ga0207670_10299822 3300025936 Bacteria 1258
218 Ga0207669_10286474 3300025937 Bacteria 1245
219 Ga0207704_10012547 3300025938 Bacteria 4209
220 Ga0207704_10370498 3300025938 Bacteria 1121
221 Ga0207665_10000007 3300025939 Bacteria 177869
222 Ga0207691_10222070 3300025940 Bacteria 1638
223 Ga0207711_10106328 3300025941 Bacteria 2490
224 Ga0207689_10033036 3300025942 Bacteria 4301
225 Ga0207689_10154140 3300025942 Unclassified 1894
226 Ga0207689_10216332 3300025942 Bacteria 1583
227 Ga0207689_11103017 3300025942 Bacteria 669
228 Ga0207679_10025533 3300025945 Bacteria 4065
229 Ga0207679_10201986 3300025945 Unclassified 1661
230 Ga0207679_10730467 3300025945 Unclassified 900
231 Ga0207679_10738346 3300025945 Bacteria 895
232 Ga0207667_10144522 3300025949 Bacteria 2449
233 Ga0207667_10320808 3300025949 Bacteria 1582
234 Ga0207667_10660714 3300025949 Unclassified 1050
235 Ga0207651_10280519 3300025960 Bacteria 1377
236 Ga0207712_10029309 3300025961 Bacteria 3691
237 Ga0207712_10421909 3300025961 Bacteria 1126
238 Ga0207668_10086815 3300025972 Bacteria 2287
239 Ga0207640_10092748 3300025981 Unclassified 2096
240 Ga0207658_10476026 3300025986 Bacteria 1109
241 Ga0207658_11463544 3300025986 Unclassified 625
242 Ga0207677_10063696 3300026023 Bacteria 2564
243 Ga0207703_10012978 3300026035 Bacteria 6492
244 Ga0207703_10136675 3300026035 Bacteria 2122
245 Ga0207703_10720164 3300026035 Bacteria 950
246 Ga0207639_10134746 3300026041 Bacteria 2049
247 Ga0207708_10097715 3300026075 Unclassified 2269
248 Ga0207708_10101411 3300026075 Bacteria 2228
249 Ga0207702_10341716 3300026078 Unclassified 1430
250 Ga0207641_10113016 3300026088 Bacteria 2410
251 Ga0207641_10372154 3300026088 Bacteria 1366
252 Ga0207641_10873570 3300026088 Bacteria 892
253 Ga0207648_10101221 3300026089 Bacteria 2525
254 Ga0207648_10182683 3300026089 Bacteria 1857
255 Ga0207676_10052721 3300026095 Bacteria 3181
256 Ga0207676_10092990 3300026095 Bacteria 2481
257 Ga0207676_10921042 3300026095 Bacteria 858
258 Ga0207676_10970726 3300026095 Unclassified 836
259 Ga0207674_10288600 3300026116 Unclassified 1589
260 Ga0207674_11058955 3300026116 Bacteria 780
261 Ga0207683_10143064 3300026121 Bacteria 2155
262 Ga0207683_10472933 3300026121 Bacteria 1156
263 Ga0207428_10126501 3300027907 Bacteria 1957
264 Ga0268265_10142938 3300028380 Bacteria 2006
265 Ga0268265_10280346 3300028380 Unclassified 1491
266 Ga0268265_10285885 3300028380 Bacteria 1478
267 Ga0268265_11183290 3300028380 Bacteria 761
268 Ga0268264_10065240 3300028381 Bacteria 3067
269 Ga0268264_10195870 3300028381 Unclassified 1845
270 Ga0268264_10970806 3300028381 Bacteria 855
271 Ga0307405_10005875 3300031731 Bacteria 5976
272 Ga0307405_10465213 3300031731 Unclassified 1006
273 Ga0307405_10616244 3300031731 Bacteria 888
274 Ga0307405_11122521 3300031731 Bacteria 677
275 Ga0307413_10099064 3300031824 Bacteria 1920
276 Ga0307413_10177532 3300031824 Bacteria 1514
277 Ga0307413_11833743 3300031824 Unclassified 543
278 Ga0307410_10009191 3300031852 Bacteria 5530
279 Ga0307410_10047837 3300031852 Unclassified 2861
280 Ga0307406_10054133 3300031901 Unclassified 2560
281 Ga0307406_10269058 3300031901 Unclassified 1294
282 Ga0307407_10308441 3300031903 Bacteria 1106
283 Ga0307412_10055154 3300031911 Unclassified 2642
284 Ga0307412_10330856 3300031911 Unclassified 1216
285 Ga0307409_100442390 3300031995 Unclassified 1253
286 Ga0307409_100937100 3300031995 Bacteria 881
287 Ga0307414_10242421 3300032004 Bacteria 1493
288 Ga0307411_10216273 3300032005 Bacteria 1483
289 Ga0307415_100073574 3300032126 Bacteria 2411
290 Ga0307415_100146132 3300032126 Unclassified 1813
291 Ga0307415_100400494 3300032126 Unclassified 1172
292 Ga0373937_0763871 3300036401 Bacteria 914
293 Ga0436364_0396599 3300037853 Bacteria 624
294 Ga0451797_0828923 3300041453 Bacteria 622
295 Ga0453684_0267291 3300044712 Bacteria 1956
296 Ga0453684_0653871 3300044712 Bacteria 1147
297 Ga0495663_0001071 3300046525 Bacteria 8915
298 Ga0495598_0002731 3300046537 Bacteria 3664
299 Ga0495598_0020876 3300046537 Bacteria 1735
300 Ga0495621_0001182 3300046539 Bacteria 6741
301 Ga0495625_0319130 3300046660 Bacteria 990
302 Ga0495669_0247716 3300046684 Bacteria 856
303 Ga0495636_0430732 3300047318 Unclassified 631
304 Ga0495672_0177832 3300047320 Bacteria 1080
305 Ga0496101_0357208 3300048904 Bacteria 1149
306 Ga0501206_069014 3300049653 Bacteria 595
307 Ga0501207_012024 3300049654 Bacteria 1296
308 Ga0501224_056061 3300049664 Bacteria 610
309 Ga0501230_036995 3300049667 Bacteria 933
310 Ga0501233_119268 3300049668 Bacteria 712
311 Ga0501235_020209 3300049669 Unclassified 1479
312 Ga0501235_046307 3300049669 Bacteria 1001
313 Ga0501250_041202 3300049680 Bacteria 678
314 Ga0501225_0039216 3300049705 Unclassified 1305
315 Ga0501245_050074 3300049708 Bacteria 738
316 nmdc:mga03683_48759_c1 3300050489 Bacteria 1761
317 nmdc:mga0k408_442574_c1 3300050493 Bacteria 772
318 nmdc:mga08y16_695037_c1 3300050511 Unclassified 1017
319 nmdc:mga08y16_80988_c1 3300050511 Bacteria 3385
320 nmdc:mga0rr50_636830_c1 3300050513 Bacteria 909
321 nmdc:mga0a205_573686_c1 3300050515 Unclassified 982
322 Ga0500568_0222286 3300053139 Bacteria 690
323 Ga0500588_0063318 3300053146 Bacteria 1192
324 Ga0500616_0001477 3300053153 Bacteria 22328
325 8055637238 8055632911 Bacteria 5283357
326 Ga0207658_10311435
327 LJNas_1008447
328 Ga0065704_10099697
329 Ga0065704_10109676
330 Ga0065704_10355847
331 Ga0065712_10379922
332 Ga0065715_10147175
333 Ga0065715_10266329
334 Ga0065707_10014083
335 Ga0065707_10348144
336 Ga0070676_10170564
337 Ga0070690_100007168
338 Ga0070690_100155803
339 Ga0070690_100392192
340 Ga0070690_100823756
341 Ga0070670_100033272
342 Ga0070670_100051550
343 Ga0070670_100135395
344 Ga0070670_101233078
345 Ga0070677_10193722
346 Ga0068869_100018204
347 Ga0068869_100026607
348 Ga0068869_100178139
349 Ga0070666_10745546
350 Ga0070666_10772177
351 Ga0070680_100066877
352 Ga0070682_101373300
353 Ga0070689_100004295
354 Ga0070689_100079095
355 Ga0070689_100355597
356 Ga0070689_100431850
357 Ga0070687_100151422
358 Ga0070687_100843101
359 Ga0070661_100309999
360 Ga0070668_100072580
361 Ga0070675_100073655
362 Ga0070675_100579066
363 Ga0070675_101107921
364 Ga0070675_101280762
365 Ga0070671_100141336
366 Ga0070671_100312422
367 Ga0070688_100157786
368 Ga0070688_100286357
369 Ga0070659_100697893
370 Ga0070700_100077784
371 Ga0070694_100397205
372 Ga0070678_100179495
373 Ga0070678_100347176
374 Ga0070662_100491310
375 Ga0070681_10012179
376 Ga0068867_100270363
377 Ga0068867_100458715
378 Ga0068867_101308948
379 Ga0070685_10062121
380 Ga0070685_10188814
381 Ga0070707_100001213
382 Ga0070707_101293490
383 Ga0070698_100003096
384 Ga0070698_100031211
385 Ga0070698_100077312
386 Ga0070699_100169451
387 Ga0070699_100523242
388 Ga0070679_100172491
389 Ga0070679_100410884
390 Ga0070697_100000170
391 Ga0068853_100006875
392 Ga0068853_100291111
393 Ga0070672_100197404
394 Ga0070686_100000980
395 Ga0070686_100012088
396 Ga0070686_100227373
397 Ga0070686_100334751
398 Ga0070695_100638589
399 Ga0070695_101299875
400 Ga0070704_100065117
401 Ga0070704_101307683
402 Ga0068855_100174520
403 Ga0068855_100414887
404 Ga0070664_100028135
405 Ga0070664_100444282
406 Ga0070664_100770070
407 Ga0068857_100546559
408 Ga0068857_101030082
409 Ga0068857_101434966
410 Ga0068854_100166435
411 Ga0068854_100812998
412 Ga0068856_100476367
413 Ga0068859_100094224
414 Ga0068859_100165347
415 Ga0068859_100564975
416 Ga0068859_102516596
417 Ga0068864_100126324
418 Ga0068864_100275466
419 Ga0068864_100499037
420 Ga0068864_101299279
421 Ga0068861_101917731
422 Ga0068870_10235499
423 Ga0068863_100138357
424 Ga0068863_100714486
425 Ga0068863_100955665
426 Ga0068858_100103508
427 Ga0068858_100860046
428 Ga0068860_100053906
429 Ga0068860_100364800
430 Ga0068860_100510769
431 Ga0068862_100026444
432 Ga0068862_100112094
433 Ga0070716_100000002
434 Ga0097621_100058647
435 Ga0097621_100084537
436 Ga0097621_100087452
437 Ga0097621_100326774
438 Ga0068871_100107897
439 Ga0075429_100422393
440 Ga0068865_100401498
441 Ga0068865_100643357
442 Ga0097620_100094227
443 Ga0097620_100165345
444 Ga0097620_100564993
445 Ga0097620_102516611
446 Ga0105244_10132454
447 Ga0105240_10724340
448 Ga0105245_10345549
449 Ga0105247_10017863
450 Ga0105247_10709856
451 Ga0105243_10048603
452 Ga0105243_11231237
453 Ga0105241_10295680
454 Ga0105241_11052090
455 Ga0105242_10218937
456 Ga0105248_10057750
457 Ga0105248_10505678
458 Ga0105248_12064995
459 Ga0105237_10098772
460 Ga0105237_10435385
461 Ga0105249_10070902
462 Ga0105249_10149990
463 Ga0105249_10301930
464 Ga0105249_11364452
465 Ga0099796_10237352
466 Ga0105239_10031757
467 Ga0105239_10652915
468 Ga0105239_11632881
469 Ga0157373_10337199
470 Ga0157373_10553871
471 Ga0157371_10647554
472 Ga0157370_10325223
473 Ga0157370_10478133
474 Ga0157374_10047576
475 Ga0157374_10365704
476 Ga0157374_11052832
477 Ga0157378_10154706
478 Ga0157378_10298955
479 Ga0157378_10369469
480 Ga0157378_10973184
481 Ga0163162_10521916
482 Ga0163162_10790264
483 Ga0163162_10836146
484 Ga0157372_10179246
485 Ga0157372_10622550
486 Ga0157372_10651679
487 Ga0157372_11223418
488 Ga0157375_10187698
489 Ga0157375_10799264
490 Ga0163163_10062349
491 Ga0163163_10228679
492 Ga0163163_10425666
493 Ga0163163_10646288
494 Ga0163163_10655615
495 Ga0163163_10681868
496 Ga0163163_10773888
497 Ga0157380_10042416
498 Ga0157380_10185474
499 Ga0157380_11585798
500 Ga0157380_12409178
501 Ga0157377_10223826
502 Ga0157379_10738696
503 Ga0157379_11125022
504 Ga0157379_11942726
505 Ga0157376_10258232
506 Ga0157376_10445721
507 Ga0157376_10611860
508 Ga0163161_10035730
509 Ga0207710_10016171
510 Ga0207680_10138914
511 Ga0207680_10150981
512 Ga0207699_10478730
513 Ga0207643_10145031
514 Ga0207684_10347983
515 Ga0207654_10758851
516 Ga0207707_10062292
517 Ga0207695_10344015
518 Ga0207671_10099403
519 Ga0207671_10427959
520 Ga0207660_10213707
521 Ga0207662_10204156
522 Ga0207649_10325229
523 Ga0207649_10333712
524 Ga0207652_10143041
525 Ga0207646_10009624
526 Ga0207681_10332999
527 Ga0207650_10041247
528 Ga0207650_10113075
529 Ga0207650_10218070
530 Ga0207650_10305478
531 Ga0207650_10867346
532 Ga0207650_11125832
533 Ga0207659_10095526
534 Ga0207659_10499815
535 Ga0207659_10792578
536 Ga0207644_11303176
537 Ga0207706_10097956
538 Ga0207706_11367280
539 Ga0207706_11368765
540 Ga0207686_10383054
541 Ga0207670_10046127
542 Ga0207670_10299822
543 Ga0207669_10286474
544 Ga0207704_10012547
545 Ga0207704_10370498
546 Ga0207665_10000007
547 Ga0207691_10222070
548 Ga0207711_10106328
549 Ga0207689_10033036
550 Ga0207689_10154140
551 Ga0207689_10216332
552 Ga0207689_11103017
553 Ga0207679_10025533
554 Ga0207679_10201986
555 Ga0207679_10730467
556 Ga0207679_10738346
557 Ga0207667_10144522
558 Ga0207667_10320808
559 Ga0207667_10660714
560 Ga0207651_10280519
561 Ga0207712_10029309
562 Ga0207712_10421909
563 Ga0207668_10086815
564 Ga0207640_10092748
565 Ga0207658_10476026
566 Ga0207658_11463544
567 Ga0207677_10063696
568 Ga0207703_10012978
569 Ga0207703_10136675
570 Ga0207703_10720164
571 Ga0207639_10134746
572 Ga0207708_10097715
573 Ga0207708_10101411
574 Ga0207702_10341716
575 Ga0207641_10113016
576 Ga0207641_10372154
577 Ga0207641_10873570
578 Ga0207648_10101221
579 Ga0207648_10182683
580 Ga0207676_10052721
581 Ga0207676_10092990
582 Ga0207676_10921042
583 Ga0207676_10970726
584 Ga0207674_10288600
585 Ga0207674_11058955
586 Ga0207683_10143064
587 Ga0207683_10472933
588 Ga0207428_10126501
589 Ga0268265_10142938
590 Ga0268265_10280346
591 Ga0268265_10285885
592 Ga0268265_11183290
593 Ga0268264_10065240
594 Ga0268264_10195870
595 Ga0268264_10970806
596 Ga0307405_10005875
597 Ga0307405_10465213
598 Ga0307405_10616244
599 Ga0307405_11122521
600 Ga0307413_10099064
601 Ga0307413_10177532
602 Ga0307413_11833743
603 Ga0307410_10009191
604 Ga0307410_10047837
605 Ga0307406_10054133
606 Ga0307406_10269058
607 Ga0307407_10308441
608 Ga0307412_10055154
609 Ga0307412_10330856
610 Ga0307409_100442390
611 Ga0307409_100937100
612 Ga0307414_10242421
613 Ga0307411_10216273
614 Ga0307415_100073574
615 Ga0307415_100146132
616 Ga0307415_100400494
617 Ga0373937_0763871
618 Ga0436364_0396599
619 Ga0451797_0828923
620 Ga0453684_0267291
621 Ga0453684_0653871
622 Ga0495663_0001071
623 Ga0495598_0002731
624 Ga0495598_0020876
625 Ga0495621_0001182
626 Ga0495625_0319130
627 Ga0495669_0247716
628 Ga0495636_0430732
629 Ga0495672_0177832
630 Ga0496101_0357208
631 Ga0501206_069014
632 Ga0501207_012024
633 Ga0501224_056061
634 Ga0501230_036995
635 Ga0501233_119268
636 Ga0501235_020209
637 Ga0501235_046307
638 Ga0501250_041202
639 Ga0501225_0039216
640 Ga0501245_050074
641 nmdc:mga03683_48759_c1
642 nmdc:mga0k408_442574_c1
643 nmdc:mga08y16_695037_c1
644 nmdc:mga08y16_80988_c1
645 nmdc:mga0rr50_636830_c1
646 nmdc:mga0a205_573686_c1
647 Ga0500568_0222286
648 Ga0500588_0063318
649 Ga0500616_0001477
650 8055637238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11188

DUF2975

Protein of unknown function (DUF2975)

49

175

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wwf-assembly2.cif.gz_B-2 high-resolution structure of two ni-bound forms of the m123c mutant of c. metallidurans cnrxs 0.7584 50 106
6w1s-assembly1.cif.gz_Q atomic model of the mammalian mediator complex 0.566 50 148
3zg1-assembly2.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.5394 50 135
7arb-assembly1.cif.gz_K cryo-em structure of arabidopsis thaliana complex-i (complete composition) 0.5287 1 116
7aqo-assembly1.cif.gz_J yeast tho-sub2 complex dimer 0.5252 48 141
ID Description Score Start End Superfamily
3epvC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8758 50 108 1.20.120.1490
af_A0A143ZYC1_108_228_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7504 48 113 3.30.40.10
af_Q8I3I3_211_336_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7152 48 118 3.30.40.10
af_G5EEW9_129_223_1.20.1250.10 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; 0.7075 48 135 1.20.1250.10
af_Q54PF0_152_283_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6914 48 121 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A352EVT5-F1-model_v4 Uncharacterized protein 0.9641 1 90 GO:0016020
AF-A0A352EVT5-F1-model_v4 Uncharacterized protein 0.9438 1 90 GO:0016020
AF-A0A0G1WHU3-F1-model_v4 DUF5671 domain-containing protein 0.9309 1 131 GO:0016020
AF-A0A2E2HD27-F1-model_v4 DUF2975 domain-containing protein 0.9308 1 131 GO:0016020
AF-A0A0G1YYT3-F1-model_v4 DUF2975 domain-containing protein 0.9167 2 135 GO:0016020

Map