F407875
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 209 | 321 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300025972|Ga0207668_10008338|Ga0207668_100083384 |
| Length | 221 |
| Sequence | MCFEWSFDPLMALPAIAFYVLAVVTVASALAVVSARNPVHSVLFLILSFFSAAGLFVLLGAEFLAMLDVDFTALRQGFARYMPLGGLVAGVLAIEMIVVSASVATNGAAGKNDAPFVATDVTNAESIGRVLYTDYVYFFQAAGLVLLVAMIGAIVLTLRHKPGVRRQVIADQVARNPRTGMRVVSIKPGEGIGEPSFAEATEGRLTANQSGGSVLRSSEGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 2 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 3 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 4 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 45 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 65 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 104 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 108 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 109 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 110 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 112 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 113 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 114 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 115 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 116 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 117 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 118 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 119 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 121 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 122 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 123 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 126 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 127 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 134 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 135 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 136 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 137 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 138 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 139 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 140 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 141 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 142 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 163 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 164 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 165 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 166 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 167 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 175 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 179 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 180 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 181 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 182 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 184 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 186 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 187 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 188 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 189 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 190 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 191 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 192 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 193 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 194 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 195 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 196 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 197 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 198 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 199 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 200 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 201 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 202 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 203 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 204 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 205 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 206 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 207 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 208 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.15 |
| Metatranscriptomes | 0.62 |
| Isolates | 1.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.46 |
| Nodule | 0 |
| Rhizoplane | 2.15 |
| Rhizosphere | 76.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10059006 | 3300003215 | Bacteria | 1053 |
| 2 | Ga0055536_1011155 | 3300003781 | Bacteria | 3484 |
| 3 | Ga0055531_10010557 | 3300003794 | Bacteria | 4572 |
| 4 | Ga0065165_1005863 | 3300005262 | Bacteria | 6679 |
| 5 | Ga0070658_10022471 | 3300005327 | Bacteria | 5062 |
| 6 | Ga0070658_10067361 | 3300005327 | Bacteria | 2925 |
| 7 | Ga0070658_10396270 | 3300005327 | Bacteria | 1185 |
| 8 | Ga0070658_10654400 | 3300005327 | Bacteria | 911 |
| 9 | Ga0070683_100757055 | 3300005329 | Bacteria | 931 |
| 10 | Ga0070670_100112035 | 3300005331 | Bacteria | 2351 |
| 11 | Ga0070666_10024927 | 3300005335 | Bacteria | 3899 |
| 12 | Ga0070666_10112537 | 3300005335 | Bacteria | 1883 |
| 13 | Ga0070680_100002884 | 3300005336 | Bacteria | 12785 |
| 14 | Ga0070680_100234977 | 3300005336 | Bacteria | 1548 |
| 15 | Ga0068868_100169328 | 3300005338 | Bacteria | 1808 |
| 16 | Ga0070660_100083509 | 3300005339 | Bacteria | 2509 |
| 17 | Ga0070691_10055171 | 3300005341 | Bacteria | 1903 |
| 18 | Ga0070661_100442119 | 3300005344 | Bacteria | 1033 |
| 19 | Ga0070668_100026974 | 3300005347 | Bacteria | 4360 |
| 20 | Ga0070668_100086236 | 3300005347 | Bacteria | 2468 |
| 21 | Ga0070668_100232122 | 3300005347 | Bacteria | 1526 |
| 22 | Ga0070671_100279990 | 3300005355 | Bacteria | 1418 |
| 23 | Ga0070673_100184680 | 3300005364 | Bacteria | 1787 |
| 24 | Ga0070659_100000373 | 3300005366 | Bacteria | 33795 |
| 25 | Ga0070659_100005185 | 3300005366 | Bacteria | 9354 |
| 26 | Ga0070659_100012608 | 3300005366 | Bacteria | 6268 |
| 27 | Ga0070667_100034345 | 3300005367 | Bacteria | 4243 |
| 28 | Ga0070713_100693330 | 3300005436 | Bacteria | 972 |
| 29 | Ga0070713_101369887 | 3300005436 | Bacteria | 686 |
| 30 | Ga0070681_10020073 | 3300005458 | Bacteria | 6696 |
| 31 | Ga0070681_10262347 | 3300005458 | Bacteria | 1639 |
| 32 | Ga0070679_100006911 | 3300005530 | Bacteria | 10585 |
| 33 | Ga0070679_100104915 | 3300005530 | Bacteria | 2812 |
| 34 | Ga0070684_101103240 | 3300005535 | Bacteria | 746 |
| 35 | Ga0068853_100030979 | 3300005539 | Bacteria | 4521 |
| 36 | Ga0068853_100417664 | 3300005539 | Bacteria | 1257 |
| 37 | Ga0070665_100152839 | 3300005548 | Bacteria | 2311 |
| 38 | Ga0068855_100056818 | 3300005563 | Bacteria | 4589 |
| 39 | Ga0068855_100182680 | 3300005563 | Bacteria | 2370 |
| 40 | Ga0068855_100274760 | 3300005563 | Bacteria | 1873 |
| 41 | Ga0068855_100653955 | 3300005563 | Bacteria | 1128 |
| 42 | Ga0070664_100211893 | 3300005564 | Bacteria | 1732 |
| 43 | Ga0068857_100663637 | 3300005577 | Bacteria | 989 |
| 44 | Ga0068856_100514880 | 3300005614 | Bacteria | 1218 |
| 45 | Ga0068859_100306844 | 3300005617 | Bacteria | 1680 |
| 46 | Ga0068859_100369650 | 3300005617 | Bacteria | 1529 |
| 47 | Ga0068864_100073787 | 3300005618 | Bacteria | 2975 |
| 48 | Ga0068861_100103460 | 3300005719 | Bacteria | 2269 |
| 49 | Ga0068861_100571253 | 3300005719 | Bacteria | 1033 |
| 50 | Ga0068863_100000007 | 3300005841 | Bacteria | 257578 |
| 51 | Ga0068863_100153556 | 3300005841 | Bacteria | 2203 |
| 52 | Ga0068863_100689823 | 3300005841 | Bacteria | 1015 |
| 53 | Ga0068858_100479335 | 3300005842 | Bacteria | 1201 |
| 54 | Ga0068860_100001231 | 3300005843 | Bacteria | 27931 |
| 55 | Ga0068860_100554471 | 3300005843 | Bacteria | 1152 |
| 56 | Ga0068860_100696538 | 3300005843 | Bacteria | 1025 |
| 57 | Ga0068862_100246177 | 3300005844 | Bacteria | 1628 |
| 58 | Ga0068862_100287634 | 3300005844 | Bacteria | 1508 |
| 59 | Ga0068862_100407938 | 3300005844 | Bacteria | 1272 |
| 60 | Ga0070717_10912974 | 3300006028 | Bacteria | 799 |
| 61 | Ga0075368_10019529 | 3300006042 | Bacteria | 2559 |
| 62 | Ga0075363_100026023 | 3300006048 | Bacteria | 2990 |
| 63 | Ga0075363_100106870 | 3300006048 | Bacteria | 1552 |
| 64 | Ga0075364_10000935 | 3300006051 | Bacteria | 15418 |
| 65 | Ga0075362_10055421 | 3300006177 | Bacteria | 1783 |
| 66 | Ga0075367_10030784 | 3300006178 | Bacteria | 3079 |
| 67 | Ga0097620_100306853 | 3300006931 | Bacteria | 1680 |
| 68 | Ga0105250_10002835 | 3300009092 | Bacteria | 8495 |
| 69 | Ga0105240_10021216 | 3300009093 | Bacteria | 8646 |
| 70 | Ga0105240_10039815 | 3300009093 | Bacteria | 6016 |
| 71 | Ga0105240_10176644 | 3300009093 | Bacteria | 2524 |
| 72 | Ga0105240_10258157 | 3300009093 | Bacteria | 2012 |
| 73 | Ga0105240_10302496 | 3300009093 | Bacteria | 1829 |
| 74 | Ga0105240_10630336 | 3300009093 | Bacteria | 1177 |
| 75 | Ga0111539_10037685 | 3300009094 | Bacteria | 5837 |
| 76 | Ga0105247_10228903 | 3300009101 | Bacteria | 1261 |
| 77 | Ga0105242_10226506 | 3300009176 | Bacteria | 1673 |
| 78 | Ga0105248_10137419 | 3300009177 | Bacteria | 2757 |
| 79 | Ga0105248_10311043 | 3300009177 | Bacteria | 1774 |
| 80 | Ga0105248_11089867 | 3300009177 | Bacteria | 903 |
| 81 | Ga0105248_11392324 | 3300009177 | Bacteria | 793 |
| 82 | Ga0105248_11392326 | 3300009177 | Bacteria | 793 |
| 83 | Ga0105237_10383014 | 3300009545 | Bacteria | 1411 |
| 84 | Ga0105237_10683854 | 3300009545 | Bacteria | 1033 |
| 85 | Ga0105238_10161506 | 3300009551 | Bacteria | 2216 |
| 86 | Ga0105238_10304722 | 3300009551 | Bacteria | 1577 |
| 87 | Ga0105238_10392484 | 3300009551 | Bacteria | 1380 |
| 88 | Ga0105238_10887853 | 3300009551 | Bacteria | 909 |
| 89 | Ga0105238_11066579 | 3300009551 | Bacteria | 830 |
| 90 | Ga0105249_10258525 | 3300009553 | Bacteria | 1729 |
| 91 | Ga0105249_11390534 | 3300009553 | Bacteria | 774 |
| 92 | Ga0105239_10249411 | 3300010375 | Bacteria | 1994 |
| 93 | Ga0105239_10416758 | 3300010375 | Bacteria | 1521 |
| 94 | Ga0105239_10928634 | 3300010375 | Bacteria | 999 |
| 95 | Ga0157373_10262696 | 3300013100 | Bacteria | 1222 |
| 96 | Ga0157373_10578756 | 3300013100 | Bacteria | 816 |
| 97 | Ga0157369_11105296 | 3300013105 | Bacteria | 810 |
| 98 | Ga0157372_10619051 | 3300013307 | Bacteria | 1262 |
| 99 | Ga0157375_10088786 | 3300013308 | Bacteria | 3146 |
| 100 | Ga0157375_10516382 | 3300013308 | Bacteria | 1358 |
| 101 | Ga0157375_10781085 | 3300013308 | Bacteria | 1105 |
| 102 | Ga0163163_10715813 | 3300014325 | Bacteria | 1065 |
| 103 | Ga0157379_10040158 | 3300014968 | Bacteria | 4175 |
| 104 | Ga0157379_10855222 | 3300014968 | Bacteria | 861 |
| 105 | Ga0182007_10028896 | 3300015262 | Bacteria | 1901 |
| 106 | Ga0213876_10026910 | 3300021384 | Bacteria | 3035 |
| 107 | Ga0213876_10122458 | 3300021384 | Bacteria | 1381 |
| 108 | Ga0213876_10223215 | 3300021384 | Bacteria | 1002 |
| 109 | Ga0209676_1000661 | 3300025292 | Bacteria | 49370 |
| 110 | Ga0209050_1011611 | 3300025298 | Bacteria | 4150 |
| 111 | Ga0209257_1000178 | 3300025304 | Bacteria | 160969 |
| 112 | Ga0207696_1017989 | 3300025711 | Bacteria | 2329 |
| 113 | Ga0207680_10122119 | 3300025903 | Bacteria | 1705 |
| 114 | Ga0207680_10223805 | 3300025903 | Bacteria | 1291 |
| 115 | Ga0207705_10001414 | 3300025909 | Bacteria | 19120 |
| 116 | Ga0207705_10158307 | 3300025909 | Bacteria | 1700 |
| 117 | Ga0207705_10490695 | 3300025909 | Bacteria | 954 |
| 118 | Ga0207707_10115807 | 3300025912 | Bacteria | 2342 |
| 119 | Ga0207707_10152706 | 3300025912 | Bacteria | 2019 |
| 120 | Ga0207707_10154227 | 3300025912 | Bacteria | 2008 |
| 121 | Ga0207695_10000718 | 3300025913 | Bacteria | 64451 |
| 122 | Ga0207695_10001195 | 3300025913 | Bacteria | 44633 |
| 123 | Ga0207695_10003313 | 3300025913 | Bacteria | 22832 |
| 124 | Ga0207695_10039184 | 3300025913 | Bacteria | 5095 |
| 125 | Ga0207695_10041800 | 3300025913 | Bacteria | 4904 |
| 126 | Ga0207695_10070044 | 3300025913 | Bacteria | 3587 |
| 127 | Ga0207671_10177249 | 3300025914 | Bacteria | 1657 |
| 128 | Ga0207660_10003153 | 3300025917 | Bacteria | 10795 |
| 129 | Ga0207660_10386527 | 3300025917 | Bacteria | 1125 |
| 130 | Ga0207657_10013040 | 3300025919 | Bacteria | 8168 |
| 131 | Ga0207652_10003865 | 3300025921 | Bacteria | 12269 |
| 132 | Ga0207652_10583549 | 3300025921 | Bacteria | 1003 |
| 133 | Ga0207694_10051471 | 3300025924 | Bacteria | 3192 |
| 134 | Ga0207694_10234082 | 3300025924 | Bacteria | 1500 |
| 135 | Ga0207694_10528525 | 3300025924 | Bacteria | 989 |
| 136 | Ga0207690_10000053 | 3300025932 | Bacteria | 105125 |
| 137 | Ga0207690_10018241 | 3300025932 | Bacteria | 4303 |
| 138 | Ga0207690_10060380 | 3300025932 | Bacteria | 2573 |
| 139 | Ga0207686_10335250 | 3300025934 | Bacteria | 1134 |
| 140 | Ga0207669_10280815 | 3300025937 | Bacteria | 1256 |
| 141 | Ga0207711_10001604 | 3300025941 | Bacteria | 20913 |
| 142 | Ga0207711_10095087 | 3300025941 | Bacteria | 2627 |
| 143 | Ga0207711_10153964 | 3300025941 | Bacteria | 2076 |
| 144 | Ga0207679_10173665 | 3300025945 | Bacteria | 1777 |
| 145 | Ga0207667_10007334 | 3300025949 | Bacteria | 13274 |
| 146 | Ga0207667_10055637 | 3300025949 | Bacteria | 4159 |
| 147 | Ga0207667_10103701 | 3300025949 | Bacteria | 2933 |
| 148 | Ga0207667_10727066 | 3300025949 | Bacteria | 993 |
| 149 | Ga0207712_10327932 | 3300025961 | Bacteria | 1265 |
| 150 | Ga0207668_10008338 | 3300025972 | Bacteria | 6171 |
| 151 | Ga0207668_10014125 | 3300025972 | Bacteria | 4938 |
| 152 | Ga0207668_10034024 | 3300025972 | Bacteria | 3380 |
| 153 | Ga0207658_10085986 | 3300025986 | Bacteria | 2423 |
| 154 | Ga0207677_10099646 | 3300026023 | Bacteria | 2134 |
| 155 | Ga0207703_10000038 | 3300026035 | Bacteria | 175917 |
| 156 | Ga0207703_10457869 | 3300026035 | Bacteria | 1192 |
| 157 | Ga0207639_10027910 | 3300026041 | Bacteria | 4116 |
| 158 | Ga0207639_10040418 | 3300026041 | Bacteria | 3481 |
| 159 | Ga0207639_10529057 | 3300026041 | Bacteria | 1080 |
| 160 | Ga0207639_10942299 | 3300026041 | Bacteria | 808 |
| 161 | Ga0207678_10105839 | 3300026067 | Bacteria | 2400 |
| 162 | Ga0207702_10514055 | 3300026078 | Bacteria | 1168 |
| 163 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 164 | Ga0207641_10366768 | 3300026088 | Bacteria | 1376 |
| 165 | Ga0207641_10750200 | 3300026088 | Bacteria | 963 |
| 166 | Ga0207676_10000179 | 3300026095 | Bacteria | 55697 |
| 167 | Ga0207676_10060769 | 3300026095 | Bacteria | 2990 |
| 168 | Ga0207674_10605858 | 3300026116 | Bacteria | 1058 |
| 169 | Ga0207675_100144246 | 3300026118 | Bacteria | 2263 |
| 170 | Ga0207698_10421261 | 3300026142 | Bacteria | 1281 |
| 171 | Ga0209981_1000363 | 3300027378 | Bacteria | 5788 |
| 172 | Ga0209983_1005457 | 3300027665 | Bacteria | 2634 |
| 173 | Ga0209813_10002977 | 3300027866 | Bacteria | 3924 |
| 174 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 175 | Ga0268266_10042668 | 3300028379 | Bacteria | 3875 |
| 176 | Ga0268265_10009872 | 3300028380 | Bacteria | 6448 |
| 177 | Ga0268265_10098207 | 3300028380 | Bacteria | 2358 |
| 178 | Ga0268265_10201876 | 3300028380 | Bacteria | 1725 |
| 179 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 180 | Ga0268264_10197711 | 3300028381 | Bacteria | 1837 |
| 181 | Ga0307517_10006007 | 3300028786 | Bacteria | 18094 |
| 182 | Ga0307517_10223018 | 3300028786 | Bacteria | 1143 |
| 183 | Ga0265338_10093250 | 3300028800 | Bacteria | 2481 |
| 184 | Ga0265760_10062473 | 3300031090 | Bacteria | 1133 |
| 185 | Ga0265331_10000003 | 3300031250 | Bacteria | 499358 |
| 186 | Ga0265327_10000602 | 3300031251 | Bacteria | 59632 |
| 187 | Ga0307513_10005748 | 3300031456 | Bacteria | 16317 |
| 188 | Ga0307513_10014216 | 3300031456 | Bacteria | 9734 |
| 189 | Ga0307408_100828742 | 3300031548 | Bacteria | 842 |
| 190 | Ga0265314_10009937 | 3300031711 | Bacteria | 7978 |
| 191 | Ga0307516_10000352 | 3300031730 | Bacteria | 59644 |
| 192 | Ga0307406_10009719 | 3300031901 | Bacteria | 5408 |
| 193 | Ga0307407_10338348 | 3300031903 | Bacteria | 1062 |
| 194 | Ga0307412_10064412 | 3300031911 | Bacteria | 2477 |
| 195 | Ga0307415_100887268 | 3300032126 | Bacteria | 821 |
| 196 | Ga0307510_10101264 | 3300033180 | Bacteria | 2669 |
| 197 | Ga0307510_10199059 | 3300033180 | Bacteria | 1541 |
| 198 | Ga0373926_0048986 | 3300035083 | Bacteria | 1521 |
| 199 | Ga0373934_0130048 | 3300035086 | Bacteria | 1027 |
| 200 | Ga0373932_0157149 | 3300035112 | Bacteria | 784 |
| 201 | Ga0373945_0009421 | 3300035116 | Bacteria | 3200 |
| 202 | Ga0373943_0076615 | 3300035170 | Bacteria | 1706 |
| 203 | Ga0373946_0052027 | 3300035171 | Bacteria | 1716 |
| 204 | Ga0373946_0168202 | 3300035171 | Bacteria | 1033 |
| 205 | Ga0373931_0022917 | 3300035691 | Bacteria | 3147 |
| 206 | Ga0373935_0115028 | 3300035692 | Bacteria | 1790 |
| 207 | Ga0373935_0146548 | 3300035692 | Bacteria | 1599 |
| 208 | Ga0373927_0000323 | 3300035695 | Bacteria | 37618 |
| 209 | Ga0373947_0014960 | 3300035725 | Bacteria | 4454 |
| 210 | Ga0373937_0015228 | 3300036401 | Bacteria | 6798 |
| 211 | Ga0373937_0183870 | 3300036401 | Bacteria | 1963 |
| 212 | Ga0373937_0239342 | 3300036401 | Bacteria | 1710 |
| 213 | Ga0373937_0614315 | 3300036401 | Bacteria | 1032 |
| 214 | Ga0373925_0000061 | 3300037068 | Bacteria | 117783 |
| 215 | Ga0373925_0004691 | 3300037068 | Bacteria | 10312 |
| 216 | Ga0373925_0456434 | 3300037068 | Bacteria | 1047 |
| 217 | Ga0395899_0000167 | 3300037312 | Bacteria | 100973 |
| 218 | Ga0395899_0426596 | 3300037312 | Bacteria | 873 |
| 219 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 220 | Ga0395900_0040733 | 3300037418 | Bacteria | 4787 |
| 221 | Ga0395900_0144666 | 3300037418 | Bacteria | 2432 |
| 222 | Ga0395900_0780201 | 3300037418 | Bacteria | 884 |
| 223 | Ga0395898_0010159 | 3300037466 | Bacteria | 9850 |
| 224 | Ga0395898_0194739 | 3300037466 | Bacteria | 1936 |
| 225 | Ga0395898_0625123 | 3300037466 | Bacteria | 1019 |
| 226 | Ga0395905_0007899 | 3300037471 | Bacteria | 10523 |
| 227 | Ga0395905_0016127 | 3300037471 | Bacteria | 7102 |
| 228 | Ga0395905_0295542 | 3300037471 | Bacteria | 1507 |
| 229 | Ga0395905_0692464 | 3300037471 | Bacteria | 921 |
| 230 | Ga0436364_1059231 | 3300037853 | Bacteria | 2540 |
| 231 | Ga0395901_0000014 | 3300038443 | Bacteria | 375100 |
| 232 | Ga0395901_0379858 | 3300038443 | Bacteria | 1454 |
| 233 | Ga0436365_0233899 | 3300039437 | Bacteria | 1236 |
| 234 | Ga0436365_0809060 | 3300039437 | Bacteria | 1210 |
| 235 | Ga0436365_1788617 | 3300039437 | Bacteria | 2803 |
| 236 | Ga0436365_1802241 | 3300039437 | Bacteria | 3059 |
| 237 | Ga0439431_0019354 | 3300041997 | Bacteria | 1618 |
| 238 | Ga0439464_0060424 | 3300042439 | Bacteria | 1109 |
| 239 | Ga0453684_0018305 | 3300044712 | Bacteria | 10766 |
| 240 | Ga0466968_0029329 | 3300044735 | Bacteria | 2275 |
| 241 | Ga0466970_0218814 | 3300044765 | Bacteria | 1063 |
| 242 | Ga0466958_0247977 | 3300045836 | Bacteria | 1139 |
| 243 | Ga0495580_0510309 | 3300046472 | Bacteria | 802 |
| 244 | Ga0495582_0130611 | 3300046473 | Bacteria | 1419 |
| 245 | Ga0495585_0076021 | 3300046492 | Bacteria | 1825 |
| 246 | Ga0495620_0035021 | 3300046515 | Bacteria | 2263 |
| 247 | Ga0495643_0006211 | 3300046522 | Bacteria | 7924 |
| 248 | Ga0495642_0011778 | 3300046528 | Bacteria | 3369 |
| 249 | Ga0495586_0182410 | 3300046535 | Bacteria | 1188 |
| 250 | Ga0495609_0010190 | 3300046538 | Bacteria | 4517 |
| 251 | Ga0495621_0110499 | 3300046539 | Bacteria | 1054 |
| 252 | Ga0495622_0002680 | 3300046557 | Bacteria | 8542 |
| 253 | Ga0495667_0536243 | 3300046559 | Bacteria | 732 |
| 254 | Ga0495668_0052746 | 3300046616 | Bacteria | 2250 |
| 255 | Ga0495668_0226228 | 3300046616 | Bacteria | 1024 |
| 256 | Ga0495611_0250756 | 3300046648 | Bacteria | 820 |
| 257 | Ga0495625_0184661 | 3300046660 | Bacteria | 1384 |
| 258 | Ga0495658_0001865 | 3300046683 | Bacteria | 10757 |
| 259 | Ga0495672_0096043 | 3300047320 | Bacteria | 1617 |
| 260 | Ga0495684_0380467 | 3300047471 | Bacteria | 996 |
| 261 | Ga0495686_0011256 | 3300047472 | Bacteria | 6308 |
| 262 | Ga0496100_0214031 | 3300048903 | Bacteria | 1411 |
| 263 | Ga0496101_0056988 | 3300048904 | Bacteria | 2825 |
| 264 | Ga0496112_0044480 | 3300048915 | Bacteria | 4351 |
| 265 | Ga0496115_0007769 | 3300048918 | Bacteria | 7908 |
| 266 | Ga0496115_0050813 | 3300048918 | Bacteria | 3323 |
| 267 | Ga0496115_0081396 | 3300048918 | Bacteria | 2637 |
| 268 | Ga0496115_0485019 | 3300048918 | Bacteria | 995 |
| 269 | Ga0496122_0000042 | 3300048925 | Bacteria | 280482 |
| 270 | Ga0496123_0000030 | 3300048926 | Bacteria | 291764 |
| 271 | Ga0496124_0082760 | 3300048927 | Bacteria | 2634 |
| 272 | Ga0501032_0329670 | 3300049569 | Bacteria | 984 |
| 273 | Ga0501034_0013786 | 3300049571 | Bacteria | 8317 |
| 274 | Ga0501034_0161171 | 3300049571 | Bacteria | 2214 |
| 275 | Ga0501037_0027718 | 3300049573 | Bacteria | 4186 |
| 276 | Ga0501038_0065716 | 3300049574 | Bacteria | 3090 |
| 277 | Ga0501042_0274558 | 3300049578 | Bacteria | 1217 |
| 278 | Ga0501047_0557057 | 3300049581 | Bacteria | 970 |
| 279 | Ga0501077_0315254 | 3300049593 | Bacteria | 997 |
| 280 | Ga0501257_005630 | 3300049686 | Bacteria | 2765 |
| 281 | Ga0501080_0545309 | 3300049742 | Bacteria | 1033 |
| 282 | Ga0501044_0136565 | 3300049823 | Bacteria | 2443 |
| 283 | Ga0501044_0506502 | 3300049823 | Bacteria | 1108 |
| 284 | Ga0501045_0216316 | 3300049824 | Bacteria | 1427 |
| 285 | nmdc:mga00v17_322_c1 | 3300050491 | Bacteria | 27155 |
| 286 | nmdc:mga0k408_7843_c1 | 3300050493 | Bacteria | 5709 |
| 287 | nmdc:mga06z11_75640_c1 | 3300050494 | Bacteria | 1794 |
| 288 | nmdc:mga04h51_136941_c1 | 3300050495 | Bacteria | 926 |
| 289 | nmdc:mga08y16_143100_c1 | 3300050511 | Bacteria | 2486 |
| 290 | Ga0500635_0000489 | 3300053080 | Bacteria | 11028 |
| 291 | Ga0495655_0023359 | 3300053083 | Bacteria | 1425 |
| 292 | Ga0500578_0149265 | 3300053086 | Bacteria | 1457 |
| 293 | Ga0500643_018019 | 3300053087 | Bacteria | 2352 |
| 294 | Ga0500644_0031944 | 3300053088 | Bacteria | 1678 |
| 295 | Ga0500647_0088346 | 3300053091 | Bacteria | 1485 |
| 296 | Ga0500651_0024969 | 3300053093 | Bacteria | 3749 |
| 297 | Ga0500651_0034610 | 3300053093 | Bacteria | 3185 |
| 298 | Ga0500641_0000885 | 3300053096 | Bacteria | 10715 |
| 299 | Ga0500555_094573 | 3300053103 | Bacteria | 765 |
| 300 | Ga0500555_111683 | 3300053103 | Bacteria | 688 |
| 301 | Ga0500556_0001909 | 3300053104 | Bacteria | 7444 |
| 302 | Ga0500556_0029947 | 3300053104 | Bacteria | 1840 |
| 303 | Ga0500562_001070 | 3300053108 | Bacteria | 6729 |
| 304 | Ga0500562_004279 | 3300053108 | Bacteria | 3613 |
| 305 | Ga0500591_102879 | 3300053115 | Bacteria | 1217 |
| 306 | Ga0500595_002565 | 3300053119 | Bacteria | 8893 |
| 307 | Ga0500595_052271 | 3300053119 | Bacteria | 1262 |
| 308 | Ga0500607_064120 | 3300053121 | Bacteria | 1914 |
| 309 | Ga0500608_002327 | 3300053122 | Bacteria | 6895 |
| 310 | Ga0500614_002843 | 3300053123 | Bacteria | 3803 |
| 311 | Ga0500642_0140126 | 3300053130 | Bacteria | 1134 |
| 312 | Ga0500655_038637 | 3300053133 | Bacteria | 933 |
| 313 | Ga0500616_0028788 | 3300053153 | Bacteria | 3059 |
| 314 | Ga0500620_022905 | 3300053155 | Bacteria | 1887 |
| 315 | Ga0500624_001597 | 3300053157 | Bacteria | 3466 |
| 316 | Ga0500636_0130936 | 3300053177 | Bacteria | 1397 |
| 317 | Ga0500637_0004468 | 3300053178 | Bacteria | 6643 |
| 318 | Ga0500645_000461 | 3300053730 | Bacteria | 27834 |
| 319 | Ga0500596_000572 | 3300053735 | Bacteria | 7020 |
| 320 | Ga0587068_024715 | 3300059641 | Bacteria | 1008 |
| 321 | Ga0501082_0541861 | 3300060353 | Bacteria | 1018 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053088 | Ga0500644_0031944 | Ga0500644_0031944_863_1489 | 154 |
| 2 | 3300053093 | Ga0500651_0024969 | Ga0500651_0024969_2096_2722 | 154 |
| 3 | 3300046472 | Ga0495580_0510309 | Ga0495580_0510309_242_790 | 157 |
| 4 | 3300009551 | Ga0105238_11066579 | Ga0105238_110665791 | 164 |
| 5 | 3300009094 | Ga0111539_10037685 | Ga0111539_100376856 | 174 |
| 6 | 3300050511 | nmdc:mga08y16_143100_c1 | nmdc:mga08y16_143100_c1_1203_1805 | 174 |
| 7 | 3300005335 | Ga0070666_10112537 | Ga0070666_101125373 | 175 |
| 8 | 3300009551 | Ga0105238_10392484 | Ga0105238_103924842 | 175 |
| 9 | 3300046473 | Ga0495582_0130611 | Ga0495582_0130611_339_941 | 175 |
| 10 | 3300046559 | Ga0495667_0536243 | Ga0495667_0536243_31_633 | 175 |
| 11 | 3300046683 | Ga0495658_0001865 | Ga0495658_0001865_3971_4573 | 175 |
| 12 | 3300047471 | Ga0495684_0380467 | Ga0495684_0380467_146_748 | 175 |
| 13 | 3300009176 | Ga0105242_10226506 | Ga0105242_102265062 | 176 |
| 14 | 3300013308 | Ga0157375_10781085 | Ga0157375_107810852 | 176 |
| 15 | 3300025934 | Ga0207686_10335250 | Ga0207686_103352503 | 176 |
| 16 | 3300035112 | Ga0373932_0157149 | Ga0373932_0157149_46_651 | 176 |
| 17 | 3300035116 | Ga0373945_0009421 | Ga0373945_0009421_745_1347 | 176 |
| 18 | 3300035691 | Ga0373931_0022917 | Ga0373931_0022917_1391_1996 | 176 |
| 19 | 3300047320 | Ga0495672_0096043 | Ga0495672_0096043_907_1512 | 176 |
| 20 | 3300049578 | Ga0501042_0274558 | Ga0501042_0274558_313_918 | 176 |
| 21 | 3300049593 | Ga0501077_0315254 | Ga0501077_0315254_203_808 | 176 |
| 22 | 3300049824 | Ga0501045_0216316 | Ga0501045_0216316_25_630 | 176 |
| 23 | 3300060353 | Ga0501082_0541861 | Ga0501082_0541861_234_839 | 176 |
| 24 | 3300035083 | Ga0373926_0048986 | Ga0373926_0048986_217_822 | 177 |
| 25 | 3300035170 | Ga0373943_0076615 | Ga0373943_0076615_732_1337 | 177 |
| 26 | 3300035171 | Ga0373946_0052027 | Ga0373946_0052027_366_971 | 177 |
| 27 | 3300035692 | Ga0373935_0115028 | Ga0373935_0115028_913_1518 | 177 |
| 28 | 3300035725 | Ga0373947_0014960 | Ga0373947_0014960_3442_4047 | 177 |
| 29 | 3300036401 | Ga0373937_0183870 | Ga0373937_0183870_147_752 | 177 |
| 30 | 3300037068 | Ga0373925_0004691 | Ga0373925_0004691_7586_8191 | 177 |
| 31 | 3300010375 | Ga0105239_10928634 | Ga0105239_109286341 | 178 |
| 32 | iso_pu_bacteria | 2643221598 | 2644000280 | 178 |
| 33 | 3300005436 | Ga0070713_100693330 | Ga0070713_1006933301 | 179 |
| 34 | 3300027378 | Ga0209981_1000363 | Ga0209981_10003635 | 179 |
| 35 | 3300027665 | Ga0209983_1005457 | Ga0209983_10054574 | 179 |
| 36 | 3300035086 | Ga0373934_0130048 | Ga0373934_0130048_270_869 | 179 |
| 37 | 3300036401 | Ga0373937_0015228 | Ga0373937_0015228_2772_3371 | 179 |
| 38 | 3300044712 | Ga0453684_0018305 | Ga0453684_0018305_176_784 | 179 |
| 39 | 3300049569 | Ga0501032_0329670 | Ga0501032_0329670_225_854 | 179 |
| 40 | 3300053103 | Ga0500555_111683 | Ga0500555_111683_50_664 | 179 |
| 41 | iso_pu_bacteria | 2643221614 | 2644084956 | 179 |
| 42 | iso_pu_bacteria | 2643221661 | 2644342508 | 179 |
| 43 | iso_pu_bacteria | 2643221666 | 2644365808 | 179 |
| 44 | 3300009093 | Ga0105240_10302496 | Ga0105240_103024962 | 180 |
| 45 | 3300025913 | Ga0207695_10041800 | Ga0207695_100418003 | 180 |
| 46 | 3300049573 | Ga0501037_0027718 | Ga0501037_0027718_3117_3728 | 180 |
| 47 | 3300049574 | Ga0501038_0065716 | Ga0501038_0065716_1054_1665 | 180 |
| 48 | 3300049823 | Ga0501044_0136565 | Ga0501044_0136565_1692_2303 | 180 |
| 49 | 3300003781 | Ga0055536_1011155 | Ga0055536_10111556 | 181 |
| 50 | 3300003794 | Ga0055531_10010557 | Ga0055531_100105576 | 181 |
| 51 | 3300005617 | Ga0068859_100369650 | Ga0068859_1003696503 | 181 |
| 52 | 3300025292 | Ga0209676_1000661 | Ga0209676_100066150 | 181 |
| 53 | 3300025298 | Ga0209050_1011611 | Ga0209050_10116116 | 181 |
| 54 | 3300025304 | Ga0209257_1000178 | Ga0209257_100017867 | 181 |
| 55 | 3300031090 | Ga0265760_10062473 | Ga0265760_100624732 | 181 |
| 56 | 3300031250 | Ga0265331_10000003 | Ga0265331_1000000393 | 181 |
| 57 | 3300031711 | Ga0265314_10009937 | Ga0265314_100099375 | 181 |
| 58 | 3300031901 | Ga0307406_10009719 | Ga0307406_100097193 | 181 |
| 59 | 3300031911 | Ga0307412_10064412 | Ga0307412_100644122 | 181 |
| 60 | 3300049571 | Ga0501034_0013786 | Ga0501034_0013786_1292_1903 | 181 |
| 61 | 3300005331 | Ga0070670_100112035 | Ga0070670_1001120353 | 182 |
| 62 | 3300005347 | Ga0070668_100232122 | Ga0070668_1002321222 | 182 |
| 63 | 3300005843 | Ga0068860_100554471 | Ga0068860_1005544712 | 182 |
| 64 | 3300005844 | Ga0068862_100287634 | Ga0068862_1002876342 | 182 |
| 65 | 3300009553 | Ga0105249_10258525 | Ga0105249_102585251 | 182 |
| 66 | 3300015262 | Ga0182007_10028896 | Ga0182007_100288961 | 182 |
| 67 | 3300025961 | Ga0207712_10327932 | Ga0207712_103279322 | 182 |
| 68 | 3300053119 | Ga0500595_002565 | Ga0500595_002565_3687_4316 | 182 |
| 69 | 3300053122 | Ga0500608_002327 | Ga0500608_002327_226_855 | 182 |
| 70 | 3300009177 | Ga0105248_10311043 | Ga0105248_103110433 | 183 |
| 71 | 3300025941 | Ga0207711_10095087 | Ga0207711_100950874 | 183 |
| 72 | 3300042439 | Ga0439464_0060424 | Ga0439464_0060424_319_933 | 183 |
| 73 | 3300046557 | Ga0495622_0002680 | Ga0495622_0002680_3803_4432 | 183 |
| 74 | 3300048918 | Ga0496115_0485019 | Ga0496115_0485019_222_833 | 183 |
| 75 | 3300048925 | Ga0496122_0000042 | Ga0496122_0000042_226092_226706 | 183 |
| 76 | 3300048926 | Ga0496123_0000030 | Ga0496123_0000030_65054_65668 | 183 |
| 77 | 3300048927 | Ga0496124_0082760 | Ga0496124_0082760_707_1321 | 183 |
| 78 | 3300005262 | Ga0065165_1005863 | Ga0065165_10058634 | 184 |
| 79 | 3300005347 | Ga0070668_100026974 | Ga0070668_1000269744 | 184 |
| 80 | 3300005347 | Ga0070668_100086236 | Ga0070668_1000862362 | 184 |
| 81 | 3300005366 | Ga0070659_100005185 | Ga0070659_1000051859 | 184 |
| 82 | 3300005367 | Ga0070667_100034345 | Ga0070667_1000343455 | 184 |
| 83 | 3300005436 | Ga0070713_101369887 | Ga0070713_1013698871 | 184 |
| 84 | 3300005539 | Ga0068853_100417664 | Ga0068853_1004176642 | 184 |
| 85 | 3300005564 | Ga0070664_100211893 | Ga0070664_1002118933 | 184 |
| 86 | 3300005617 | Ga0068859_100306844 | Ga0068859_1003068443 | 184 |
| 87 | 3300005719 | Ga0068861_100103460 | Ga0068861_1001034604 | 184 |
| 88 | 3300005719 | Ga0068861_100571253 | Ga0068861_1005712532 | 184 |
| 89 | 3300005841 | Ga0068863_100689823 | Ga0068863_1006898232 | 184 |
| 90 | 3300005843 | Ga0068860_100001231 | Ga0068860_1000012312 | 184 |
| 91 | 3300005843 | Ga0068860_100696538 | Ga0068860_1006965382 | 184 |
| 92 | 3300005844 | Ga0068862_100246177 | Ga0068862_1002461772 | 184 |
| 93 | 3300005844 | Ga0068862_100407938 | Ga0068862_1004079382 | 184 |
| 94 | 3300006931 | Ga0097620_100306853 | Ga0097620_1003068533 | 184 |
| 95 | 3300009093 | Ga0105240_10176644 | Ga0105240_101766443 | 184 |
| 96 | 3300013100 | Ga0157373_10578756 | Ga0157373_105787562 | 184 |
| 97 | 3300013308 | Ga0157375_10516382 | Ga0157375_105163821 | 184 |
| 98 | 3300021384 | Ga0213876_10122458 | Ga0213876_101224582 | 184 |
| 99 | 3300025932 | Ga0207690_10018241 | Ga0207690_100182414 | 184 |
| 100 | 3300025937 | Ga0207669_10280815 | Ga0207669_102808153 | 184 |
| 101 | 3300025945 | Ga0207679_10173665 | Ga0207679_101736653 | 184 |
| 102 | 3300025972 | Ga0207668_10008338 | Ga0207668_100083384 | 184 |
| 103 | 3300025972 | Ga0207668_10014125 | Ga0207668_100141253 | 184 |
| 104 | 3300025972 | Ga0207668_10034024 | Ga0207668_100340244 | 184 |
| 105 | 3300025986 | Ga0207658_10085986 | Ga0207658_100859863 | 184 |
| 106 | 3300026041 | Ga0207639_10040418 | Ga0207639_100404184 | 184 |
| 107 | 3300026088 | Ga0207641_10750200 | Ga0207641_107502002 | 184 |
| 108 | 3300026095 | Ga0207676_10060769 | Ga0207676_100607693 | 184 |
| 109 | 3300026118 | Ga0207675_100144246 | Ga0207675_1001442464 | 184 |
| 110 | 3300028380 | Ga0268265_10009872 | Ga0268265_100098725 | 184 |
| 111 | 3300028380 | Ga0268265_10098207 | Ga0268265_100982074 | 184 |
| 112 | 3300028380 | Ga0268265_10201876 | Ga0268265_102018763 | 184 |
| 113 | 3300028381 | Ga0268264_10000046 | Ga0268264_10000046191 | 184 |
| 114 | 3300028381 | Ga0268264_10197711 | Ga0268264_101977112 | 184 |
| 115 | 3300031251 | Ga0265327_10000602 | Ga0265327_100006029 | 184 |
| 116 | 3300031548 | Ga0307408_100828742 | Ga0307408_1008287421 | 184 |
| 117 | 3300031730 | Ga0307516_10000352 | Ga0307516_1000035246 | 184 |
| 118 | 3300031903 | Ga0307407_10338348 | Ga0307407_103383482 | 184 |
| 119 | 3300032126 | Ga0307415_100887268 | Ga0307415_1008872682 | 184 |
| 120 | 3300036401 | Ga0373937_0239342 | Ga0373937_0239342_900_1520 | 184 |
| 121 | 3300036401 | Ga0373937_0614315 | Ga0373937_0614315_198_812 | 184 |
| 122 | 3300039437 | Ga0436365_1788617 | Ga0436365_1788617_1978_2592 | 184 |
| 123 | 3300049571 | Ga0501034_0161171 | Ga0501034_0161171_824_1438 | 184 |
| 124 | 3300049581 | Ga0501047_0557057 | Ga0501047_0557057_168_782 | 184 |
| 125 | 3300049686 | Ga0501257_005630 | Ga0501257_005630_342_956 | 184 |
| 126 | 3300053096 | Ga0500641_0000885 | Ga0500641_0000885_1892_2506 | 184 |
| 127 | 3300053103 | Ga0500555_094573 | Ga0500555_094573_106_720 | 184 |
| 128 | 3300053119 | Ga0500595_052271 | Ga0500595_052271_594_1208 | 184 |
| 129 | 3300059641 | Ga0587068_024715 | Ga0587068_024715_294_908 | 184 |
| 130 | 3300021384 | Ga0213876_10026910 | Ga0213876_100269103 | 185 |
| 131 | 3300021384 | Ga0213876_10223215 | Ga0213876_102232152 | 185 |
| 132 | 3300028800 | Ga0265338_10093250 | Ga0265338_100932503 | 185 |
| 133 | 3300033180 | Ga0307510_10199059 | Ga0307510_101990593 | 185 |
| 134 | 3300037471 | Ga0395905_0295542 | Ga0395905_0295542_336_956 | 185 |
| 135 | 3300039437 | Ga0436365_0233899 | Ga0436365_0233899_547_1164 | 185 |
| 136 | 3300039437 | Ga0436365_1802241 | Ga0436365_1802241_1085_1705 | 185 |
| 137 | 3300046616 | Ga0495668_0226228 | Ga0495668_0226228_224_847 | 185 |
| 138 | 3300053087 | Ga0500643_018019 | Ga0500643_018019_1393_2016 | 185 |
| 139 | 3300053104 | Ga0500556_0001909 | Ga0500556_0001909_6535_7158 | 185 |
| 140 | 3300053108 | Ga0500562_004279 | Ga0500562_004279_1261_1884 | 185 |
| 141 | 3300053153 | Ga0500616_0028788 | Ga0500616_0028788_1101_1724 | 185 |
| 142 | 3300053730 | Ga0500645_000461 | Ga0500645_000461_1204_1827 | 185 |
| 143 | 3300005366 | Ga0070659_100000373 | Ga0070659_10000037331 | 186 |
| 144 | 3300005548 | Ga0070665_100152839 | Ga0070665_1001528394 | 186 |
| 145 | 3300005563 | Ga0068855_100274760 | Ga0068855_1002747603 | 186 |
| 146 | 3300005841 | Ga0068863_100000007 | Ga0068863_100000007224 | 186 |
| 147 | 3300006028 | Ga0070717_10912974 | Ga0070717_109129742 | 186 |
| 148 | 3300006042 | Ga0075368_10019529 | Ga0075368_100195293 | 186 |
| 149 | 3300006048 | Ga0075363_100026023 | Ga0075363_1000260233 | 186 |
| 150 | 3300006051 | Ga0075364_10000935 | Ga0075364_1000093513 | 186 |
| 151 | 3300006178 | Ga0075367_10030784 | Ga0075367_100307843 | 186 |
| 152 | 3300009092 | Ga0105250_10002835 | Ga0105250_100028356 | 186 |
| 153 | 3300009093 | Ga0105240_10630336 | Ga0105240_106303362 | 186 |
| 154 | 3300009101 | Ga0105247_10228903 | Ga0105247_102289032 | 186 |
| 155 | 3300009177 | Ga0105248_10137419 | Ga0105248_101374193 | 186 |
| 156 | 3300009545 | Ga0105237_10383014 | Ga0105237_103830143 | 186 |
| 157 | 3300009545 | Ga0105237_10683854 | Ga0105237_106838542 | 186 |
| 158 | 3300009551 | Ga0105238_10887853 | Ga0105238_108878532 | 186 |
| 159 | 3300009553 | Ga0105249_11390534 | Ga0105249_113905341 | 186 |
| 160 | 3300010375 | Ga0105239_10249411 | Ga0105239_102494113 | 186 |
| 161 | 3300013307 | Ga0157372_10619051 | Ga0157372_106190511 | 186 |
| 162 | 3300014325 | Ga0163163_10715813 | Ga0163163_107158132 | 186 |
| 163 | 3300014968 | Ga0157379_10040158 | Ga0157379_100401584 | 186 |
| 164 | 3300025711 | Ga0207696_1017989 | Ga0207696_10179894 | 186 |
| 165 | 3300025903 | Ga0207680_10122119 | Ga0207680_101221192 | 186 |
| 166 | 3300025913 | Ga0207695_10039184 | Ga0207695_100391845 | 186 |
| 167 | 3300025914 | Ga0207671_10177249 | Ga0207671_101772492 | 186 |
| 168 | 3300025924 | Ga0207694_10234082 | Ga0207694_102340823 | 186 |
| 169 | 3300025932 | Ga0207690_10000053 | Ga0207690_1000005385 | 186 |
| 170 | 3300025941 | Ga0207711_10001604 | Ga0207711_1000160417 | 186 |
| 171 | 3300025941 | Ga0207711_10153964 | Ga0207711_101539642 | 186 |
| 172 | 3300025949 | Ga0207667_10727066 | Ga0207667_107270662 | 186 |
| 173 | 3300026035 | Ga0207703_10000038 | Ga0207703_1000003824 | 186 |
| 174 | 3300026041 | Ga0207639_10942299 | Ga0207639_109422991 | 186 |
| 175 | 3300026088 | Ga0207641_10000012 | Ga0207641_1000001285 | 186 |
| 176 | 3300026088 | Ga0207641_10366768 | Ga0207641_103667682 | 186 |
| 177 | 3300026095 | Ga0207676_10000179 | Ga0207676_100001796 | 186 |
| 178 | 3300027866 | Ga0209813_10002977 | Ga0209813_100029775 | 186 |
| 179 | 3300028379 | Ga0268266_10042668 | Ga0268266_100426684 | 186 |
| 180 | 3300028786 | Ga0307517_10223018 | Ga0307517_102230182 | 186 |
| 181 | 3300037068 | Ga0373925_0456434 | Ga0373925_0456434_186_806 | 186 |
| 182 | 3300037312 | Ga0395899_0000167 | Ga0395899_0000167_51128_51748 | 186 |
| 183 | 3300037312 | Ga0395899_0426596 | Ga0395899_0426596_156_782 | 186 |
| 184 | 3300037418 | Ga0395900_0000009 | Ga0395900_0000009_354630_355250 | 186 |
| 185 | 3300037418 | Ga0395900_0040733 | Ga0395900_0040733_3749_4375 | 186 |
| 186 | 3300037418 | Ga0395900_0144666 | Ga0395900_0144666_290_916 | 186 |
| 187 | 3300037466 | Ga0395898_0010159 | Ga0395898_0010159_1491_2111 | 186 |
| 188 | 3300037466 | Ga0395898_0625123 | Ga0395898_0625123_34_660 | 186 |
| 189 | 3300037471 | Ga0395905_0007899 | Ga0395905_0007899_5585_6211 | 186 |
| 190 | 3300037471 | Ga0395905_0016127 | Ga0395905_0016127_3382_4002 | 186 |
| 191 | 3300037471 | Ga0395905_0692464 | Ga0395905_0692464_186_812 | 186 |
| 192 | 3300037853 | Ga0436364_1059231 | Ga0436364_1059231_1047_1667 | 186 |
| 193 | 3300038443 | Ga0395901_0000014 | Ga0395901_0000014_305836_306456 | 186 |
| 194 | 3300038443 | Ga0395901_0379858 | Ga0395901_0379858_795_1421 | 186 |
| 195 | 3300039437 | Ga0436365_0809060 | Ga0436365_0809060_558_1178 | 186 |
| 196 | 3300044735 | Ga0466968_0029329 | Ga0466968_0029329_1543_2163 | 186 |
| 197 | 3300046492 | Ga0495585_0076021 | Ga0495585_0076021_436_1056 | 186 |
| 198 | 3300046535 | Ga0495586_0182410 | Ga0495586_0182410_363_992 | 186 |
| 199 | 3300050491 | nmdc:mga00v17_322_c1 | nmdc:mga00v17_322_c1_9097_9717 | 186 |
| 200 | 3300050493 | nmdc:mga0k408_7843_c1 | nmdc:mga0k408_7843_c1_4402_5022 | 186 |
| 201 | 3300050494 | nmdc:mga06z11_75640_c1 | nmdc:mga06z11_75640_c1_180_800 | 186 |
| 202 | 3300050495 | nmdc:mga04h51_136941_c1 | nmdc:mga04h51_136941_c1_118_738 | 186 |
| 203 | 3300053083 | Ga0495655_0023359 | Ga0495655_0023359_297_923 | 186 |
| 204 | 3300053104 | Ga0500556_0029947 | Ga0500556_0029947_402_1022 | 186 |
| 205 | 3300053108 | Ga0500562_001070 | Ga0500562_001070_1332_1952 | 186 |
| 206 | 3300053130 | Ga0500642_0140126 | Ga0500642_0140126_428_1048 | 186 |
| 207 | 3300005327 | Ga0070658_10022471 | Ga0070658_100224714 | 187 |
| 208 | 3300005327 | Ga0070658_10067361 | Ga0070658_100673614 | 187 |
| 209 | 3300005327 | Ga0070658_10396270 | Ga0070658_103962701 | 187 |
| 210 | 3300005327 | Ga0070658_10654400 | Ga0070658_106544001 | 187 |
| 211 | 3300005329 | Ga0070683_100757055 | Ga0070683_1007570551 | 187 |
| 212 | 3300005336 | Ga0070680_100002884 | Ga0070680_10000288410 | 187 |
| 213 | 3300005336 | Ga0070680_100234977 | Ga0070680_1002349771 | 187 |
| 214 | 3300005338 | Ga0068868_100169328 | Ga0068868_1001693283 | 187 |
| 215 | 3300005339 | Ga0070660_100083509 | Ga0070660_1000835092 | 187 |
| 216 | 3300005341 | Ga0070691_10055171 | Ga0070691_100551714 | 187 |
| 217 | 3300005344 | Ga0070661_100442119 | Ga0070661_1004421191 | 187 |
| 218 | 3300005355 | Ga0070671_100279990 | Ga0070671_1002799903 | 187 |
| 219 | 3300005364 | Ga0070673_100184680 | Ga0070673_1001846803 | 187 |
| 220 | 3300005366 | Ga0070659_100012608 | Ga0070659_1000126083 | 187 |
| 221 | 3300005458 | Ga0070681_10020073 | Ga0070681_100200735 | 187 |
| 222 | 3300005458 | Ga0070681_10262347 | Ga0070681_102623473 | 187 |
| 223 | 3300005530 | Ga0070679_100006911 | Ga0070679_1000069116 | 187 |
| 224 | 3300005530 | Ga0070679_100104915 | Ga0070679_1001049153 | 187 |
| 225 | 3300005535 | Ga0070684_101103240 | Ga0070684_1011032401 | 187 |
| 226 | 3300005539 | Ga0068853_100030979 | Ga0068853_1000309795 | 187 |
| 227 | 3300005563 | Ga0068855_100056818 | Ga0068855_1000568185 | 187 |
| 228 | 3300005563 | Ga0068855_100182680 | Ga0068855_1001826803 | 187 |
| 229 | 3300005563 | Ga0068855_100653955 | Ga0068855_1006539552 | 187 |
| 230 | 3300005577 | Ga0068857_100663637 | Ga0068857_1006636372 | 187 |
| 231 | 3300005614 | Ga0068856_100514880 | Ga0068856_1005148802 | 187 |
| 232 | 3300005618 | Ga0068864_100073787 | Ga0068864_1000737873 | 187 |
| 233 | 3300005841 | Ga0068863_100153556 | Ga0068863_1001535562 | 187 |
| 234 | 3300009093 | Ga0105240_10021216 | Ga0105240_100212164 | 187 |
| 235 | 3300009093 | Ga0105240_10039815 | Ga0105240_100398154 | 187 |
| 236 | 3300009093 | Ga0105240_10258157 | Ga0105240_102581572 | 187 |
| 237 | 3300009177 | Ga0105248_11392326 | Ga0105248_113923261 | 187 |
| 238 | 3300009551 | Ga0105238_10161506 | Ga0105238_101615062 | 187 |
| 239 | 3300009551 | Ga0105238_10304722 | Ga0105238_103047222 | 187 |
| 240 | 3300010375 | Ga0105239_10416758 | Ga0105239_104167583 | 187 |
| 241 | 3300013100 | Ga0157373_10262696 | Ga0157373_102626963 | 187 |
| 242 | 3300013105 | Ga0157369_11105296 | Ga0157369_111052961 | 187 |
| 243 | 3300013308 | Ga0157375_10088786 | Ga0157375_100887863 | 187 |
| 244 | 3300025909 | Ga0207705_10001414 | Ga0207705_100014149 | 187 |
| 245 | 3300025909 | Ga0207705_10158307 | Ga0207705_101583072 | 187 |
| 246 | 3300025909 | Ga0207705_10490695 | Ga0207705_104906952 | 187 |
| 247 | 3300025912 | Ga0207707_10115807 | Ga0207707_101158073 | 187 |
| 248 | 3300025912 | Ga0207707_10152706 | Ga0207707_101527063 | 187 |
| 249 | 3300025912 | Ga0207707_10154227 | Ga0207707_101542272 | 187 |
| 250 | 3300025913 | Ga0207695_10000718 | Ga0207695_1000071857 | 187 |
| 251 | 3300025913 | Ga0207695_10001195 | Ga0207695_1000119517 | 187 |
| 252 | 3300025913 | Ga0207695_10003313 | Ga0207695_100033139 | 187 |
| 253 | 3300025913 | Ga0207695_10070044 | Ga0207695_100700443 | 187 |
| 254 | 3300025917 | Ga0207660_10003153 | Ga0207660_100031538 | 187 |
| 255 | 3300025917 | Ga0207660_10386527 | Ga0207660_103865272 | 187 |
| 256 | 3300025919 | Ga0207657_10013040 | Ga0207657_100130409 | 187 |
| 257 | 3300025921 | Ga0207652_10003865 | Ga0207652_1000386510 | 187 |
| 258 | 3300025921 | Ga0207652_10583549 | Ga0207652_105835492 | 187 |
| 259 | 3300025924 | Ga0207694_10051471 | Ga0207694_100514714 | 187 |
| 260 | 3300025924 | Ga0207694_10528525 | Ga0207694_105285252 | 187 |
| 261 | 3300025932 | Ga0207690_10060380 | Ga0207690_100603803 | 187 |
| 262 | 3300025949 | Ga0207667_10007334 | Ga0207667_100073345 | 187 |
| 263 | 3300025949 | Ga0207667_10055637 | Ga0207667_100556374 | 187 |
| 264 | 3300025949 | Ga0207667_10103701 | Ga0207667_101037015 | 187 |
| 265 | 3300026023 | Ga0207677_10099646 | Ga0207677_100996463 | 187 |
| 266 | 3300026035 | Ga0207703_10457869 | Ga0207703_104578692 | 187 |
| 267 | 3300026041 | Ga0207639_10027910 | Ga0207639_100279105 | 187 |
| 268 | 3300026041 | Ga0207639_10529057 | Ga0207639_105290572 | 187 |
| 269 | 3300026067 | Ga0207678_10105839 | Ga0207678_101058392 | 187 |
| 270 | 3300026078 | Ga0207702_10514055 | Ga0207702_105140552 | 187 |
| 271 | 3300026116 | Ga0207674_10605858 | Ga0207674_106058581 | 187 |
| 272 | 3300026142 | Ga0207698_10421261 | Ga0207698_104212613 | 187 |
| 273 | 3300028379 | Ga0268266_10000064 | Ga0268266_10000064233 | 187 |
| 274 | 3300028786 | Ga0307517_10006007 | Ga0307517_1000600716 | 187 |
| 275 | 3300031456 | Ga0307513_10005748 | Ga0307513_100057481 | 187 |
| 276 | 3300031456 | Ga0307513_10014216 | Ga0307513_100142167 | 187 |
| 277 | 3300033180 | Ga0307510_10101264 | Ga0307510_101012643 | 187 |
| 278 | 3300035171 | Ga0373946_0168202 | Ga0373946_0168202_271_900 | 187 |
| 279 | 3300035692 | Ga0373935_0146548 | Ga0373935_0146548_628_1257 | 187 |
| 280 | 3300035695 | Ga0373927_0000323 | Ga0373927_0000323_36138_36767 | 187 |
| 281 | 3300037068 | Ga0373925_0000061 | Ga0373925_0000061_60028_60657 | 187 |
| 282 | 3300037418 | Ga0395900_0780201 | Ga0395900_0780201_151_780 | 187 |
| 283 | 3300037466 | Ga0395898_0194739 | Ga0395898_0194739_553_1182 | 187 |
| 284 | 3300044765 | Ga0466970_0218814 | Ga0466970_0218814_183_812 | 187 |
| 285 | 3300045836 | Ga0466958_0247977 | Ga0466958_0247977_357_986 | 187 |
| 286 | 3300046515 | Ga0495620_0035021 | Ga0495620_0035021_1579_2208 | 187 |
| 287 | 3300046522 | Ga0495643_0006211 | Ga0495643_0006211_2153_2782 | 187 |
| 288 | 3300046528 | Ga0495642_0011778 | Ga0495642_0011778_1138_1767 | 187 |
| 289 | 3300046538 | Ga0495609_0010190 | Ga0495609_0010190_2422_3051 | 187 |
| 290 | 3300046539 | Ga0495621_0110499 | Ga0495621_0110499_31_660 | 187 |
| 291 | 3300046616 | Ga0495668_0052746 | Ga0495668_0052746_505_1134 | 187 |
| 292 | 3300046648 | Ga0495611_0250756 | Ga0495611_0250756_17_646 | 187 |
| 293 | 3300046660 | Ga0495625_0184661 | Ga0495625_0184661_489_1118 | 187 |
| 294 | 3300048903 | Ga0496100_0214031 | Ga0496100_0214031_345_974 | 187 |
| 295 | 3300048904 | Ga0496101_0056988 | Ga0496101_0056988_208_837 | 187 |
| 296 | 3300048915 | Ga0496112_0044480 | Ga0496112_0044480_401_1030 | 187 |
| 297 | 3300048918 | Ga0496115_0007769 | Ga0496115_0007769_162_863 | 187 |
| 298 | 3300048918 | Ga0496115_0050813 | Ga0496115_0050813_1674_2300 | 187 |
| 299 | 3300048918 | Ga0496115_0081396 | Ga0496115_0081396_528_1157 | 187 |
| 300 | 3300049742 | Ga0501080_0545309 | Ga0501080_0545309_292_915 | 187 |
| 301 | 3300053080 | Ga0500635_0000489 | Ga0500635_0000489_10060_10689 | 187 |
| 302 | 3300053086 | Ga0500578_0149265 | Ga0500578_0149265_813_1442 | 187 |
| 303 | 3300053091 | Ga0500647_0088346 | Ga0500647_0088346_339_968 | 187 |
| 304 | 3300053093 | Ga0500651_0034610 | Ga0500651_0034610_1552_2181 | 187 |
| 305 | 3300053115 | Ga0500591_102879 | Ga0500591_102879_164_793 | 187 |
| 306 | 3300053121 | Ga0500607_064120 | Ga0500607_064120_641_1270 | 187 |
| 307 | 3300053123 | Ga0500614_002843 | Ga0500614_002843_1622_2251 | 187 |
| 308 | 3300053133 | Ga0500655_038637 | Ga0500655_038637_277_906 | 187 |
| 309 | 3300053155 | Ga0500620_022905 | Ga0500620_022905_766_1395 | 187 |
| 310 | 3300053157 | Ga0500624_001597 | Ga0500624_001597_2597_3226 | 187 |
| 311 | 3300053177 | Ga0500636_0130936 | Ga0500636_0130936_723_1352 | 187 |
| 312 | 3300053178 | Ga0500637_0004468 | Ga0500637_0004468_4707_5336 | 187 |
| 313 | 3300053735 | Ga0500596_000572 | Ga0500596_000572_1777_2406 | 187 |
| 314 | 3300003215 | JGI25153J46596_10059006 | JGI25153J46596_100590061 | 188 |
| 315 | 3300005335 | Ga0070666_10024927 | Ga0070666_100249274 | 188 |
| 316 | 3300005842 | Ga0068858_100479335 | Ga0068858_1004793352 | 188 |
| 317 | 3300006048 | Ga0075363_100106870 | Ga0075363_1001068703 | 188 |
| 318 | 3300006177 | Ga0075362_10055421 | Ga0075362_100554214 | 188 |
| 319 | 3300009177 | Ga0105248_11089867 | Ga0105248_110898672 | 188 |
| 320 | 3300009177 | Ga0105248_11392324 | Ga0105248_113923241 | 188 |
| 321 | 3300014968 | Ga0157379_10855222 | Ga0157379_108552222 | 188 |
| 322 | 3300025903 | Ga0207680_10223805 | Ga0207680_102238052 | 188 |
| 323 | 3300041997 | Ga0439431_0019354 | Ga0439431_0019354_338_961 | 188 |
| 324 | 3300047472 | Ga0495686_0011256 | Ga0495686_0011256_1258_1881 | 188 |
| 325 | 3300049823 | Ga0501044_0506502 | Ga0501044_0506502_202_828 | 188 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar