F407875

General Info

Members Datasets Scaffolds Average Seq Length
325 209 321 186

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_10008338|Ga0207668_100083384
Length 221
Sequence MCFEWSFDPLMALPAIAFYVLAVVTVASALAVVSARNPVHSVLFLILSFFSAAGLFVLLGAEFLAMLDVDFTALRQGFARYMPLGGLVAGVLAIEMIVVSASVATNGAAGKNDAPFVATDVTNAESIGRVLYTDYVYFFQAAGLVLLVAMIGAIVLTLRHKPGVRRQVIADQVARNPRTGMRVVSIKPGEGIGEPSFAEATEGRLTANQSGGSVLRSSEGA

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
181 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
184 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
185 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
186 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
187 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
188 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
192 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
193 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
194 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
195 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
196 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
197 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
198 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
199 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
200 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
201 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
202 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
203 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
206 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
207 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
208 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 0.62
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.46
Nodule 0
Rhizoplane 2.15
Rhizosphere 76.62
Stem 0
Stem Tuber 0
Unclassified 6.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10059006 3300003215 Bacteria 1053
2 Ga0055536_1011155 3300003781 Bacteria 3484
3 Ga0055531_10010557 3300003794 Bacteria 4572
4 Ga0065165_1005863 3300005262 Bacteria 6679
5 Ga0070658_10022471 3300005327 Bacteria 5062
6 Ga0070658_10067361 3300005327 Bacteria 2925
7 Ga0070658_10396270 3300005327 Bacteria 1185
8 Ga0070658_10654400 3300005327 Bacteria 911
9 Ga0070683_100757055 3300005329 Bacteria 931
10 Ga0070670_100112035 3300005331 Bacteria 2351
11 Ga0070666_10024927 3300005335 Bacteria 3899
12 Ga0070666_10112537 3300005335 Bacteria 1883
13 Ga0070680_100002884 3300005336 Bacteria 12785
14 Ga0070680_100234977 3300005336 Bacteria 1548
15 Ga0068868_100169328 3300005338 Bacteria 1808
16 Ga0070660_100083509 3300005339 Bacteria 2509
17 Ga0070691_10055171 3300005341 Bacteria 1903
18 Ga0070661_100442119 3300005344 Bacteria 1033
19 Ga0070668_100026974 3300005347 Bacteria 4360
20 Ga0070668_100086236 3300005347 Bacteria 2468
21 Ga0070668_100232122 3300005347 Bacteria 1526
22 Ga0070671_100279990 3300005355 Bacteria 1418
23 Ga0070673_100184680 3300005364 Bacteria 1787
24 Ga0070659_100000373 3300005366 Bacteria 33795
25 Ga0070659_100005185 3300005366 Bacteria 9354
26 Ga0070659_100012608 3300005366 Bacteria 6268
27 Ga0070667_100034345 3300005367 Bacteria 4243
28 Ga0070713_100693330 3300005436 Bacteria 972
29 Ga0070713_101369887 3300005436 Bacteria 686
30 Ga0070681_10020073 3300005458 Bacteria 6696
31 Ga0070681_10262347 3300005458 Bacteria 1639
32 Ga0070679_100006911 3300005530 Bacteria 10585
33 Ga0070679_100104915 3300005530 Bacteria 2812
34 Ga0070684_101103240 3300005535 Bacteria 746
35 Ga0068853_100030979 3300005539 Bacteria 4521
36 Ga0068853_100417664 3300005539 Bacteria 1257
37 Ga0070665_100152839 3300005548 Bacteria 2311
38 Ga0068855_100056818 3300005563 Bacteria 4589
39 Ga0068855_100182680 3300005563 Bacteria 2370
40 Ga0068855_100274760 3300005563 Bacteria 1873
41 Ga0068855_100653955 3300005563 Bacteria 1128
42 Ga0070664_100211893 3300005564 Bacteria 1732
43 Ga0068857_100663637 3300005577 Bacteria 989
44 Ga0068856_100514880 3300005614 Bacteria 1218
45 Ga0068859_100306844 3300005617 Bacteria 1680
46 Ga0068859_100369650 3300005617 Bacteria 1529
47 Ga0068864_100073787 3300005618 Bacteria 2975
48 Ga0068861_100103460 3300005719 Bacteria 2269
49 Ga0068861_100571253 3300005719 Bacteria 1033
50 Ga0068863_100000007 3300005841 Bacteria 257578
51 Ga0068863_100153556 3300005841 Bacteria 2203
52 Ga0068863_100689823 3300005841 Bacteria 1015
53 Ga0068858_100479335 3300005842 Bacteria 1201
54 Ga0068860_100001231 3300005843 Bacteria 27931
55 Ga0068860_100554471 3300005843 Bacteria 1152
56 Ga0068860_100696538 3300005843 Bacteria 1025
57 Ga0068862_100246177 3300005844 Bacteria 1628
58 Ga0068862_100287634 3300005844 Bacteria 1508
59 Ga0068862_100407938 3300005844 Bacteria 1272
60 Ga0070717_10912974 3300006028 Bacteria 799
61 Ga0075368_10019529 3300006042 Bacteria 2559
62 Ga0075363_100026023 3300006048 Bacteria 2990
63 Ga0075363_100106870 3300006048 Bacteria 1552
64 Ga0075364_10000935 3300006051 Bacteria 15418
65 Ga0075362_10055421 3300006177 Bacteria 1783
66 Ga0075367_10030784 3300006178 Bacteria 3079
67 Ga0097620_100306853 3300006931 Bacteria 1680
68 Ga0105250_10002835 3300009092 Bacteria 8495
69 Ga0105240_10021216 3300009093 Bacteria 8646
70 Ga0105240_10039815 3300009093 Bacteria 6016
71 Ga0105240_10176644 3300009093 Bacteria 2524
72 Ga0105240_10258157 3300009093 Bacteria 2012
73 Ga0105240_10302496 3300009093 Bacteria 1829
74 Ga0105240_10630336 3300009093 Bacteria 1177
75 Ga0111539_10037685 3300009094 Bacteria 5837
76 Ga0105247_10228903 3300009101 Bacteria 1261
77 Ga0105242_10226506 3300009176 Bacteria 1673
78 Ga0105248_10137419 3300009177 Bacteria 2757
79 Ga0105248_10311043 3300009177 Bacteria 1774
80 Ga0105248_11089867 3300009177 Bacteria 903
81 Ga0105248_11392324 3300009177 Bacteria 793
82 Ga0105248_11392326 3300009177 Bacteria 793
83 Ga0105237_10383014 3300009545 Bacteria 1411
84 Ga0105237_10683854 3300009545 Bacteria 1033
85 Ga0105238_10161506 3300009551 Bacteria 2216
86 Ga0105238_10304722 3300009551 Bacteria 1577
87 Ga0105238_10392484 3300009551 Bacteria 1380
88 Ga0105238_10887853 3300009551 Bacteria 909
89 Ga0105238_11066579 3300009551 Bacteria 830
90 Ga0105249_10258525 3300009553 Bacteria 1729
91 Ga0105249_11390534 3300009553 Bacteria 774
92 Ga0105239_10249411 3300010375 Bacteria 1994
93 Ga0105239_10416758 3300010375 Bacteria 1521
94 Ga0105239_10928634 3300010375 Bacteria 999
95 Ga0157373_10262696 3300013100 Bacteria 1222
96 Ga0157373_10578756 3300013100 Bacteria 816
97 Ga0157369_11105296 3300013105 Bacteria 810
98 Ga0157372_10619051 3300013307 Bacteria 1262
99 Ga0157375_10088786 3300013308 Bacteria 3146
100 Ga0157375_10516382 3300013308 Bacteria 1358
101 Ga0157375_10781085 3300013308 Bacteria 1105
102 Ga0163163_10715813 3300014325 Bacteria 1065
103 Ga0157379_10040158 3300014968 Bacteria 4175
104 Ga0157379_10855222 3300014968 Bacteria 861
105 Ga0182007_10028896 3300015262 Bacteria 1901
106 Ga0213876_10026910 3300021384 Bacteria 3035
107 Ga0213876_10122458 3300021384 Bacteria 1381
108 Ga0213876_10223215 3300021384 Bacteria 1002
109 Ga0209676_1000661 3300025292 Bacteria 49370
110 Ga0209050_1011611 3300025298 Bacteria 4150
111 Ga0209257_1000178 3300025304 Bacteria 160969
112 Ga0207696_1017989 3300025711 Bacteria 2329
113 Ga0207680_10122119 3300025903 Bacteria 1705
114 Ga0207680_10223805 3300025903 Bacteria 1291
115 Ga0207705_10001414 3300025909 Bacteria 19120
116 Ga0207705_10158307 3300025909 Bacteria 1700
117 Ga0207705_10490695 3300025909 Bacteria 954
118 Ga0207707_10115807 3300025912 Bacteria 2342
119 Ga0207707_10152706 3300025912 Bacteria 2019
120 Ga0207707_10154227 3300025912 Bacteria 2008
121 Ga0207695_10000718 3300025913 Bacteria 64451
122 Ga0207695_10001195 3300025913 Bacteria 44633
123 Ga0207695_10003313 3300025913 Bacteria 22832
124 Ga0207695_10039184 3300025913 Bacteria 5095
125 Ga0207695_10041800 3300025913 Bacteria 4904
126 Ga0207695_10070044 3300025913 Bacteria 3587
127 Ga0207671_10177249 3300025914 Bacteria 1657
128 Ga0207660_10003153 3300025917 Bacteria 10795
129 Ga0207660_10386527 3300025917 Bacteria 1125
130 Ga0207657_10013040 3300025919 Bacteria 8168
131 Ga0207652_10003865 3300025921 Bacteria 12269
132 Ga0207652_10583549 3300025921 Bacteria 1003
133 Ga0207694_10051471 3300025924 Bacteria 3192
134 Ga0207694_10234082 3300025924 Bacteria 1500
135 Ga0207694_10528525 3300025924 Bacteria 989
136 Ga0207690_10000053 3300025932 Bacteria 105125
137 Ga0207690_10018241 3300025932 Bacteria 4303
138 Ga0207690_10060380 3300025932 Bacteria 2573
139 Ga0207686_10335250 3300025934 Bacteria 1134
140 Ga0207669_10280815 3300025937 Bacteria 1256
141 Ga0207711_10001604 3300025941 Bacteria 20913
142 Ga0207711_10095087 3300025941 Bacteria 2627
143 Ga0207711_10153964 3300025941 Bacteria 2076
144 Ga0207679_10173665 3300025945 Bacteria 1777
145 Ga0207667_10007334 3300025949 Bacteria 13274
146 Ga0207667_10055637 3300025949 Bacteria 4159
147 Ga0207667_10103701 3300025949 Bacteria 2933
148 Ga0207667_10727066 3300025949 Bacteria 993
149 Ga0207712_10327932 3300025961 Bacteria 1265
150 Ga0207668_10008338 3300025972 Bacteria 6171
151 Ga0207668_10014125 3300025972 Bacteria 4938
152 Ga0207668_10034024 3300025972 Bacteria 3380
153 Ga0207658_10085986 3300025986 Bacteria 2423
154 Ga0207677_10099646 3300026023 Bacteria 2134
155 Ga0207703_10000038 3300026035 Bacteria 175917
156 Ga0207703_10457869 3300026035 Bacteria 1192
157 Ga0207639_10027910 3300026041 Bacteria 4116
158 Ga0207639_10040418 3300026041 Bacteria 3481
159 Ga0207639_10529057 3300026041 Bacteria 1080
160 Ga0207639_10942299 3300026041 Bacteria 808
161 Ga0207678_10105839 3300026067 Bacteria 2400
162 Ga0207702_10514055 3300026078 Bacteria 1168
163 Ga0207641_10000012 3300026088 Bacteria 375486
164 Ga0207641_10366768 3300026088 Bacteria 1376
165 Ga0207641_10750200 3300026088 Bacteria 963
166 Ga0207676_10000179 3300026095 Bacteria 55697
167 Ga0207676_10060769 3300026095 Bacteria 2990
168 Ga0207674_10605858 3300026116 Bacteria 1058
169 Ga0207675_100144246 3300026118 Bacteria 2263
170 Ga0207698_10421261 3300026142 Bacteria 1281
171 Ga0209981_1000363 3300027378 Bacteria 5788
172 Ga0209983_1005457 3300027665 Bacteria 2634
173 Ga0209813_10002977 3300027866 Bacteria 3924
174 Ga0268266_10000064 3300028379 Bacteria 249533
175 Ga0268266_10042668 3300028379 Bacteria 3875
176 Ga0268265_10009872 3300028380 Bacteria 6448
177 Ga0268265_10098207 3300028380 Bacteria 2358
178 Ga0268265_10201876 3300028380 Bacteria 1725
179 Ga0268264_10000046 3300028381 Bacteria 364597
180 Ga0268264_10197711 3300028381 Bacteria 1837
181 Ga0307517_10006007 3300028786 Bacteria 18094
182 Ga0307517_10223018 3300028786 Bacteria 1143
183 Ga0265338_10093250 3300028800 Bacteria 2481
184 Ga0265760_10062473 3300031090 Bacteria 1133
185 Ga0265331_10000003 3300031250 Bacteria 499358
186 Ga0265327_10000602 3300031251 Bacteria 59632
187 Ga0307513_10005748 3300031456 Bacteria 16317
188 Ga0307513_10014216 3300031456 Bacteria 9734
189 Ga0307408_100828742 3300031548 Bacteria 842
190 Ga0265314_10009937 3300031711 Bacteria 7978
191 Ga0307516_10000352 3300031730 Bacteria 59644
192 Ga0307406_10009719 3300031901 Bacteria 5408
193 Ga0307407_10338348 3300031903 Bacteria 1062
194 Ga0307412_10064412 3300031911 Bacteria 2477
195 Ga0307415_100887268 3300032126 Bacteria 821
196 Ga0307510_10101264 3300033180 Bacteria 2669
197 Ga0307510_10199059 3300033180 Bacteria 1541
198 Ga0373926_0048986 3300035083 Bacteria 1521
199 Ga0373934_0130048 3300035086 Bacteria 1027
200 Ga0373932_0157149 3300035112 Bacteria 784
201 Ga0373945_0009421 3300035116 Bacteria 3200
202 Ga0373943_0076615 3300035170 Bacteria 1706
203 Ga0373946_0052027 3300035171 Bacteria 1716
204 Ga0373946_0168202 3300035171 Bacteria 1033
205 Ga0373931_0022917 3300035691 Bacteria 3147
206 Ga0373935_0115028 3300035692 Bacteria 1790
207 Ga0373935_0146548 3300035692 Bacteria 1599
208 Ga0373927_0000323 3300035695 Bacteria 37618
209 Ga0373947_0014960 3300035725 Bacteria 4454
210 Ga0373937_0015228 3300036401 Bacteria 6798
211 Ga0373937_0183870 3300036401 Bacteria 1963
212 Ga0373937_0239342 3300036401 Bacteria 1710
213 Ga0373937_0614315 3300036401 Bacteria 1032
214 Ga0373925_0000061 3300037068 Bacteria 117783
215 Ga0373925_0004691 3300037068 Bacteria 10312
216 Ga0373925_0456434 3300037068 Bacteria 1047
217 Ga0395899_0000167 3300037312 Bacteria 100973
218 Ga0395899_0426596 3300037312 Bacteria 873
219 Ga0395900_0000009 3300037418 Bacteria 476249
220 Ga0395900_0040733 3300037418 Bacteria 4787
221 Ga0395900_0144666 3300037418 Bacteria 2432
222 Ga0395900_0780201 3300037418 Bacteria 884
223 Ga0395898_0010159 3300037466 Bacteria 9850
224 Ga0395898_0194739 3300037466 Bacteria 1936
225 Ga0395898_0625123 3300037466 Bacteria 1019
226 Ga0395905_0007899 3300037471 Bacteria 10523
227 Ga0395905_0016127 3300037471 Bacteria 7102
228 Ga0395905_0295542 3300037471 Bacteria 1507
229 Ga0395905_0692464 3300037471 Bacteria 921
230 Ga0436364_1059231 3300037853 Bacteria 2540
231 Ga0395901_0000014 3300038443 Bacteria 375100
232 Ga0395901_0379858 3300038443 Bacteria 1454
233 Ga0436365_0233899 3300039437 Bacteria 1236
234 Ga0436365_0809060 3300039437 Bacteria 1210
235 Ga0436365_1788617 3300039437 Bacteria 2803
236 Ga0436365_1802241 3300039437 Bacteria 3059
237 Ga0439431_0019354 3300041997 Bacteria 1618
238 Ga0439464_0060424 3300042439 Bacteria 1109
239 Ga0453684_0018305 3300044712 Bacteria 10766
240 Ga0466968_0029329 3300044735 Bacteria 2275
241 Ga0466970_0218814 3300044765 Bacteria 1063
242 Ga0466958_0247977 3300045836 Bacteria 1139
243 Ga0495580_0510309 3300046472 Bacteria 802
244 Ga0495582_0130611 3300046473 Bacteria 1419
245 Ga0495585_0076021 3300046492 Bacteria 1825
246 Ga0495620_0035021 3300046515 Bacteria 2263
247 Ga0495643_0006211 3300046522 Bacteria 7924
248 Ga0495642_0011778 3300046528 Bacteria 3369
249 Ga0495586_0182410 3300046535 Bacteria 1188
250 Ga0495609_0010190 3300046538 Bacteria 4517
251 Ga0495621_0110499 3300046539 Bacteria 1054
252 Ga0495622_0002680 3300046557 Bacteria 8542
253 Ga0495667_0536243 3300046559 Bacteria 732
254 Ga0495668_0052746 3300046616 Bacteria 2250
255 Ga0495668_0226228 3300046616 Bacteria 1024
256 Ga0495611_0250756 3300046648 Bacteria 820
257 Ga0495625_0184661 3300046660 Bacteria 1384
258 Ga0495658_0001865 3300046683 Bacteria 10757
259 Ga0495672_0096043 3300047320 Bacteria 1617
260 Ga0495684_0380467 3300047471 Bacteria 996
261 Ga0495686_0011256 3300047472 Bacteria 6308
262 Ga0496100_0214031 3300048903 Bacteria 1411
263 Ga0496101_0056988 3300048904 Bacteria 2825
264 Ga0496112_0044480 3300048915 Bacteria 4351
265 Ga0496115_0007769 3300048918 Bacteria 7908
266 Ga0496115_0050813 3300048918 Bacteria 3323
267 Ga0496115_0081396 3300048918 Bacteria 2637
268 Ga0496115_0485019 3300048918 Bacteria 995
269 Ga0496122_0000042 3300048925 Bacteria 280482
270 Ga0496123_0000030 3300048926 Bacteria 291764
271 Ga0496124_0082760 3300048927 Bacteria 2634
272 Ga0501032_0329670 3300049569 Bacteria 984
273 Ga0501034_0013786 3300049571 Bacteria 8317
274 Ga0501034_0161171 3300049571 Bacteria 2214
275 Ga0501037_0027718 3300049573 Bacteria 4186
276 Ga0501038_0065716 3300049574 Bacteria 3090
277 Ga0501042_0274558 3300049578 Bacteria 1217
278 Ga0501047_0557057 3300049581 Bacteria 970
279 Ga0501077_0315254 3300049593 Bacteria 997
280 Ga0501257_005630 3300049686 Bacteria 2765
281 Ga0501080_0545309 3300049742 Bacteria 1033
282 Ga0501044_0136565 3300049823 Bacteria 2443
283 Ga0501044_0506502 3300049823 Bacteria 1108
284 Ga0501045_0216316 3300049824 Bacteria 1427
285 nmdc:mga00v17_322_c1 3300050491 Bacteria 27155
286 nmdc:mga0k408_7843_c1 3300050493 Bacteria 5709
287 nmdc:mga06z11_75640_c1 3300050494 Bacteria 1794
288 nmdc:mga04h51_136941_c1 3300050495 Bacteria 926
289 nmdc:mga08y16_143100_c1 3300050511 Bacteria 2486
290 Ga0500635_0000489 3300053080 Bacteria 11028
291 Ga0495655_0023359 3300053083 Bacteria 1425
292 Ga0500578_0149265 3300053086 Bacteria 1457
293 Ga0500643_018019 3300053087 Bacteria 2352
294 Ga0500644_0031944 3300053088 Bacteria 1678
295 Ga0500647_0088346 3300053091 Bacteria 1485
296 Ga0500651_0024969 3300053093 Bacteria 3749
297 Ga0500651_0034610 3300053093 Bacteria 3185
298 Ga0500641_0000885 3300053096 Bacteria 10715
299 Ga0500555_094573 3300053103 Bacteria 765
300 Ga0500555_111683 3300053103 Bacteria 688
301 Ga0500556_0001909 3300053104 Bacteria 7444
302 Ga0500556_0029947 3300053104 Bacteria 1840
303 Ga0500562_001070 3300053108 Bacteria 6729
304 Ga0500562_004279 3300053108 Bacteria 3613
305 Ga0500591_102879 3300053115 Bacteria 1217
306 Ga0500595_002565 3300053119 Bacteria 8893
307 Ga0500595_052271 3300053119 Bacteria 1262
308 Ga0500607_064120 3300053121 Bacteria 1914
309 Ga0500608_002327 3300053122 Bacteria 6895
310 Ga0500614_002843 3300053123 Bacteria 3803
311 Ga0500642_0140126 3300053130 Bacteria 1134
312 Ga0500655_038637 3300053133 Bacteria 933
313 Ga0500616_0028788 3300053153 Bacteria 3059
314 Ga0500620_022905 3300053155 Bacteria 1887
315 Ga0500624_001597 3300053157 Bacteria 3466
316 Ga0500636_0130936 3300053177 Bacteria 1397
317 Ga0500637_0004468 3300053178 Bacteria 6643
318 Ga0500645_000461 3300053730 Bacteria 27834
319 Ga0500596_000572 3300053735 Bacteria 7020
320 Ga0587068_024715 3300059641 Bacteria 1008
321 Ga0501082_0541861 3300060353 Bacteria 1018

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053088 Ga0500644_0031944 Ga0500644_0031944_863_1489 154
2 3300053093 Ga0500651_0024969 Ga0500651_0024969_2096_2722 154
3 3300046472 Ga0495580_0510309 Ga0495580_0510309_242_790 157
4 3300009551 Ga0105238_11066579 Ga0105238_110665791 164
5 3300009094 Ga0111539_10037685 Ga0111539_100376856 174
6 3300050511 nmdc:mga08y16_143100_c1 nmdc:mga08y16_143100_c1_1203_1805 174
7 3300005335 Ga0070666_10112537 Ga0070666_101125373 175
8 3300009551 Ga0105238_10392484 Ga0105238_103924842 175
9 3300046473 Ga0495582_0130611 Ga0495582_0130611_339_941 175
10 3300046559 Ga0495667_0536243 Ga0495667_0536243_31_633 175
11 3300046683 Ga0495658_0001865 Ga0495658_0001865_3971_4573 175
12 3300047471 Ga0495684_0380467 Ga0495684_0380467_146_748 175
13 3300009176 Ga0105242_10226506 Ga0105242_102265062 176
14 3300013308 Ga0157375_10781085 Ga0157375_107810852 176
15 3300025934 Ga0207686_10335250 Ga0207686_103352503 176
16 3300035112 Ga0373932_0157149 Ga0373932_0157149_46_651 176
17 3300035116 Ga0373945_0009421 Ga0373945_0009421_745_1347 176
18 3300035691 Ga0373931_0022917 Ga0373931_0022917_1391_1996 176
19 3300047320 Ga0495672_0096043 Ga0495672_0096043_907_1512 176
20 3300049578 Ga0501042_0274558 Ga0501042_0274558_313_918 176
21 3300049593 Ga0501077_0315254 Ga0501077_0315254_203_808 176
22 3300049824 Ga0501045_0216316 Ga0501045_0216316_25_630 176
23 3300060353 Ga0501082_0541861 Ga0501082_0541861_234_839 176
24 3300035083 Ga0373926_0048986 Ga0373926_0048986_217_822 177
25 3300035170 Ga0373943_0076615 Ga0373943_0076615_732_1337 177
26 3300035171 Ga0373946_0052027 Ga0373946_0052027_366_971 177
27 3300035692 Ga0373935_0115028 Ga0373935_0115028_913_1518 177
28 3300035725 Ga0373947_0014960 Ga0373947_0014960_3442_4047 177
29 3300036401 Ga0373937_0183870 Ga0373937_0183870_147_752 177
30 3300037068 Ga0373925_0004691 Ga0373925_0004691_7586_8191 177
31 3300010375 Ga0105239_10928634 Ga0105239_109286341 178
32 iso_pu_bacteria 2643221598 2644000280 178
33 3300005436 Ga0070713_100693330 Ga0070713_1006933301 179
34 3300027378 Ga0209981_1000363 Ga0209981_10003635 179
35 3300027665 Ga0209983_1005457 Ga0209983_10054574 179
36 3300035086 Ga0373934_0130048 Ga0373934_0130048_270_869 179
37 3300036401 Ga0373937_0015228 Ga0373937_0015228_2772_3371 179
38 3300044712 Ga0453684_0018305 Ga0453684_0018305_176_784 179
39 3300049569 Ga0501032_0329670 Ga0501032_0329670_225_854 179
40 3300053103 Ga0500555_111683 Ga0500555_111683_50_664 179
41 iso_pu_bacteria 2643221614 2644084956 179
42 iso_pu_bacteria 2643221661 2644342508 179
43 iso_pu_bacteria 2643221666 2644365808 179
44 3300009093 Ga0105240_10302496 Ga0105240_103024962 180
45 3300025913 Ga0207695_10041800 Ga0207695_100418003 180
46 3300049573 Ga0501037_0027718 Ga0501037_0027718_3117_3728 180
47 3300049574 Ga0501038_0065716 Ga0501038_0065716_1054_1665 180
48 3300049823 Ga0501044_0136565 Ga0501044_0136565_1692_2303 180
49 3300003781 Ga0055536_1011155 Ga0055536_10111556 181
50 3300003794 Ga0055531_10010557 Ga0055531_100105576 181
51 3300005617 Ga0068859_100369650 Ga0068859_1003696503 181
52 3300025292 Ga0209676_1000661 Ga0209676_100066150 181
53 3300025298 Ga0209050_1011611 Ga0209050_10116116 181
54 3300025304 Ga0209257_1000178 Ga0209257_100017867 181
55 3300031090 Ga0265760_10062473 Ga0265760_100624732 181
56 3300031250 Ga0265331_10000003 Ga0265331_1000000393 181
57 3300031711 Ga0265314_10009937 Ga0265314_100099375 181
58 3300031901 Ga0307406_10009719 Ga0307406_100097193 181
59 3300031911 Ga0307412_10064412 Ga0307412_100644122 181
60 3300049571 Ga0501034_0013786 Ga0501034_0013786_1292_1903 181
61 3300005331 Ga0070670_100112035 Ga0070670_1001120353 182
62 3300005347 Ga0070668_100232122 Ga0070668_1002321222 182
63 3300005843 Ga0068860_100554471 Ga0068860_1005544712 182
64 3300005844 Ga0068862_100287634 Ga0068862_1002876342 182
65 3300009553 Ga0105249_10258525 Ga0105249_102585251 182
66 3300015262 Ga0182007_10028896 Ga0182007_100288961 182
67 3300025961 Ga0207712_10327932 Ga0207712_103279322 182
68 3300053119 Ga0500595_002565 Ga0500595_002565_3687_4316 182
69 3300053122 Ga0500608_002327 Ga0500608_002327_226_855 182
70 3300009177 Ga0105248_10311043 Ga0105248_103110433 183
71 3300025941 Ga0207711_10095087 Ga0207711_100950874 183
72 3300042439 Ga0439464_0060424 Ga0439464_0060424_319_933 183
73 3300046557 Ga0495622_0002680 Ga0495622_0002680_3803_4432 183
74 3300048918 Ga0496115_0485019 Ga0496115_0485019_222_833 183
75 3300048925 Ga0496122_0000042 Ga0496122_0000042_226092_226706 183
76 3300048926 Ga0496123_0000030 Ga0496123_0000030_65054_65668 183
77 3300048927 Ga0496124_0082760 Ga0496124_0082760_707_1321 183
78 3300005262 Ga0065165_1005863 Ga0065165_10058634 184
79 3300005347 Ga0070668_100026974 Ga0070668_1000269744 184
80 3300005347 Ga0070668_100086236 Ga0070668_1000862362 184
81 3300005366 Ga0070659_100005185 Ga0070659_1000051859 184
82 3300005367 Ga0070667_100034345 Ga0070667_1000343455 184
83 3300005436 Ga0070713_101369887 Ga0070713_1013698871 184
84 3300005539 Ga0068853_100417664 Ga0068853_1004176642 184
85 3300005564 Ga0070664_100211893 Ga0070664_1002118933 184
86 3300005617 Ga0068859_100306844 Ga0068859_1003068443 184
87 3300005719 Ga0068861_100103460 Ga0068861_1001034604 184
88 3300005719 Ga0068861_100571253 Ga0068861_1005712532 184
89 3300005841 Ga0068863_100689823 Ga0068863_1006898232 184
90 3300005843 Ga0068860_100001231 Ga0068860_1000012312 184
91 3300005843 Ga0068860_100696538 Ga0068860_1006965382 184
92 3300005844 Ga0068862_100246177 Ga0068862_1002461772 184
93 3300005844 Ga0068862_100407938 Ga0068862_1004079382 184
94 3300006931 Ga0097620_100306853 Ga0097620_1003068533 184
95 3300009093 Ga0105240_10176644 Ga0105240_101766443 184
96 3300013100 Ga0157373_10578756 Ga0157373_105787562 184
97 3300013308 Ga0157375_10516382 Ga0157375_105163821 184
98 3300021384 Ga0213876_10122458 Ga0213876_101224582 184
99 3300025932 Ga0207690_10018241 Ga0207690_100182414 184
100 3300025937 Ga0207669_10280815 Ga0207669_102808153 184
101 3300025945 Ga0207679_10173665 Ga0207679_101736653 184
102 3300025972 Ga0207668_10008338 Ga0207668_100083384 184
103 3300025972 Ga0207668_10014125 Ga0207668_100141253 184
104 3300025972 Ga0207668_10034024 Ga0207668_100340244 184
105 3300025986 Ga0207658_10085986 Ga0207658_100859863 184
106 3300026041 Ga0207639_10040418 Ga0207639_100404184 184
107 3300026088 Ga0207641_10750200 Ga0207641_107502002 184
108 3300026095 Ga0207676_10060769 Ga0207676_100607693 184
109 3300026118 Ga0207675_100144246 Ga0207675_1001442464 184
110 3300028380 Ga0268265_10009872 Ga0268265_100098725 184
111 3300028380 Ga0268265_10098207 Ga0268265_100982074 184
112 3300028380 Ga0268265_10201876 Ga0268265_102018763 184
113 3300028381 Ga0268264_10000046 Ga0268264_10000046191 184
114 3300028381 Ga0268264_10197711 Ga0268264_101977112 184
115 3300031251 Ga0265327_10000602 Ga0265327_100006029 184
116 3300031548 Ga0307408_100828742 Ga0307408_1008287421 184
117 3300031730 Ga0307516_10000352 Ga0307516_1000035246 184
118 3300031903 Ga0307407_10338348 Ga0307407_103383482 184
119 3300032126 Ga0307415_100887268 Ga0307415_1008872682 184
120 3300036401 Ga0373937_0239342 Ga0373937_0239342_900_1520 184
121 3300036401 Ga0373937_0614315 Ga0373937_0614315_198_812 184
122 3300039437 Ga0436365_1788617 Ga0436365_1788617_1978_2592 184
123 3300049571 Ga0501034_0161171 Ga0501034_0161171_824_1438 184
124 3300049581 Ga0501047_0557057 Ga0501047_0557057_168_782 184
125 3300049686 Ga0501257_005630 Ga0501257_005630_342_956 184
126 3300053096 Ga0500641_0000885 Ga0500641_0000885_1892_2506 184
127 3300053103 Ga0500555_094573 Ga0500555_094573_106_720 184
128 3300053119 Ga0500595_052271 Ga0500595_052271_594_1208 184
129 3300059641 Ga0587068_024715 Ga0587068_024715_294_908 184
130 3300021384 Ga0213876_10026910 Ga0213876_100269103 185
131 3300021384 Ga0213876_10223215 Ga0213876_102232152 185
132 3300028800 Ga0265338_10093250 Ga0265338_100932503 185
133 3300033180 Ga0307510_10199059 Ga0307510_101990593 185
134 3300037471 Ga0395905_0295542 Ga0395905_0295542_336_956 185
135 3300039437 Ga0436365_0233899 Ga0436365_0233899_547_1164 185
136 3300039437 Ga0436365_1802241 Ga0436365_1802241_1085_1705 185
137 3300046616 Ga0495668_0226228 Ga0495668_0226228_224_847 185
138 3300053087 Ga0500643_018019 Ga0500643_018019_1393_2016 185
139 3300053104 Ga0500556_0001909 Ga0500556_0001909_6535_7158 185
140 3300053108 Ga0500562_004279 Ga0500562_004279_1261_1884 185
141 3300053153 Ga0500616_0028788 Ga0500616_0028788_1101_1724 185
142 3300053730 Ga0500645_000461 Ga0500645_000461_1204_1827 185
143 3300005366 Ga0070659_100000373 Ga0070659_10000037331 186
144 3300005548 Ga0070665_100152839 Ga0070665_1001528394 186
145 3300005563 Ga0068855_100274760 Ga0068855_1002747603 186
146 3300005841 Ga0068863_100000007 Ga0068863_100000007224 186
147 3300006028 Ga0070717_10912974 Ga0070717_109129742 186
148 3300006042 Ga0075368_10019529 Ga0075368_100195293 186
149 3300006048 Ga0075363_100026023 Ga0075363_1000260233 186
150 3300006051 Ga0075364_10000935 Ga0075364_1000093513 186
151 3300006178 Ga0075367_10030784 Ga0075367_100307843 186
152 3300009092 Ga0105250_10002835 Ga0105250_100028356 186
153 3300009093 Ga0105240_10630336 Ga0105240_106303362 186
154 3300009101 Ga0105247_10228903 Ga0105247_102289032 186
155 3300009177 Ga0105248_10137419 Ga0105248_101374193 186
156 3300009545 Ga0105237_10383014 Ga0105237_103830143 186
157 3300009545 Ga0105237_10683854 Ga0105237_106838542 186
158 3300009551 Ga0105238_10887853 Ga0105238_108878532 186
159 3300009553 Ga0105249_11390534 Ga0105249_113905341 186
160 3300010375 Ga0105239_10249411 Ga0105239_102494113 186
161 3300013307 Ga0157372_10619051 Ga0157372_106190511 186
162 3300014325 Ga0163163_10715813 Ga0163163_107158132 186
163 3300014968 Ga0157379_10040158 Ga0157379_100401584 186
164 3300025711 Ga0207696_1017989 Ga0207696_10179894 186
165 3300025903 Ga0207680_10122119 Ga0207680_101221192 186
166 3300025913 Ga0207695_10039184 Ga0207695_100391845 186
167 3300025914 Ga0207671_10177249 Ga0207671_101772492 186
168 3300025924 Ga0207694_10234082 Ga0207694_102340823 186
169 3300025932 Ga0207690_10000053 Ga0207690_1000005385 186
170 3300025941 Ga0207711_10001604 Ga0207711_1000160417 186
171 3300025941 Ga0207711_10153964 Ga0207711_101539642 186
172 3300025949 Ga0207667_10727066 Ga0207667_107270662 186
173 3300026035 Ga0207703_10000038 Ga0207703_1000003824 186
174 3300026041 Ga0207639_10942299 Ga0207639_109422991 186
175 3300026088 Ga0207641_10000012 Ga0207641_1000001285 186
176 3300026088 Ga0207641_10366768 Ga0207641_103667682 186
177 3300026095 Ga0207676_10000179 Ga0207676_100001796 186
178 3300027866 Ga0209813_10002977 Ga0209813_100029775 186
179 3300028379 Ga0268266_10042668 Ga0268266_100426684 186
180 3300028786 Ga0307517_10223018 Ga0307517_102230182 186
181 3300037068 Ga0373925_0456434 Ga0373925_0456434_186_806 186
182 3300037312 Ga0395899_0000167 Ga0395899_0000167_51128_51748 186
183 3300037312 Ga0395899_0426596 Ga0395899_0426596_156_782 186
184 3300037418 Ga0395900_0000009 Ga0395900_0000009_354630_355250 186
185 3300037418 Ga0395900_0040733 Ga0395900_0040733_3749_4375 186
186 3300037418 Ga0395900_0144666 Ga0395900_0144666_290_916 186
187 3300037466 Ga0395898_0010159 Ga0395898_0010159_1491_2111 186
188 3300037466 Ga0395898_0625123 Ga0395898_0625123_34_660 186
189 3300037471 Ga0395905_0007899 Ga0395905_0007899_5585_6211 186
190 3300037471 Ga0395905_0016127 Ga0395905_0016127_3382_4002 186
191 3300037471 Ga0395905_0692464 Ga0395905_0692464_186_812 186
192 3300037853 Ga0436364_1059231 Ga0436364_1059231_1047_1667 186
193 3300038443 Ga0395901_0000014 Ga0395901_0000014_305836_306456 186
194 3300038443 Ga0395901_0379858 Ga0395901_0379858_795_1421 186
195 3300039437 Ga0436365_0809060 Ga0436365_0809060_558_1178 186
196 3300044735 Ga0466968_0029329 Ga0466968_0029329_1543_2163 186
197 3300046492 Ga0495585_0076021 Ga0495585_0076021_436_1056 186
198 3300046535 Ga0495586_0182410 Ga0495586_0182410_363_992 186
199 3300050491 nmdc:mga00v17_322_c1 nmdc:mga00v17_322_c1_9097_9717 186
200 3300050493 nmdc:mga0k408_7843_c1 nmdc:mga0k408_7843_c1_4402_5022 186
201 3300050494 nmdc:mga06z11_75640_c1 nmdc:mga06z11_75640_c1_180_800 186
202 3300050495 nmdc:mga04h51_136941_c1 nmdc:mga04h51_136941_c1_118_738 186
203 3300053083 Ga0495655_0023359 Ga0495655_0023359_297_923 186
204 3300053104 Ga0500556_0029947 Ga0500556_0029947_402_1022 186
205 3300053108 Ga0500562_001070 Ga0500562_001070_1332_1952 186
206 3300053130 Ga0500642_0140126 Ga0500642_0140126_428_1048 186
207 3300005327 Ga0070658_10022471 Ga0070658_100224714 187
208 3300005327 Ga0070658_10067361 Ga0070658_100673614 187
209 3300005327 Ga0070658_10396270 Ga0070658_103962701 187
210 3300005327 Ga0070658_10654400 Ga0070658_106544001 187
211 3300005329 Ga0070683_100757055 Ga0070683_1007570551 187
212 3300005336 Ga0070680_100002884 Ga0070680_10000288410 187
213 3300005336 Ga0070680_100234977 Ga0070680_1002349771 187
214 3300005338 Ga0068868_100169328 Ga0068868_1001693283 187
215 3300005339 Ga0070660_100083509 Ga0070660_1000835092 187
216 3300005341 Ga0070691_10055171 Ga0070691_100551714 187
217 3300005344 Ga0070661_100442119 Ga0070661_1004421191 187
218 3300005355 Ga0070671_100279990 Ga0070671_1002799903 187
219 3300005364 Ga0070673_100184680 Ga0070673_1001846803 187
220 3300005366 Ga0070659_100012608 Ga0070659_1000126083 187
221 3300005458 Ga0070681_10020073 Ga0070681_100200735 187
222 3300005458 Ga0070681_10262347 Ga0070681_102623473 187
223 3300005530 Ga0070679_100006911 Ga0070679_1000069116 187
224 3300005530 Ga0070679_100104915 Ga0070679_1001049153 187
225 3300005535 Ga0070684_101103240 Ga0070684_1011032401 187
226 3300005539 Ga0068853_100030979 Ga0068853_1000309795 187
227 3300005563 Ga0068855_100056818 Ga0068855_1000568185 187
228 3300005563 Ga0068855_100182680 Ga0068855_1001826803 187
229 3300005563 Ga0068855_100653955 Ga0068855_1006539552 187
230 3300005577 Ga0068857_100663637 Ga0068857_1006636372 187
231 3300005614 Ga0068856_100514880 Ga0068856_1005148802 187
232 3300005618 Ga0068864_100073787 Ga0068864_1000737873 187
233 3300005841 Ga0068863_100153556 Ga0068863_1001535562 187
234 3300009093 Ga0105240_10021216 Ga0105240_100212164 187
235 3300009093 Ga0105240_10039815 Ga0105240_100398154 187
236 3300009093 Ga0105240_10258157 Ga0105240_102581572 187
237 3300009177 Ga0105248_11392326 Ga0105248_113923261 187
238 3300009551 Ga0105238_10161506 Ga0105238_101615062 187
239 3300009551 Ga0105238_10304722 Ga0105238_103047222 187
240 3300010375 Ga0105239_10416758 Ga0105239_104167583 187
241 3300013100 Ga0157373_10262696 Ga0157373_102626963 187
242 3300013105 Ga0157369_11105296 Ga0157369_111052961 187
243 3300013308 Ga0157375_10088786 Ga0157375_100887863 187
244 3300025909 Ga0207705_10001414 Ga0207705_100014149 187
245 3300025909 Ga0207705_10158307 Ga0207705_101583072 187
246 3300025909 Ga0207705_10490695 Ga0207705_104906952 187
247 3300025912 Ga0207707_10115807 Ga0207707_101158073 187
248 3300025912 Ga0207707_10152706 Ga0207707_101527063 187
249 3300025912 Ga0207707_10154227 Ga0207707_101542272 187
250 3300025913 Ga0207695_10000718 Ga0207695_1000071857 187
251 3300025913 Ga0207695_10001195 Ga0207695_1000119517 187
252 3300025913 Ga0207695_10003313 Ga0207695_100033139 187
253 3300025913 Ga0207695_10070044 Ga0207695_100700443 187
254 3300025917 Ga0207660_10003153 Ga0207660_100031538 187
255 3300025917 Ga0207660_10386527 Ga0207660_103865272 187
256 3300025919 Ga0207657_10013040 Ga0207657_100130409 187
257 3300025921 Ga0207652_10003865 Ga0207652_1000386510 187
258 3300025921 Ga0207652_10583549 Ga0207652_105835492 187
259 3300025924 Ga0207694_10051471 Ga0207694_100514714 187
260 3300025924 Ga0207694_10528525 Ga0207694_105285252 187
261 3300025932 Ga0207690_10060380 Ga0207690_100603803 187
262 3300025949 Ga0207667_10007334 Ga0207667_100073345 187
263 3300025949 Ga0207667_10055637 Ga0207667_100556374 187
264 3300025949 Ga0207667_10103701 Ga0207667_101037015 187
265 3300026023 Ga0207677_10099646 Ga0207677_100996463 187
266 3300026035 Ga0207703_10457869 Ga0207703_104578692 187
267 3300026041 Ga0207639_10027910 Ga0207639_100279105 187
268 3300026041 Ga0207639_10529057 Ga0207639_105290572 187
269 3300026067 Ga0207678_10105839 Ga0207678_101058392 187
270 3300026078 Ga0207702_10514055 Ga0207702_105140552 187
271 3300026116 Ga0207674_10605858 Ga0207674_106058581 187
272 3300026142 Ga0207698_10421261 Ga0207698_104212613 187
273 3300028379 Ga0268266_10000064 Ga0268266_10000064233 187
274 3300028786 Ga0307517_10006007 Ga0307517_1000600716 187
275 3300031456 Ga0307513_10005748 Ga0307513_100057481 187
276 3300031456 Ga0307513_10014216 Ga0307513_100142167 187
277 3300033180 Ga0307510_10101264 Ga0307510_101012643 187
278 3300035171 Ga0373946_0168202 Ga0373946_0168202_271_900 187
279 3300035692 Ga0373935_0146548 Ga0373935_0146548_628_1257 187
280 3300035695 Ga0373927_0000323 Ga0373927_0000323_36138_36767 187
281 3300037068 Ga0373925_0000061 Ga0373925_0000061_60028_60657 187
282 3300037418 Ga0395900_0780201 Ga0395900_0780201_151_780 187
283 3300037466 Ga0395898_0194739 Ga0395898_0194739_553_1182 187
284 3300044765 Ga0466970_0218814 Ga0466970_0218814_183_812 187
285 3300045836 Ga0466958_0247977 Ga0466958_0247977_357_986 187
286 3300046515 Ga0495620_0035021 Ga0495620_0035021_1579_2208 187
287 3300046522 Ga0495643_0006211 Ga0495643_0006211_2153_2782 187
288 3300046528 Ga0495642_0011778 Ga0495642_0011778_1138_1767 187
289 3300046538 Ga0495609_0010190 Ga0495609_0010190_2422_3051 187
290 3300046539 Ga0495621_0110499 Ga0495621_0110499_31_660 187
291 3300046616 Ga0495668_0052746 Ga0495668_0052746_505_1134 187
292 3300046648 Ga0495611_0250756 Ga0495611_0250756_17_646 187
293 3300046660 Ga0495625_0184661 Ga0495625_0184661_489_1118 187
294 3300048903 Ga0496100_0214031 Ga0496100_0214031_345_974 187
295 3300048904 Ga0496101_0056988 Ga0496101_0056988_208_837 187
296 3300048915 Ga0496112_0044480 Ga0496112_0044480_401_1030 187
297 3300048918 Ga0496115_0007769 Ga0496115_0007769_162_863 187
298 3300048918 Ga0496115_0050813 Ga0496115_0050813_1674_2300 187
299 3300048918 Ga0496115_0081396 Ga0496115_0081396_528_1157 187
300 3300049742 Ga0501080_0545309 Ga0501080_0545309_292_915 187
301 3300053080 Ga0500635_0000489 Ga0500635_0000489_10060_10689 187
302 3300053086 Ga0500578_0149265 Ga0500578_0149265_813_1442 187
303 3300053091 Ga0500647_0088346 Ga0500647_0088346_339_968 187
304 3300053093 Ga0500651_0034610 Ga0500651_0034610_1552_2181 187
305 3300053115 Ga0500591_102879 Ga0500591_102879_164_793 187
306 3300053121 Ga0500607_064120 Ga0500607_064120_641_1270 187
307 3300053123 Ga0500614_002843 Ga0500614_002843_1622_2251 187
308 3300053133 Ga0500655_038637 Ga0500655_038637_277_906 187
309 3300053155 Ga0500620_022905 Ga0500620_022905_766_1395 187
310 3300053157 Ga0500624_001597 Ga0500624_001597_2597_3226 187
311 3300053177 Ga0500636_0130936 Ga0500636_0130936_723_1352 187
312 3300053178 Ga0500637_0004468 Ga0500637_0004468_4707_5336 187
313 3300053735 Ga0500596_000572 Ga0500596_000572_1777_2406 187
314 3300003215 JGI25153J46596_10059006 JGI25153J46596_100590061 188
315 3300005335 Ga0070666_10024927 Ga0070666_100249274 188
316 3300005842 Ga0068858_100479335 Ga0068858_1004793352 188
317 3300006048 Ga0075363_100106870 Ga0075363_1001068703 188
318 3300006177 Ga0075362_10055421 Ga0075362_100554214 188
319 3300009177 Ga0105248_11089867 Ga0105248_110898672 188
320 3300009177 Ga0105248_11392324 Ga0105248_113923241 188
321 3300014968 Ga0157379_10855222 Ga0157379_108552222 188
322 3300025903 Ga0207680_10223805 Ga0207680_102238052 188
323 3300041997 Ga0439431_0019354 Ga0439431_0019354_338_961 188
324 3300047472 Ga0495686_0011256 Ga0495686_0011256_1258_1881 188
325 3300049823 Ga0501044_0506502 Ga0501044_0506502_202_828 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

28

69

0.96

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

72

156

0.78

Feature Viewer

pLDDT pTM Quality
77.62 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map