F407837

General Info

Members Datasets Scaffolds Average Seq Length
325 207 293 108

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10000025|Ga0182008_1000002575
Length 112
Sequence VIGGSFTLILQKKIMNWIILIIAGLFEVGFTTCLKLSNNFTNLKWSLAYFLNKATQTLPMGTAYAVWTGIGAVGTVMVGIVCFQEPANFWRIFFIVTLIGSILGLKFFAGSH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
7 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
8 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
9 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
10 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
11 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
12 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
13 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
14 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
15 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
16 2738541284 Pedobacter sp. YR016 Isolate Unclassified
17 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
18 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
19 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
20 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
21 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
22 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
23 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
24 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
25 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
26 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
27 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
28 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
29 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
30 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
31 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
32 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
33 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
34 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
35 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
69 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
124 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
143 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
144 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
145 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
146 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
147 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
148 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
184 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
185 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
186 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
187 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
188 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
189 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
192 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
193 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
194 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
197 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
198 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
201 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
202 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
203 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
204 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
205 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.54
Metatranscriptomes 0.31
Isolates 10.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.62
Bulb 0
Endosphere 12
Nodule 1.54
Rhizoplane 1.23
Rhizosphere 67.69
Stem 0
Stem Tuber 0
Unclassified 16.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663468 2162886007 Bacteria 272152
2 SwRhRL2b_contig_1985813 2162886007 Bacteria 998
3 SwRhRL2b_contig_236177 2162886007 Bacteria 1761
4 SwRhRL2b_contig_3757853 2162886007 Bacteria 16541
5 JGI25157J39369_1004497 3300002741 Bacteria 2506
6 rootH2_10015343 3300003320 Bacteria 7553
7 rootH2_10064779 3300003320 Bacteria 2946
8 rootH2_10169384 3300003320 Unclassified 1054
9 rootH2_10254400 3300003320 Bacteria 2412
10 rootL2_10002205 3300003322 Bacteria 6251
11 rootH1_10005480 3300003316 Bacteria 9779
12 rootH1_10005480 3300003323 Bacteria 11389
13 rootH1_10097937 3300003323 Bacteria 4220
14 JGI25160J50197_1000831 3300003354 Bacteria 16491
15 JGI25160J50197_1001335 3300003354 Bacteria 12446
16 JGI25160J50197_1067975 3300003354 Bacteria 688
17 Ga0055528_1001659 3300003790 Bacteria 13038
18 Ga0055528_1002049 3300003790 Bacteria 11265
19 Ga0055530_10012562 3300003791 Bacteria 2943
20 Ga0055531_10067731 3300003794 Unclassified 838
21 Ga0065165_1000038 3300005262 Bacteria 211664
22 Ga0065714_10002231 3300005288 Bacteria 44866
23 Ga0065714_10005940 3300005288 Bacteria 8737
24 Ga0065704_10000218 3300005289 Bacteria 76484
25 Ga0065704_10071407 3300005289 Bacteria 11313
26 Ga0065704_10075750 3300005289 Bacteria 5437
27 Ga0065704_10080857 3300005289 Bacteria 3867
28 Ga0070658_10326730 3300005327 Bacteria 1310
29 Ga0070683_100022440 3300005329 Bacteria 5642
30 Ga0070682_100000206 3300005337 Bacteria 43560
31 Ga0070682_100181673 3300005337 Bacteria 1470
32 Ga0070682_100211004 3300005337 Bacteria 1376
33 Ga0070660_100273931 3300005339 Bacteria 1380
34 Ga0070668_100090314 3300005347 Bacteria 2413
35 Ga0070659_100441754 3300005366 Unclassified 1102
36 Ga0070659_101596880 3300005366 Bacteria 582
37 Ga0070667_101289137 3300005367 Unclassified 684
38 Ga0070667_101605193 3300005367 Bacteria 611
39 Ga0070711_100246085 3300005439 Bacteria 1400
40 Ga0070663_100452230 3300005455 Bacteria 1059
41 Ga0070678_101255192 3300005456 Bacteria 688
42 Ga0068867_100744907 3300005459 Bacteria 869
43 Ga0070684_100050020 3300005535 Bacteria 3629
44 Ga0068853_100161242 3300005539 Bacteria 2024
45 Ga0070665_101248575 3300005548 Bacteria 753
46 Ga0068855_100095412 3300005563 Bacteria 3428
47 Ga0068855_100116173 3300005563 Bacteria 3067
48 Ga0068857_100003021 3300005577 Bacteria 13897
49 Ga0068857_100205849 3300005577 Bacteria 1795
50 Ga0068857_100518246 3300005577 Bacteria 1120
51 Ga0068857_100536706 3300005577 Bacteria 1101
52 Ga0068854_100036563 3300005578 Bacteria 3444
53 Ga0068854_100634808 3300005578 Bacteria 915
54 Ga0068856_100059007 3300005614 Bacteria 3790
55 Ga0068856_100143210 3300005614 Bacteria 2398
56 Ga0068852_100019464 3300005616 Bacteria 5373
57 Ga0068852_100272926 3300005616 Bacteria 1628
58 Ga0068851_10000104 3300005834 Bacteria 45630
59 Ga0070716_100115607 3300006173 Unclassified 1670
60 Ga0075366_10006071 3300006195 Bacteria 6583
61 Ga0075366_10329288 3300006195 Bacteria 936
62 Ga0079104_1000005 3300006946 Bacteria 407099
63 Ga0099826_10001059 3300006948 Bacteria 15569
64 Ga0105251_10050420 3300009011 Bacteria 1988
65 Ga0105244_10000114 3300009036 Bacteria 84368
66 Ga0105244_10219259 3300009036 Bacteria 892
67 Ga0105250_10070513 3300009092 Bacteria 1411
68 Ga0105240_10001190 3300009093 Bacteria 45471
69 Ga0105240_10050314 3300009093 Bacteria 5254
70 Ga0105240_10278458 3300009093 Unclassified 1923
71 Ga0105243_10000043 3300009148 Bacteria 158809
72 Ga0105243_10001230 3300009148 Bacteria 23083
73 Ga0105241_10038358 3300009174 Bacteria 3611
74 Ga0105241_12501172 3300009174 Bacteria 517
75 Ga0105237_10030153 3300009545 Bacteria 5511
76 Ga0105237_10041755 3300009545 Bacteria 4625
77 Ga0105237_10378884 3300009545 Unclassified 1419
78 Ga0105238_10013926 3300009551 Bacteria 8133
79 Ga0105238_10040719 3300009551 Bacteria 4708
80 Ga0105239_10161775 3300010375 Unclassified 2501
81 Ga0105239_11644662 3300010375 Bacteria 743
82 Ga0105239_12256665 3300010375 Bacteria 633
83 Ga0157323_1033669 3300012495 Unclassified 556
84 Ga0157373_10000002 3300013100 Bacteria 750094
85 Ga0157373_10000167 3300013100 Bacteria 53611
86 Ga0157373_10023444 3300013100 Bacteria 4474
87 Ga0157373_10335748 3300013100 Bacteria 1076
88 Ga0157373_10712011 3300013100 Unclassified 736
89 Ga0157371_10000019 3300013102 Bacteria 307914
90 Ga0157371_10009312 3300013102 Bacteria 7742
91 Ga0157371_10036644 3300013102 Bacteria 3512
92 Ga0157371_10314459 3300013102 Bacteria 1136
93 Ga0157370_10000222 3300013104 Bacteria 72506
94 Ga0157370_10000399 3300013104 Bacteria 54642
95 Ga0157370_10007094 3300013104 Bacteria 12240
96 Ga0157370_10007164 3300013104 Bacteria 12165
97 Ga0157370_10034455 3300013104 Bacteria 4929
98 Ga0157370_10760367 3300013104 Bacteria 883
99 Ga0157369_10002091 3300013105 Bacteria 24135
100 Ga0157369_10009719 3300013105 Bacteria 11001
101 Ga0157369_11806201 3300013105 Bacteria 621
102 Ga0157378_10270658 3300013297 Bacteria 1634
103 Ga0157372_10004157 3300013307 Bacteria 15490
104 Ga0157372_10008046 3300013307 Bacteria 11212
105 Ga0157372_10653561 3300013307 Bacteria 1224
106 Ga0157372_11038751 3300013307 Bacteria 949
107 Ga0157375_10000846 3300013308 Bacteria 26697
108 Ga0157375_10023023 3300013308 Bacteria 5741
109 Ga0182008_10000025 3300014497 Bacteria 191222
110 Ga0182006_1000011 3300015261 Bacteria 408647
111 Ga0182006_1003760 3300015261 Bacteria 7661
112 Ga0182006_1004356 3300015261 Bacteria 6998
113 Ga0182006_1029884 3300015261 Bacteria 2206
114 Ga0182006_1048568 3300015261 Bacteria 1641
115 Ga0182006_1057522 3300015261 Bacteria 1478
116 Ga0182006_1074212 3300015261 Bacteria 1254
117 Ga0163161_10725543 3300017792 Bacteria 829
118 Ga0213876_10016258 3300021384 Unclassified 3933
119 Ga0207425_1012556 3300025245 Bacteria 1983
120 Ga0209646_1000003 3300025246 Bacteria 1160860
121 Ga0209026_1000202 3300025250 Bacteria 82517
122 Ga0209129_1011889 3300025258 Bacteria 2045
123 Ga0209673_1000123 3300025273 Bacteria 169208
124 Ga0209675_1000032 3300025291 Bacteria 273013
125 Ga0209564_1000705 3300025295 Bacteria 48887
126 Ga0209564_1002197 3300025295 Bacteria 16308
127 Ga0209758_1002624 3300025297 Bacteria 17871
128 Ga0209758_1004422 3300025297 Bacteria 11706
129 Ga0209758_1124170 3300025297 Bacteria 692
130 Ga0209050_1000692 3300025298 Bacteria 50268
131 Ga0207426_1000364 3300025302 Bacteria 80671
132 Ga0207426_1001365 3300025302 Bacteria 20691
133 Ga0207426_1135939 3300025302 Bacteria 590
134 Ga0209257_1000064 3300025304 Bacteria 356803
135 Ga0209257_1010858 3300025304 Bacteria 4507
136 Ga0207656_10000149 3300025321 Bacteria 25828
137 Ga0207696_1065604 3300025711 Bacteria 1015
138 Ga0207655_1000631 3300025728 Bacteria 42239
139 Ga0207647_10064609 3300025904 Bacteria 2223
140 Ga0207705_10115969 3300025909 Bacteria 1983
141 Ga0207654_10071802 3300025911 Bacteria 2059
142 Ga0207695_10280570 3300025913 Bacteria 1560
143 Ga0207695_10810987 3300025913 Bacteria 816
144 Ga0207671_10241285 3300025914 Unclassified 1419
145 Ga0207663_10320959 3300025916 Bacteria 1164
146 Ga0207694_10068459 3300025924 Bacteria 2772
147 Ga0207694_10926026 3300025924 Unclassified 737
148 Ga0207690_10233630 3300025932 Unclassified 1413
149 Ga0207709_10000021 3300025935 Bacteria 386722
150 Ga0207709_10000992 3300025935 Bacteria 21129
151 Ga0207661_10004950 3300025944 Bacteria 9342
152 Ga0207667_10008002 3300025949 Bacteria 12613
153 Ga0207667_10081934 3300025949 Bacteria 3343
154 Ga0207667_10161819 3300025949 Bacteria 2302
155 Ga0207668_10078764 3300025972 Bacteria 2381
156 Ga0207640_10097729 3300025981 Bacteria 2051
157 Ga0207640_10354906 3300025981 Bacteria 1179
158 Ga0207639_10092356 3300026041 Bacteria 2426
159 Ga0207639_10143888 3300026041 Bacteria 1990
160 Ga0207678_10332754 3300026067 Bacteria 1308
161 Ga0207678_10741792 3300026067 Bacteria 865
162 Ga0207702_10055791 3300026078 Bacteria 3352
163 Ga0207702_10111201 3300026078 Bacteria 2436
164 Ga0207674_10024564 3300026116 Bacteria 6436
165 Ga0207674_11201084 3300026116 Bacteria 728
166 Ga0207698_10008903 3300026142 Bacteria 6365
167 Ga0207698_10178542 3300026142 Unclassified 1878
168 Ga0209281_1000216 3300027111 Bacteria 125724
169 Ga0209282_1058737 3300027666 Bacteria 2155
170 Ga0307517_10522594 3300028786 Unclassified 599
171 Ga0316181_1030788 3300030744 Bacteria 2422
172 Ga0265327_10000319 3300031251 Bacteria 91814
173 Ga0307513_10777246 3300031456 Bacteria 663
174 Ga0307413_11938332 3300031824 Unclassified 530
175 Ga0307406_11958225 3300031901 Bacteria 523
176 Ga0307412_10000001 3300031911 Bacteria 822691
177 Ga0307412_10000012 3300031911 Bacteria 404180
178 Ga0307412_10005610 3300031911 Bacteria 7047
179 Ga0307412_10796737 3300031911 Bacteria 820
180 Ga0307409_100666717 3300031995 Unclassified 1036
181 Ga0307416_100004689 3300032002 Bacteria 8279
182 Ga0307414_10002618 3300032004 Bacteria 9466
183 Ga0307414_10021128 3300032004 Bacteria 4076
184 Ga0307414_10022163 3300032004 Unclassified 4001
185 Ga0307414_10028680 3300032004 Bacteria 3613
186 Ga0307414_10042917 3300032004 Bacteria 3076
187 Ga0307414_10088068 3300032004 Bacteria 2297
188 Ga0307414_10251342 3300032004 Unclassified 1470
189 Ga0307414_10328097 3300032004 Unclassified 1305
190 Ga0307414_10823913 3300032004 Bacteria 847
191 Ga0307411_10660687 3300032005 Unclassified 906
192 Ga0307411_11973069 3300032005 Bacteria 544
193 Ga0395899_0624221 3300037312 Bacteria 684
194 Ga0395900_0210249 3300037418 Bacteria 1964
195 Ga0395898_0915303 3300037466 Bacteria 815
196 Ga0395905_0000587 3300037471 Bacteria 48840
197 Ga0395901_0000875 3300038443 Bacteria 33234
198 Ga0395901_0720338 3300038443 Bacteria 993
199 Ga0395901_1256257 3300038443 Unclassified 704
200 Ga0436365_1186448 3300039437 Bacteria 17083
201 Ga0451797_0462431 3300041453 Bacteria 1203
202 Ga0451845_0361213 3300041501 Bacteria 560
203 Ga0451849_0334274 3300041505 Bacteria 683
204 Ga0451855_0689903 3300041511 Bacteria 575
205 Ga0439442_052214 3300042002 Bacteria 863
206 Ga0439445_0000044 3300042004 Bacteria 17497
207 Ga0439459_0101381 3300042438 Bacteria 705
208 Ga0466969_0000443 3300044656 Bacteria 22699
209 Ga0466972_0000002 3300044658 Bacteria 408005
210 Ga0466972_0259898 3300044658 Bacteria 812
211 Ga0466965_0779761 3300044683 Bacteria 552
212 Ga0466966_0000393 3300044684 Bacteria 28294
213 Ga0466964_0542360 3300044706 Bacteria 630
214 Ga0466971_0510722 3300044719 Bacteria 594
215 Ga0466970_0000489 3300044765 Bacteria 19447
216 Ga0466970_0462444 3300044765 Bacteria 728
217 Ga0466957_0395403 3300044842 Bacteria 945
218 Ga0466959_0000083 3300045049 Bacteria 59623
219 Ga0495627_000003 3300046453 Bacteria 704557
220 Ga0495638_0588502 3300046460 Bacteria 548
221 Ga0495596_0003542 3300046500 Bacteria 7867
222 Ga0495610_0000001 3300046512 Bacteria 1620061
223 Ga0495632_0001417 3300046519 Bacteria 19984
224 Ga0495632_0509453 3300046519 Unclassified 518
225 Ga0495643_0247032 3300046522 Bacteria 834
226 Ga0495654_0000001 3300046530 Bacteria 1513197
227 Ga0495633_0015009 3300046558 Bacteria 4027
228 Ga0495668_0008488 3300046616 Bacteria 6402
229 Ga0495670_0502473 3300046691 Bacteria 658
230 Ga0495686_0000118 3300047472 Bacteria 165897
231 Ga0496101_0562815 3300048904 Bacteria 901
232 Ga0496104_0605307 3300048907 Bacteria 1006
233 Ga0496115_0700125 3300048918 Bacteria 796
234 Ga0496116_0000012 3300048919 Bacteria 611365
235 Ga0496116_0000047 3300048919 Bacteria 315121
236 Ga0496117_0000050 3300048920 Bacteria 292727
237 Ga0496117_0240679 3300048920 Bacteria 994
238 Ga0496117_0268131 3300048920 Bacteria 921
239 Ga0496118_0000044 3300048921 Bacteria 283524
240 Ga0496118_0597740 3300048921 Bacteria 528
241 Ga0496119_0000002 3300048922 Bacteria 738385
242 Ga0496121_0000007 3300048924 Bacteria 942516
243 Ga0496121_0029873 3300048924 Bacteria 5022
244 Ga0496121_0067655 3300048924 Bacteria 2894
245 Ga0496122_0000386 3300048925 Bacteria 93777
246 Ga0496122_0000848 3300048925 Bacteria 57604
247 Ga0496122_0002418 3300048925 Bacteria 26574
248 Ga0496122_0027275 3300048925 Bacteria 4887
249 Ga0496122_0547685 3300048925 Bacteria 552
250 Ga0496123_0002309 3300048926 Bacteria 23946
251 Ga0496123_0014375 3300048926 Bacteria 6566
252 Ga0496123_0121522 3300048926 Bacteria 1468
253 Ga0496124_0006605 3300048927 Bacteria 12594
254 Ga0496124_0130573 3300048927 Bacteria 1996
255 Ga0496124_0134544 3300048927 Bacteria 1959
256 Ga0496125_0000050 3300048928 Bacteria 286703
257 Ga0496125_0004193 3300048928 Bacteria 16796
258 Ga0496125_0413783 3300048928 Unclassified 784
259 Ga0496125_0518310 3300048928 Bacteria 667
260 Ga0496126_0001648 3300048929 Bacteria 33659
261 Ga0496126_0009353 3300048929 Bacteria 10422
262 Ga0496126_0031794 3300048929 Bacteria 4980
263 Ga0496126_0117506 3300048929 Bacteria 2310
264 Ga0496126_0191429 3300048929 Bacteria 1732
265 Ga0501335_023363 3300049551 Bacteria 671
266 Ga0501217_008703 3300049661 Bacteria 2198
267 Ga0501243_002816 3300049675 Bacteria 2562
268 Ga0501251_024820 3300049681 Bacteria 820
269 Ga0501252_018535 3300049682 Bacteria 892
270 Ga0501259_035508 3300049688 Bacteria 960
271 Ga0501225_0009813 3300049705 Bacteria 2719
272 Ga0501245_064859 3300049708 Bacteria 676
273 Ga0501080_1097074 3300049742 Unclassified 687
274 Ga0501241_000013 3300049758 Bacteria 104728
275 Ga0501241_001457 3300049758 Plasmid 4798
276 Ga0501241_004184 3300049758 Unclassified 2709
277 Ga0501266_001686 3300049763 Bacteria 2811
278 Ga0501269_000364 3300049766 Bacteria 11297
279 Ga0501270_065367 3300049767 Unclassified 692
280 nmdc:mga0k408_26287_c1 3300050493 Bacteria 3299
281 Ga0500644_0000344 3300053088 Bacteria 23446
282 Ga0500646_0092649 3300053090 Bacteria 937
283 Ga0500583_0069161 3300053092 Bacteria 1685
284 Ga0500651_0000680 3300053093 Bacteria 16894
285 Ga0500651_0151546 3300053093 Bacteria 1392
286 Ga0500566_0321691 3300053094 Bacteria 720
287 Ga0500569_001812 3300053109 Bacteria 4098
288 Ga0500592_030940 3300053116 Bacteria 863
289 Ga0500652_366257 3300053131 Archaea 541
290 Ga0500658_0006919 3300053134 Bacteria 4197
291 Ga0500577_0001238 3300053142 Bacteria 6535
292 Ga0500616_0023179 3300053153 Bacteria 3459
293 Ga0500633_0000305 3300053160 Bacteria 7239

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030744 Ga0316181_1030788 Ga0316181_10307881 94
2 3300031824 Ga0307413_11938332 Ga0307413_119383321 94
3 3300032004 Ga0307414_10022163 Ga0307414_100221631 94
4 3300032005 Ga0307411_10660687 Ga0307411_106606872 94
5 3300044658 Ga0466972_0259898 Ga0466972_0259898_11_298 95
6 3300014497 Ga0182008_10000025 Ga0182008_1000002575 97
7 3300005288 Ga0065714_10002231 Ga0065714_100022316 98
8 2162886007 SwRhRL2b_contig_3757853 SwRhRL2b_0703.00006130 99
9 3300005288 Ga0065714_10005940 Ga0065714_100059407 99
10 3300005289 Ga0065704_10000218 Ga0065704_1000021818 99
11 3300013100 Ga0157373_10000167 Ga0157373_1000016710 99
12 3300013102 Ga0157371_10009312 Ga0157371_1000931210 99
13 3300015261 Ga0182006_1003760 Ga0182006_10037608 99
14 3300031911 Ga0307412_10000001 Ga0307412_10000001497 99
15 3300032004 Ga0307414_10002618 Ga0307414_100026189 99
16 3300049758 Ga0501241_004184 Ga0501241_004184_2308_2631 99
17 3300053093 Ga0500651_0000680 Ga0500651_0000680_758_1081 99
18 3300053094 Ga0500566_0321691 Ga0500566_0321691_134_457 99
19 iso_pu_bacteria 2738541284 2738761512 102
20 iso_pu_bacteria 2775506987 2776615852 102
21 3300025916 Ga0207663_10320959 Ga0207663_103209592 103
22 iso_pu_bacteria 2511231000 2511232649 104
23 iso_pu_bacteria 2582581281 2585159323 104
24 iso_pu_bacteria 2582581282 2585163582 104
25 iso_pu_bacteria 2585428060 2587748025 104
26 iso_pu_bacteria 2588253712 2588446285 104
27 iso_pu_bacteria 2588254257 2590611678 104
28 iso_pu_bacteria 2739367874 2740057463 104
29 iso_pu_bacteria 2842083920 2842084065 104
30 iso_pu_bacteria 2905999023 2906000926 104
31 iso_pu_bacteria 2919399522 2919402763 104
32 iso_pu_bacteria 2946019816 2946021262 104
33 iso_pu_bacteria 2984572630 2984575806 104
34 iso_pu_bacteria 2984606641 2984609262 104
35 iso_pu_bacteria 2582581278 2585144888 105
36 iso_pu_bacteria 2585428045 2587678497 105
37 iso_pu_bacteria 2585428182 2588208491 105
38 iso_pu_bacteria 2585428183 2588213010 105
39 iso_pu_bacteria 2585428184 2588219598 105
40 iso_pu_bacteria 2585428185 2588224089 105
41 iso_pu_bacteria 2585428187 2588233594 105
42 iso_pu_bacteria 2588254255 2590600465 105
43 iso_pu_bacteria 2751185877 2753672838 105
44 iso_pu_bacteria 2765235839 2765572388 105
45 iso_pu_bacteria 2775506739 2775673025 105
46 iso_pu_bacteria 2816332188 2816872665 105
47 iso_pu_bacteria 2871720351 2871721801 105
48 iso_pu_bacteria 2889290771 2889291978 105
49 iso_pu_bacteria 2919097161 2919099442 105
50 iso_pu_bacteria 2945924605 2945927458 105
51 iso_pu_bacteria 2993480792 2993484313 105
52 3300013308 Ga0157375_10023023 Ga0157375_100230235 106
53 3300005834 Ga0068851_10000104 Ga0068851_1000010413 107
54 3300025321 Ga0207656_10000149 Ga0207656_1000014913 107
55 3300038443 Ga0395901_0000875 Ga0395901_0000875_28122_28445 107
56 3300002741 JGI25157J39369_1004497 JGI25157J39369_10044974 108
57 3300003320 rootH2_10015343 rootH2_100153434 108
58 3300003320 rootH2_10169384 rootH2_101693842 108
59 3300003322 rootL2_10002205 rootL2_100022059 108
60 3300003323 rootH1_10005480 rootH1_100054804 108
61 3300003354 JGI25160J50197_1001335 JGI25160J50197_10013353 108
62 3300005289 Ga0065704_10080857 Ga0065704_100808572 108
63 3300005329 Ga0070683_100022440 Ga0070683_1000224405 108
64 3300005337 Ga0070682_100181673 Ga0070682_1001816732 108
65 3300005337 Ga0070682_100211004 Ga0070682_1002110042 108
66 3300005366 Ga0070659_100441754 Ga0070659_1004417542 108
67 3300005366 Ga0070659_101596880 Ga0070659_1015968801 108
68 3300005367 Ga0070667_101289137 Ga0070667_1012891371 108
69 3300005367 Ga0070667_101605193 Ga0070667_1016051931 108
70 3300005439 Ga0070711_100246085 Ga0070711_1002460852 108
71 3300005455 Ga0070663_100452230 Ga0070663_1004522302 108
72 3300005456 Ga0070678_101255192 Ga0070678_1012551922 108
73 3300005459 Ga0068867_100744907 Ga0068867_1007449072 108
74 3300005535 Ga0070684_100050020 Ga0070684_1000500201 108
75 3300005539 Ga0068853_100161242 Ga0068853_1001612422 108
76 3300005548 Ga0070665_101248575 Ga0070665_1012485752 108
77 3300005563 Ga0068855_100095412 Ga0068855_1000954123 108
78 3300005563 Ga0068855_100116173 Ga0068855_1001161733 108
79 3300005577 Ga0068857_100003021 Ga0068857_1000030213 108
80 3300005577 Ga0068857_100205849 Ga0068857_1002058493 108
81 3300005577 Ga0068857_100518246 Ga0068857_1005182462 108
82 3300005577 Ga0068857_100536706 Ga0068857_1005367062 108
83 3300005578 Ga0068854_100036563 Ga0068854_1000365633 108
84 3300005614 Ga0068856_100059007 Ga0068856_1000590072 108
85 3300005614 Ga0068856_100143210 Ga0068856_1001432102 108
86 3300005616 Ga0068852_100019464 Ga0068852_1000194643 108
87 3300005616 Ga0068852_100272926 Ga0068852_1002729262 108
88 3300006195 Ga0075366_10006071 Ga0075366_100060716 108
89 3300006946 Ga0079104_1000005 Ga0079104_1000005315 108
90 3300006948 Ga0099826_10001059 Ga0099826_1000105911 108
91 3300009011 Ga0105251_10050420 Ga0105251_100504203 108
92 3300009092 Ga0105250_10070513 Ga0105250_100705132 108
93 3300009093 Ga0105240_10001190 Ga0105240_1000119022 108
94 3300009093 Ga0105240_10050314 Ga0105240_100503143 108
95 3300009093 Ga0105240_10278458 Ga0105240_102784584 108
96 3300009174 Ga0105241_10038358 Ga0105241_100383584 108
97 3300009174 Ga0105241_12501172 Ga0105241_125011721 108
98 3300009545 Ga0105237_10030153 Ga0105237_100301537 108
99 3300009545 Ga0105237_10041755 Ga0105237_100417554 108
100 3300009545 Ga0105237_10378884 Ga0105237_103788842 108
101 3300009551 Ga0105238_10013926 Ga0105238_100139263 108
102 3300009551 Ga0105238_10040719 Ga0105238_100407192 108
103 3300010375 Ga0105239_10161775 Ga0105239_101617753 108
104 3300010375 Ga0105239_11644662 Ga0105239_116446621 108
105 3300013100 Ga0157373_10000002 Ga0157373_10000002195 108
106 3300013100 Ga0157373_10023444 Ga0157373_100234442 108
107 3300013100 Ga0157373_10712011 Ga0157373_107120111 108
108 3300013102 Ga0157371_10036644 Ga0157371_100366442 108
109 3300013104 Ga0157370_10000222 Ga0157370_1000022211 108
110 3300013104 Ga0157370_10000399 Ga0157370_100003998 108
111 3300013104 Ga0157370_10007094 Ga0157370_100070946 108
112 3300013104 Ga0157370_10007164 Ga0157370_100071649 108
113 3300013105 Ga0157369_10002091 Ga0157369_1000209122 108
114 3300013105 Ga0157369_10009719 Ga0157369_1000971910 108
115 3300013105 Ga0157369_11806201 Ga0157369_118062012 108
116 3300013297 Ga0157378_10270658 Ga0157378_102706582 108
117 3300013307 Ga0157372_10004157 Ga0157372_1000415712 108
118 3300013307 Ga0157372_10653561 Ga0157372_106535612 108
119 3300013307 Ga0157372_11038751 Ga0157372_110387512 108
120 3300013308 Ga0157375_10000846 Ga0157375_100008469 108
121 3300015261 Ga0182006_1000011 Ga0182006_1000011131 108
122 3300015261 Ga0182006_1004356 Ga0182006_10043566 108
123 3300015261 Ga0182006_1029884 Ga0182006_10298843 108
124 3300015261 Ga0182006_1048568 Ga0182006_10485682 108
125 3300015261 Ga0182006_1057522 Ga0182006_10575222 108
126 3300015261 Ga0182006_1074212 Ga0182006_10742122 108
127 3300025245 Ga0207425_1012556 Ga0207425_10125562 108
128 3300025246 Ga0209646_1000003 Ga0209646_100000348 108
129 3300025250 Ga0209026_1000202 Ga0209026_100020249 108
130 3300025258 Ga0209129_1011889 Ga0209129_10118893 108
131 3300025302 Ga0207426_1000364 Ga0207426_100036440 108
132 3300025302 Ga0207426_1135939 Ga0207426_11359392 108
133 3300025711 Ga0207696_1065604 Ga0207696_10656042 108
134 3300025904 Ga0207647_10064609 Ga0207647_100646092 108
135 3300025911 Ga0207654_10071802 Ga0207654_100718024 108
136 3300025913 Ga0207695_10280570 Ga0207695_102805701 108
137 3300025913 Ga0207695_10810987 Ga0207695_108109871 108
138 3300025914 Ga0207671_10241285 Ga0207671_102412852 108
139 3300025924 Ga0207694_10068459 Ga0207694_100684592 108
140 3300025924 Ga0207694_10926026 Ga0207694_109260262 108
141 3300025932 Ga0207690_10233630 Ga0207690_102336302 108
142 3300025944 Ga0207661_10004950 Ga0207661_100049506 108
143 3300025949 Ga0207667_10008002 Ga0207667_1000800210 108
144 3300025949 Ga0207667_10081934 Ga0207667_100819343 108
145 3300025949 Ga0207667_10161819 Ga0207667_101618191 108
146 3300025981 Ga0207640_10097729 Ga0207640_100977293 108
147 3300025981 Ga0207640_10354906 Ga0207640_103549062 108
148 3300026041 Ga0207639_10092356 Ga0207639_100923563 108
149 3300026041 Ga0207639_10143888 Ga0207639_101438882 108
150 3300026067 Ga0207678_10332754 Ga0207678_103327542 108
151 3300026078 Ga0207702_10055791 Ga0207702_100557914 108
152 3300026078 Ga0207702_10111201 Ga0207702_101112014 108
153 3300026116 Ga0207674_10024564 Ga0207674_100245643 108
154 3300026116 Ga0207674_11201084 Ga0207674_112010841 108
155 3300026142 Ga0207698_10008903 Ga0207698_100089035 108
156 3300026142 Ga0207698_10178542 Ga0207698_101785422 108
157 3300027111 Ga0209281_1000216 Ga0209281_100021698 108
158 3300027666 Ga0209282_1058737 Ga0209282_10587373 108
159 3300028786 Ga0307517_10522594 Ga0307517_105225941 108
160 3300031456 Ga0307513_10777246 Ga0307513_107772461 108
161 3300031901 Ga0307406_11958225 Ga0307406_119582251 108
162 3300031911 Ga0307412_10000012 Ga0307412_10000012326 108
163 3300031911 Ga0307412_10005610 Ga0307412_100056106 108
164 3300031911 Ga0307412_10796737 Ga0307412_107967372 108
165 3300031995 Ga0307409_100666717 Ga0307409_1006667172 108
166 3300032002 Ga0307416_100004689 Ga0307416_1000046895 108
167 3300032004 Ga0307414_10042917 Ga0307414_100429175 108
168 3300032004 Ga0307414_10251342 Ga0307414_102513422 108
169 3300032004 Ga0307414_10328097 Ga0307414_103280972 108
170 3300032004 Ga0307414_10823913 Ga0307414_108239132 108
171 3300032005 Ga0307411_11973069 Ga0307411_119730691 108
172 3300041453 Ga0451797_0462431 Ga0451797_0462431_778_1104 108
173 3300041501 Ga0451845_0361213 Ga0451845_0361213_171_497 108
174 3300041505 Ga0451849_0334274 Ga0451849_0334274_209_535 108
175 3300041511 Ga0451855_0689903 Ga0451855_0689903_116_442 108
176 3300042002 Ga0439442_052214 Ga0439442_052214_41_367 108
177 3300042004 Ga0439445_0000044 Ga0439445_0000044_11334_11660 108
178 3300044656 Ga0466969_0000443 Ga0466969_0000443_19770_20096 108
179 3300044658 Ga0466972_0000002 Ga0466972_0000002_206888_207214 108
180 3300044683 Ga0466965_0779761 Ga0466965_0779761_118_444 108
181 3300044684 Ga0466966_0000393 Ga0466966_0000393_14013_14339 108
182 3300044706 Ga0466964_0542360 Ga0466964_0542360_131_457 108
183 3300044719 Ga0466971_0510722 Ga0466971_0510722_242_568 108
184 3300044765 Ga0466970_0000489 Ga0466970_0000489_12448_12774 108
185 3300044765 Ga0466970_0462444 Ga0466970_0462444_149_475 108
186 3300044842 Ga0466957_0395403 Ga0466957_0395403_461_787 108
187 3300045049 Ga0466959_0000083 Ga0466959_0000083_14042_14368 108
188 3300046453 Ga0495627_000003 Ga0495627_000003_484608_484934 108
189 3300046512 Ga0495610_0000001 Ga0495610_0000001_1330758_1331084 108
190 3300046519 Ga0495632_0509453 Ga0495632_0509453_49_450 108
191 3300046530 Ga0495654_0000001 Ga0495654_0000001_631481_631807 108
192 3300046616 Ga0495668_0008488 Ga0495668_0008488_405_731 108
193 3300048918 Ga0496115_0700125 Ga0496115_0700125_50_376 108
194 3300048919 Ga0496116_0000047 Ga0496116_0000047_102120_102446 108
195 3300048920 Ga0496117_0240679 Ga0496117_0240679_503_829 108
196 3300048921 Ga0496118_0597740 Ga0496118_0597740_191_517 108
197 3300048924 Ga0496121_0029873 Ga0496121_0029873_2237_2563 108
198 3300048924 Ga0496121_0067655 Ga0496121_0067655_1269_1595 108
199 3300048925 Ga0496122_0547685 Ga0496122_0547685_121_447 108
200 3300048926 Ga0496123_0121522 Ga0496123_0121522_241_591 108
201 3300048927 Ga0496124_0130573 Ga0496124_0130573_1618_1944 108
202 3300048927 Ga0496124_0134544 Ga0496124_0134544_1534_1860 108
203 3300048928 Ga0496125_0000050 Ga0496125_0000050_209147_209473 108
204 3300048928 Ga0496125_0413783 Ga0496125_0413783_23_349 108
205 3300048928 Ga0496125_0518310 Ga0496125_0518310_49_375 108
206 3300048929 Ga0496126_0031794 Ga0496126_0031794_2955_3281 108
207 3300048929 Ga0496126_0191429 Ga0496126_0191429_416_742 108
208 3300049661 Ga0501217_008703 Ga0501217_008703_232_558 108
209 3300049675 Ga0501243_002816 Ga0501243_002816_1160_1486 108
210 3300049681 Ga0501251_024820 Ga0501251_024820_283_609 108
211 3300049682 Ga0501252_018535 Ga0501252_018535_385_711 108
212 3300049688 Ga0501259_035508 Ga0501259_035508_223_549 108
213 3300049708 Ga0501245_064859 Ga0501245_064859_93_419 108
214 3300049758 Ga0501241_000013 Ga0501241_000013_47585_47911 108
215 3300049763 Ga0501266_001686 Ga0501266_001686_1156_1482 108
216 3300049767 Ga0501270_065367 Ga0501270_065367_279_605 108
217 3300050493 nmdc:mga0k408_26287_c1 nmdc:mga0k408_26287_c1_2676_3002 108
218 3300053088 Ga0500644_0000344 Ga0500644_0000344_13585_13911 108
219 3300053090 Ga0500646_0092649 Ga0500646_0092649_186_587 108
220 3300053092 Ga0500583_0069161 Ga0500583_0069161_252_578 108
221 3300053093 Ga0500651_0151546 Ga0500651_0151546_901_1302 108
222 3300053109 Ga0500569_001812 Ga0500569_001812_1440_1841 108
223 3300053116 Ga0500592_030940 Ga0500592_030940_273_599 108
224 3300053131 Ga0500652_366257 Ga0500652_366257_41_367 108
225 3300053134 Ga0500658_0006919 Ga0500658_0006919_1351_1752 108
226 3300053142 Ga0500577_0001238 Ga0500577_0001238_1647_2048 108
227 3300053153 Ga0500616_0023179 Ga0500616_0023179_1380_1781 108
228 3300053160 Ga0500633_0000305 Ga0500633_0000305_6494_6820 108
229 2162886007 SwRhRL2b_contig_1663468 SwRhRL2b_0819.00002220 109
230 2162886007 SwRhRL2b_contig_1985813 SwRhRL2b_0929.00004830 109
231 2162886007 SwRhRL2b_contig_236177 SwRhRL2b_0618.00007510 109
232 3300003320 rootH2_10064779 rootH2_100647794 109
233 3300003320 rootH2_10254400 rootH2_102544002 109
234 3300003323 rootH1_10097937 rootH1_100979374 109
235 3300003354 JGI25160J50197_1000831 JGI25160J50197_10008318 109
236 3300003354 JGI25160J50197_1067975 JGI25160J50197_10679751 109
237 3300003790 Ga0055528_1001659 Ga0055528_10016591 109
238 3300003790 Ga0055528_1002049 Ga0055528_100204913 109
239 3300003791 Ga0055530_10012562 Ga0055530_100125623 109
240 3300003794 Ga0055531_10067731 Ga0055531_100677312 109
241 3300005262 Ga0065165_1000038 Ga0065165_1000038146 109
242 3300005289 Ga0065704_10071407 Ga0065704_100714075 109
243 3300005289 Ga0065704_10075750 Ga0065704_100757502 109
244 3300005327 Ga0070658_10326730 Ga0070658_103267301 109
245 3300005337 Ga0070682_100000206 Ga0070682_10000020637 109
246 3300005339 Ga0070660_100273931 Ga0070660_1002739314 109
247 3300005347 Ga0070668_100090314 Ga0070668_1000903144 109
248 3300005578 Ga0068854_100634808 Ga0068854_1006348082 109
249 3300006173 Ga0070716_100115607 Ga0070716_1001156072 109
250 3300006195 Ga0075366_10329288 Ga0075366_103292882 109
251 3300009036 Ga0105244_10000114 Ga0105244_1000011428 109
252 3300009036 Ga0105244_10219259 Ga0105244_102192591 109
253 3300009148 Ga0105243_10000043 Ga0105243_1000004332 109
254 3300009148 Ga0105243_10001230 Ga0105243_1000123014 109
255 3300010375 Ga0105239_12256665 Ga0105239_122566651 109
256 3300012495 Ga0157323_1033669 Ga0157323_10336691 109
257 3300013100 Ga0157373_10335748 Ga0157373_103357482 109
258 3300013102 Ga0157371_10000019 Ga0157371_1000001963 109
259 3300013102 Ga0157371_10314459 Ga0157371_103144592 109
260 3300013104 Ga0157370_10034455 Ga0157370_100344551 109
261 3300013104 Ga0157370_10760367 Ga0157370_107603671 109
262 3300013307 Ga0157372_10008046 Ga0157372_100080466 109
263 3300017792 Ga0163161_10725543 Ga0163161_107255431 109
264 3300021384 Ga0213876_10016258 Ga0213876_100162582 109
265 3300025273 Ga0209673_1000123 Ga0209673_1000123144 109
266 3300025291 Ga0209675_1000032 Ga0209675_1000032251 109
267 3300025295 Ga0209564_1000705 Ga0209564_100070516 109
268 3300025295 Ga0209564_1002197 Ga0209564_10021973 109
269 3300025297 Ga0209758_1002624 Ga0209758_10026243 109
270 3300025297 Ga0209758_1004422 Ga0209758_100442211 109
271 3300025297 Ga0209758_1124170 Ga0209758_11241702 109
272 3300025298 Ga0209050_1000692 Ga0209050_100069230 109
273 3300025302 Ga0207426_1001365 Ga0207426_100136519 109
274 3300025304 Ga0209257_1000064 Ga0209257_1000064117 109
275 3300025304 Ga0209257_1010858 Ga0209257_10108583 109
276 3300025728 Ga0207655_1000631 Ga0207655_100063116 109
277 3300025909 Ga0207705_10115969 Ga0207705_101159692 109
278 3300025935 Ga0207709_10000021 Ga0207709_10000021279 109
279 3300025935 Ga0207709_10000992 Ga0207709_100009928 109
280 3300025972 Ga0207668_10078764 Ga0207668_100787644 109
281 3300026067 Ga0207678_10741792 Ga0207678_107417921 109
282 3300031251 Ga0265327_10000319 Ga0265327_1000031973 109
283 3300032004 Ga0307414_10021128 Ga0307414_100211283 109
284 3300032004 Ga0307414_10028680 Ga0307414_100286802 109
285 3300032004 Ga0307414_10088068 Ga0307414_100880683 109
286 3300037312 Ga0395899_0624221 Ga0395899_0624221_284_613 109
287 3300037418 Ga0395900_0210249 Ga0395900_0210249_815_1144 109
288 3300037466 Ga0395898_0915303 Ga0395898_0915303_131_460 109
289 3300037471 Ga0395905_0000587 Ga0395905_0000587_36743_37072 109
290 3300038443 Ga0395901_0720338 Ga0395901_0720338_239_568 109
291 3300038443 Ga0395901_1256257 Ga0395901_1256257_119_466 109
292 3300039437 Ga0436365_1186448 Ga0436365_1186448_1282_1611 109
293 3300042438 Ga0439459_0101381 Ga0439459_0101381_312_641 109
294 3300046460 Ga0495638_0588502 Ga0495638_0588502_21_350 109
295 3300046500 Ga0495596_0003542 Ga0495596_0003542_1067_1399 109
296 3300046519 Ga0495632_0001417 Ga0495632_0001417_2691_3020 109
297 3300046522 Ga0495643_0247032 Ga0495643_0247032_350_679 109
298 3300046558 Ga0495633_0015009 Ga0495633_0015009_599_928 109
299 3300046691 Ga0495670_0502473 Ga0495670_0502473_271_603 109
300 3300047472 Ga0495686_0000118 Ga0495686_0000118_18720_19049 109
301 3300048904 Ga0496101_0562815 Ga0496101_0562815_449_778 109
302 3300048907 Ga0496104_0605307 Ga0496104_0605307_76_408 109
303 3300048919 Ga0496116_0000012 Ga0496116_0000012_72787_73119 109
304 3300048920 Ga0496117_0000050 Ga0496117_0000050_47318_47650 109
305 3300048920 Ga0496117_0268131 Ga0496117_0268131_381_710 109
306 3300048921 Ga0496118_0000044 Ga0496118_0000044_245105_245437 109
307 3300048922 Ga0496119_0000002 Ga0496119_0000002_247283_247615 109
308 3300048924 Ga0496121_0000007 Ga0496121_0000007_918873_919202 109
309 3300048925 Ga0496122_0000386 Ga0496122_0000386_68625_68957 109
310 3300048925 Ga0496122_0000848 Ga0496122_0000848_15714_16046 109
311 3300048925 Ga0496122_0002418 Ga0496122_0002418_24946_25278 109
312 3300048925 Ga0496122_0027275 Ga0496122_0027275_1255_1587 109
313 3300048926 Ga0496123_0002309 Ga0496123_0002309_22328_22660 109
314 3300048926 Ga0496123_0014375 Ga0496123_0014375_3110_3442 109
315 3300048927 Ga0496124_0006605 Ga0496124_0006605_9557_9889 109
316 3300048928 Ga0496125_0004193 Ga0496125_0004193_8920_9252 109
317 3300048929 Ga0496126_0001648 Ga0496126_0001648_3340_3672 109
318 3300048929 Ga0496126_0009353 Ga0496126_0009353_1407_1736 109
319 3300048929 Ga0496126_0117506 Ga0496126_0117506_1325_1657 109
320 3300049551 Ga0501335_023363 Ga0501335_023363_122_451 109
321 3300049705 Ga0501225_0009813 Ga0501225_0009813_579_908 109
322 3300049742 Ga0501080_1097074 Ga0501080_1097074_100_429 109
323 3300049758 Ga0501241_001457 Ga0501241_001457_3266_3595 109
324 3300049766 Ga0501269_000364 Ga0501269_000364_3487_3816 109
325 iso_pu_bacteria 2772190705 2772606573 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

15

99

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.9146 1 107
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.9064 1 107
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8547 1 101
7mgx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.8491 1 101
7mgx-assembly2.cif.gz_F structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.8215 1 101
ID Description Score Start End Superfamily
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9378 1 107 1.10.3730.20
af_Q0DVJ4_6_84_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9293 5 84 1.10.3730.20
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9207 1 107 1.10.3730.20
af_I1KSB6_13_116_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.905 1 109 1.10.3730.20
af_I1KSB6_13_116_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.897 1 109 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A258KUH7-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 0.9966 1 77 GO:0005886
GO:0022857
AF-A0A2A3N6Z6-F1-model_v4 deleted 0.9942 1 106
AF-A0A2U0ZN18-F1-model_v4 deleted 0.9929 1 107
AF-A0A258KUH7-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 0.9838 1 77 GO:0005886
GO:0022857
AF-A0A2Z6IE80-F1-model_v4 Guanidinium exporter 0.9816 2 106 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
84.53 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map