F407837
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 207 | 293 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10000025|Ga0182008_1000002575 |
| Length | 112 |
| Sequence | VIGGSFTLILQKKIMNWIILIIAGLFEVGFTTCLKLSNNFTNLKWSLAYFLNKATQTLPMGTAYAVWTGIGAVGTVMVGIVCFQEPANFWRIFFIVTLIGSILGLKFFAGSH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 3 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 4 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 5 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 6 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 7 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 8 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 9 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 10 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 11 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 12 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 13 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 14 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 15 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 16 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 17 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 18 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 19 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 20 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 21 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 22 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 23 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 24 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 25 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 26 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 27 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 28 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 29 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 30 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 31 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 32 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 33 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 34 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 35 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 36 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 37 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 38 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 39 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 40 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 44 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 69 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 70 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 88 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 91 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 94 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 124 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 125 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 126 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 127 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 129 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 130 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 142 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 144 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 145 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 146 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 147 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 148 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 149 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 150 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 151 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 152 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 153 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 154 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 155 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 156 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 157 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 158 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 171 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 172 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 173 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 174 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 175 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 176 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 177 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 178 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 179 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 180 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 181 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 182 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 184 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 185 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 186 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 187 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 188 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 189 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 190 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 192 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 193 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 194 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 195 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 196 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 197 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 198 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 199 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 200 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 201 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 202 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 203 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 204 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 205 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 206 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 207 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.54 |
| Metatranscriptomes | 0.31 |
| Isolates | 10.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.62 |
| Bulb | 0 |
| Endosphere | 12 |
| Nodule | 1.54 |
| Rhizoplane | 1.23 |
| Rhizosphere | 67.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1663468 | 2162886007 | Bacteria | 272152 |
| 2 | SwRhRL2b_contig_1985813 | 2162886007 | Bacteria | 998 |
| 3 | SwRhRL2b_contig_236177 | 2162886007 | Bacteria | 1761 |
| 4 | SwRhRL2b_contig_3757853 | 2162886007 | Bacteria | 16541 |
| 5 | JGI25157J39369_1004497 | 3300002741 | Bacteria | 2506 |
| 6 | rootH2_10015343 | 3300003320 | Bacteria | 7553 |
| 7 | rootH2_10064779 | 3300003320 | Bacteria | 2946 |
| 8 | rootH2_10169384 | 3300003320 | Unclassified | 1054 |
| 9 | rootH2_10254400 | 3300003320 | Bacteria | 2412 |
| 10 | rootL2_10002205 | 3300003322 | Bacteria | 6251 |
| 11 | rootH1_10005480 | 3300003316 | Bacteria | 9779 |
| 12 | rootH1_10005480 | 3300003323 | Bacteria | 11389 |
| 13 | rootH1_10097937 | 3300003323 | Bacteria | 4220 |
| 14 | JGI25160J50197_1000831 | 3300003354 | Bacteria | 16491 |
| 15 | JGI25160J50197_1001335 | 3300003354 | Bacteria | 12446 |
| 16 | JGI25160J50197_1067975 | 3300003354 | Bacteria | 688 |
| 17 | Ga0055528_1001659 | 3300003790 | Bacteria | 13038 |
| 18 | Ga0055528_1002049 | 3300003790 | Bacteria | 11265 |
| 19 | Ga0055530_10012562 | 3300003791 | Bacteria | 2943 |
| 20 | Ga0055531_10067731 | 3300003794 | Unclassified | 838 |
| 21 | Ga0065165_1000038 | 3300005262 | Bacteria | 211664 |
| 22 | Ga0065714_10002231 | 3300005288 | Bacteria | 44866 |
| 23 | Ga0065714_10005940 | 3300005288 | Bacteria | 8737 |
| 24 | Ga0065704_10000218 | 3300005289 | Bacteria | 76484 |
| 25 | Ga0065704_10071407 | 3300005289 | Bacteria | 11313 |
| 26 | Ga0065704_10075750 | 3300005289 | Bacteria | 5437 |
| 27 | Ga0065704_10080857 | 3300005289 | Bacteria | 3867 |
| 28 | Ga0070658_10326730 | 3300005327 | Bacteria | 1310 |
| 29 | Ga0070683_100022440 | 3300005329 | Bacteria | 5642 |
| 30 | Ga0070682_100000206 | 3300005337 | Bacteria | 43560 |
| 31 | Ga0070682_100181673 | 3300005337 | Bacteria | 1470 |
| 32 | Ga0070682_100211004 | 3300005337 | Bacteria | 1376 |
| 33 | Ga0070660_100273931 | 3300005339 | Bacteria | 1380 |
| 34 | Ga0070668_100090314 | 3300005347 | Bacteria | 2413 |
| 35 | Ga0070659_100441754 | 3300005366 | Unclassified | 1102 |
| 36 | Ga0070659_101596880 | 3300005366 | Bacteria | 582 |
| 37 | Ga0070667_101289137 | 3300005367 | Unclassified | 684 |
| 38 | Ga0070667_101605193 | 3300005367 | Bacteria | 611 |
| 39 | Ga0070711_100246085 | 3300005439 | Bacteria | 1400 |
| 40 | Ga0070663_100452230 | 3300005455 | Bacteria | 1059 |
| 41 | Ga0070678_101255192 | 3300005456 | Bacteria | 688 |
| 42 | Ga0068867_100744907 | 3300005459 | Bacteria | 869 |
| 43 | Ga0070684_100050020 | 3300005535 | Bacteria | 3629 |
| 44 | Ga0068853_100161242 | 3300005539 | Bacteria | 2024 |
| 45 | Ga0070665_101248575 | 3300005548 | Bacteria | 753 |
| 46 | Ga0068855_100095412 | 3300005563 | Bacteria | 3428 |
| 47 | Ga0068855_100116173 | 3300005563 | Bacteria | 3067 |
| 48 | Ga0068857_100003021 | 3300005577 | Bacteria | 13897 |
| 49 | Ga0068857_100205849 | 3300005577 | Bacteria | 1795 |
| 50 | Ga0068857_100518246 | 3300005577 | Bacteria | 1120 |
| 51 | Ga0068857_100536706 | 3300005577 | Bacteria | 1101 |
| 52 | Ga0068854_100036563 | 3300005578 | Bacteria | 3444 |
| 53 | Ga0068854_100634808 | 3300005578 | Bacteria | 915 |
| 54 | Ga0068856_100059007 | 3300005614 | Bacteria | 3790 |
| 55 | Ga0068856_100143210 | 3300005614 | Bacteria | 2398 |
| 56 | Ga0068852_100019464 | 3300005616 | Bacteria | 5373 |
| 57 | Ga0068852_100272926 | 3300005616 | Bacteria | 1628 |
| 58 | Ga0068851_10000104 | 3300005834 | Bacteria | 45630 |
| 59 | Ga0070716_100115607 | 3300006173 | Unclassified | 1670 |
| 60 | Ga0075366_10006071 | 3300006195 | Bacteria | 6583 |
| 61 | Ga0075366_10329288 | 3300006195 | Bacteria | 936 |
| 62 | Ga0079104_1000005 | 3300006946 | Bacteria | 407099 |
| 63 | Ga0099826_10001059 | 3300006948 | Bacteria | 15569 |
| 64 | Ga0105251_10050420 | 3300009011 | Bacteria | 1988 |
| 65 | Ga0105244_10000114 | 3300009036 | Bacteria | 84368 |
| 66 | Ga0105244_10219259 | 3300009036 | Bacteria | 892 |
| 67 | Ga0105250_10070513 | 3300009092 | Bacteria | 1411 |
| 68 | Ga0105240_10001190 | 3300009093 | Bacteria | 45471 |
| 69 | Ga0105240_10050314 | 3300009093 | Bacteria | 5254 |
| 70 | Ga0105240_10278458 | 3300009093 | Unclassified | 1923 |
| 71 | Ga0105243_10000043 | 3300009148 | Bacteria | 158809 |
| 72 | Ga0105243_10001230 | 3300009148 | Bacteria | 23083 |
| 73 | Ga0105241_10038358 | 3300009174 | Bacteria | 3611 |
| 74 | Ga0105241_12501172 | 3300009174 | Bacteria | 517 |
| 75 | Ga0105237_10030153 | 3300009545 | Bacteria | 5511 |
| 76 | Ga0105237_10041755 | 3300009545 | Bacteria | 4625 |
| 77 | Ga0105237_10378884 | 3300009545 | Unclassified | 1419 |
| 78 | Ga0105238_10013926 | 3300009551 | Bacteria | 8133 |
| 79 | Ga0105238_10040719 | 3300009551 | Bacteria | 4708 |
| 80 | Ga0105239_10161775 | 3300010375 | Unclassified | 2501 |
| 81 | Ga0105239_11644662 | 3300010375 | Bacteria | 743 |
| 82 | Ga0105239_12256665 | 3300010375 | Bacteria | 633 |
| 83 | Ga0157323_1033669 | 3300012495 | Unclassified | 556 |
| 84 | Ga0157373_10000002 | 3300013100 | Bacteria | 750094 |
| 85 | Ga0157373_10000167 | 3300013100 | Bacteria | 53611 |
| 86 | Ga0157373_10023444 | 3300013100 | Bacteria | 4474 |
| 87 | Ga0157373_10335748 | 3300013100 | Bacteria | 1076 |
| 88 | Ga0157373_10712011 | 3300013100 | Unclassified | 736 |
| 89 | Ga0157371_10000019 | 3300013102 | Bacteria | 307914 |
| 90 | Ga0157371_10009312 | 3300013102 | Bacteria | 7742 |
| 91 | Ga0157371_10036644 | 3300013102 | Bacteria | 3512 |
| 92 | Ga0157371_10314459 | 3300013102 | Bacteria | 1136 |
| 93 | Ga0157370_10000222 | 3300013104 | Bacteria | 72506 |
| 94 | Ga0157370_10000399 | 3300013104 | Bacteria | 54642 |
| 95 | Ga0157370_10007094 | 3300013104 | Bacteria | 12240 |
| 96 | Ga0157370_10007164 | 3300013104 | Bacteria | 12165 |
| 97 | Ga0157370_10034455 | 3300013104 | Bacteria | 4929 |
| 98 | Ga0157370_10760367 | 3300013104 | Bacteria | 883 |
| 99 | Ga0157369_10002091 | 3300013105 | Bacteria | 24135 |
| 100 | Ga0157369_10009719 | 3300013105 | Bacteria | 11001 |
| 101 | Ga0157369_11806201 | 3300013105 | Bacteria | 621 |
| 102 | Ga0157378_10270658 | 3300013297 | Bacteria | 1634 |
| 103 | Ga0157372_10004157 | 3300013307 | Bacteria | 15490 |
| 104 | Ga0157372_10008046 | 3300013307 | Bacteria | 11212 |
| 105 | Ga0157372_10653561 | 3300013307 | Bacteria | 1224 |
| 106 | Ga0157372_11038751 | 3300013307 | Bacteria | 949 |
| 107 | Ga0157375_10000846 | 3300013308 | Bacteria | 26697 |
| 108 | Ga0157375_10023023 | 3300013308 | Bacteria | 5741 |
| 109 | Ga0182008_10000025 | 3300014497 | Bacteria | 191222 |
| 110 | Ga0182006_1000011 | 3300015261 | Bacteria | 408647 |
| 111 | Ga0182006_1003760 | 3300015261 | Bacteria | 7661 |
| 112 | Ga0182006_1004356 | 3300015261 | Bacteria | 6998 |
| 113 | Ga0182006_1029884 | 3300015261 | Bacteria | 2206 |
| 114 | Ga0182006_1048568 | 3300015261 | Bacteria | 1641 |
| 115 | Ga0182006_1057522 | 3300015261 | Bacteria | 1478 |
| 116 | Ga0182006_1074212 | 3300015261 | Bacteria | 1254 |
| 117 | Ga0163161_10725543 | 3300017792 | Bacteria | 829 |
| 118 | Ga0213876_10016258 | 3300021384 | Unclassified | 3933 |
| 119 | Ga0207425_1012556 | 3300025245 | Bacteria | 1983 |
| 120 | Ga0209646_1000003 | 3300025246 | Bacteria | 1160860 |
| 121 | Ga0209026_1000202 | 3300025250 | Bacteria | 82517 |
| 122 | Ga0209129_1011889 | 3300025258 | Bacteria | 2045 |
| 123 | Ga0209673_1000123 | 3300025273 | Bacteria | 169208 |
| 124 | Ga0209675_1000032 | 3300025291 | Bacteria | 273013 |
| 125 | Ga0209564_1000705 | 3300025295 | Bacteria | 48887 |
| 126 | Ga0209564_1002197 | 3300025295 | Bacteria | 16308 |
| 127 | Ga0209758_1002624 | 3300025297 | Bacteria | 17871 |
| 128 | Ga0209758_1004422 | 3300025297 | Bacteria | 11706 |
| 129 | Ga0209758_1124170 | 3300025297 | Bacteria | 692 |
| 130 | Ga0209050_1000692 | 3300025298 | Bacteria | 50268 |
| 131 | Ga0207426_1000364 | 3300025302 | Bacteria | 80671 |
| 132 | Ga0207426_1001365 | 3300025302 | Bacteria | 20691 |
| 133 | Ga0207426_1135939 | 3300025302 | Bacteria | 590 |
| 134 | Ga0209257_1000064 | 3300025304 | Bacteria | 356803 |
| 135 | Ga0209257_1010858 | 3300025304 | Bacteria | 4507 |
| 136 | Ga0207656_10000149 | 3300025321 | Bacteria | 25828 |
| 137 | Ga0207696_1065604 | 3300025711 | Bacteria | 1015 |
| 138 | Ga0207655_1000631 | 3300025728 | Bacteria | 42239 |
| 139 | Ga0207647_10064609 | 3300025904 | Bacteria | 2223 |
| 140 | Ga0207705_10115969 | 3300025909 | Bacteria | 1983 |
| 141 | Ga0207654_10071802 | 3300025911 | Bacteria | 2059 |
| 142 | Ga0207695_10280570 | 3300025913 | Bacteria | 1560 |
| 143 | Ga0207695_10810987 | 3300025913 | Bacteria | 816 |
| 144 | Ga0207671_10241285 | 3300025914 | Unclassified | 1419 |
| 145 | Ga0207663_10320959 | 3300025916 | Bacteria | 1164 |
| 146 | Ga0207694_10068459 | 3300025924 | Bacteria | 2772 |
| 147 | Ga0207694_10926026 | 3300025924 | Unclassified | 737 |
| 148 | Ga0207690_10233630 | 3300025932 | Unclassified | 1413 |
| 149 | Ga0207709_10000021 | 3300025935 | Bacteria | 386722 |
| 150 | Ga0207709_10000992 | 3300025935 | Bacteria | 21129 |
| 151 | Ga0207661_10004950 | 3300025944 | Bacteria | 9342 |
| 152 | Ga0207667_10008002 | 3300025949 | Bacteria | 12613 |
| 153 | Ga0207667_10081934 | 3300025949 | Bacteria | 3343 |
| 154 | Ga0207667_10161819 | 3300025949 | Bacteria | 2302 |
| 155 | Ga0207668_10078764 | 3300025972 | Bacteria | 2381 |
| 156 | Ga0207640_10097729 | 3300025981 | Bacteria | 2051 |
| 157 | Ga0207640_10354906 | 3300025981 | Bacteria | 1179 |
| 158 | Ga0207639_10092356 | 3300026041 | Bacteria | 2426 |
| 159 | Ga0207639_10143888 | 3300026041 | Bacteria | 1990 |
| 160 | Ga0207678_10332754 | 3300026067 | Bacteria | 1308 |
| 161 | Ga0207678_10741792 | 3300026067 | Bacteria | 865 |
| 162 | Ga0207702_10055791 | 3300026078 | Bacteria | 3352 |
| 163 | Ga0207702_10111201 | 3300026078 | Bacteria | 2436 |
| 164 | Ga0207674_10024564 | 3300026116 | Bacteria | 6436 |
| 165 | Ga0207674_11201084 | 3300026116 | Bacteria | 728 |
| 166 | Ga0207698_10008903 | 3300026142 | Bacteria | 6365 |
| 167 | Ga0207698_10178542 | 3300026142 | Unclassified | 1878 |
| 168 | Ga0209281_1000216 | 3300027111 | Bacteria | 125724 |
| 169 | Ga0209282_1058737 | 3300027666 | Bacteria | 2155 |
| 170 | Ga0307517_10522594 | 3300028786 | Unclassified | 599 |
| 171 | Ga0316181_1030788 | 3300030744 | Bacteria | 2422 |
| 172 | Ga0265327_10000319 | 3300031251 | Bacteria | 91814 |
| 173 | Ga0307513_10777246 | 3300031456 | Bacteria | 663 |
| 174 | Ga0307413_11938332 | 3300031824 | Unclassified | 530 |
| 175 | Ga0307406_11958225 | 3300031901 | Bacteria | 523 |
| 176 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 177 | Ga0307412_10000012 | 3300031911 | Bacteria | 404180 |
| 178 | Ga0307412_10005610 | 3300031911 | Bacteria | 7047 |
| 179 | Ga0307412_10796737 | 3300031911 | Bacteria | 820 |
| 180 | Ga0307409_100666717 | 3300031995 | Unclassified | 1036 |
| 181 | Ga0307416_100004689 | 3300032002 | Bacteria | 8279 |
| 182 | Ga0307414_10002618 | 3300032004 | Bacteria | 9466 |
| 183 | Ga0307414_10021128 | 3300032004 | Bacteria | 4076 |
| 184 | Ga0307414_10022163 | 3300032004 | Unclassified | 4001 |
| 185 | Ga0307414_10028680 | 3300032004 | Bacteria | 3613 |
| 186 | Ga0307414_10042917 | 3300032004 | Bacteria | 3076 |
| 187 | Ga0307414_10088068 | 3300032004 | Bacteria | 2297 |
| 188 | Ga0307414_10251342 | 3300032004 | Unclassified | 1470 |
| 189 | Ga0307414_10328097 | 3300032004 | Unclassified | 1305 |
| 190 | Ga0307414_10823913 | 3300032004 | Bacteria | 847 |
| 191 | Ga0307411_10660687 | 3300032005 | Unclassified | 906 |
| 192 | Ga0307411_11973069 | 3300032005 | Bacteria | 544 |
| 193 | Ga0395899_0624221 | 3300037312 | Bacteria | 684 |
| 194 | Ga0395900_0210249 | 3300037418 | Bacteria | 1964 |
| 195 | Ga0395898_0915303 | 3300037466 | Bacteria | 815 |
| 196 | Ga0395905_0000587 | 3300037471 | Bacteria | 48840 |
| 197 | Ga0395901_0000875 | 3300038443 | Bacteria | 33234 |
| 198 | Ga0395901_0720338 | 3300038443 | Bacteria | 993 |
| 199 | Ga0395901_1256257 | 3300038443 | Unclassified | 704 |
| 200 | Ga0436365_1186448 | 3300039437 | Bacteria | 17083 |
| 201 | Ga0451797_0462431 | 3300041453 | Bacteria | 1203 |
| 202 | Ga0451845_0361213 | 3300041501 | Bacteria | 560 |
| 203 | Ga0451849_0334274 | 3300041505 | Bacteria | 683 |
| 204 | Ga0451855_0689903 | 3300041511 | Bacteria | 575 |
| 205 | Ga0439442_052214 | 3300042002 | Bacteria | 863 |
| 206 | Ga0439445_0000044 | 3300042004 | Bacteria | 17497 |
| 207 | Ga0439459_0101381 | 3300042438 | Bacteria | 705 |
| 208 | Ga0466969_0000443 | 3300044656 | Bacteria | 22699 |
| 209 | Ga0466972_0000002 | 3300044658 | Bacteria | 408005 |
| 210 | Ga0466972_0259898 | 3300044658 | Bacteria | 812 |
| 211 | Ga0466965_0779761 | 3300044683 | Bacteria | 552 |
| 212 | Ga0466966_0000393 | 3300044684 | Bacteria | 28294 |
| 213 | Ga0466964_0542360 | 3300044706 | Bacteria | 630 |
| 214 | Ga0466971_0510722 | 3300044719 | Bacteria | 594 |
| 215 | Ga0466970_0000489 | 3300044765 | Bacteria | 19447 |
| 216 | Ga0466970_0462444 | 3300044765 | Bacteria | 728 |
| 217 | Ga0466957_0395403 | 3300044842 | Bacteria | 945 |
| 218 | Ga0466959_0000083 | 3300045049 | Bacteria | 59623 |
| 219 | Ga0495627_000003 | 3300046453 | Bacteria | 704557 |
| 220 | Ga0495638_0588502 | 3300046460 | Bacteria | 548 |
| 221 | Ga0495596_0003542 | 3300046500 | Bacteria | 7867 |
| 222 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 223 | Ga0495632_0001417 | 3300046519 | Bacteria | 19984 |
| 224 | Ga0495632_0509453 | 3300046519 | Unclassified | 518 |
| 225 | Ga0495643_0247032 | 3300046522 | Bacteria | 834 |
| 226 | Ga0495654_0000001 | 3300046530 | Bacteria | 1513197 |
| 227 | Ga0495633_0015009 | 3300046558 | Bacteria | 4027 |
| 228 | Ga0495668_0008488 | 3300046616 | Bacteria | 6402 |
| 229 | Ga0495670_0502473 | 3300046691 | Bacteria | 658 |
| 230 | Ga0495686_0000118 | 3300047472 | Bacteria | 165897 |
| 231 | Ga0496101_0562815 | 3300048904 | Bacteria | 901 |
| 232 | Ga0496104_0605307 | 3300048907 | Bacteria | 1006 |
| 233 | Ga0496115_0700125 | 3300048918 | Bacteria | 796 |
| 234 | Ga0496116_0000012 | 3300048919 | Bacteria | 611365 |
| 235 | Ga0496116_0000047 | 3300048919 | Bacteria | 315121 |
| 236 | Ga0496117_0000050 | 3300048920 | Bacteria | 292727 |
| 237 | Ga0496117_0240679 | 3300048920 | Bacteria | 994 |
| 238 | Ga0496117_0268131 | 3300048920 | Bacteria | 921 |
| 239 | Ga0496118_0000044 | 3300048921 | Bacteria | 283524 |
| 240 | Ga0496118_0597740 | 3300048921 | Bacteria | 528 |
| 241 | Ga0496119_0000002 | 3300048922 | Bacteria | 738385 |
| 242 | Ga0496121_0000007 | 3300048924 | Bacteria | 942516 |
| 243 | Ga0496121_0029873 | 3300048924 | Bacteria | 5022 |
| 244 | Ga0496121_0067655 | 3300048924 | Bacteria | 2894 |
| 245 | Ga0496122_0000386 | 3300048925 | Bacteria | 93777 |
| 246 | Ga0496122_0000848 | 3300048925 | Bacteria | 57604 |
| 247 | Ga0496122_0002418 | 3300048925 | Bacteria | 26574 |
| 248 | Ga0496122_0027275 | 3300048925 | Bacteria | 4887 |
| 249 | Ga0496122_0547685 | 3300048925 | Bacteria | 552 |
| 250 | Ga0496123_0002309 | 3300048926 | Bacteria | 23946 |
| 251 | Ga0496123_0014375 | 3300048926 | Bacteria | 6566 |
| 252 | Ga0496123_0121522 | 3300048926 | Bacteria | 1468 |
| 253 | Ga0496124_0006605 | 3300048927 | Bacteria | 12594 |
| 254 | Ga0496124_0130573 | 3300048927 | Bacteria | 1996 |
| 255 | Ga0496124_0134544 | 3300048927 | Bacteria | 1959 |
| 256 | Ga0496125_0000050 | 3300048928 | Bacteria | 286703 |
| 257 | Ga0496125_0004193 | 3300048928 | Bacteria | 16796 |
| 258 | Ga0496125_0413783 | 3300048928 | Unclassified | 784 |
| 259 | Ga0496125_0518310 | 3300048928 | Bacteria | 667 |
| 260 | Ga0496126_0001648 | 3300048929 | Bacteria | 33659 |
| 261 | Ga0496126_0009353 | 3300048929 | Bacteria | 10422 |
| 262 | Ga0496126_0031794 | 3300048929 | Bacteria | 4980 |
| 263 | Ga0496126_0117506 | 3300048929 | Bacteria | 2310 |
| 264 | Ga0496126_0191429 | 3300048929 | Bacteria | 1732 |
| 265 | Ga0501335_023363 | 3300049551 | Bacteria | 671 |
| 266 | Ga0501217_008703 | 3300049661 | Bacteria | 2198 |
| 267 | Ga0501243_002816 | 3300049675 | Bacteria | 2562 |
| 268 | Ga0501251_024820 | 3300049681 | Bacteria | 820 |
| 269 | Ga0501252_018535 | 3300049682 | Bacteria | 892 |
| 270 | Ga0501259_035508 | 3300049688 | Bacteria | 960 |
| 271 | Ga0501225_0009813 | 3300049705 | Bacteria | 2719 |
| 272 | Ga0501245_064859 | 3300049708 | Bacteria | 676 |
| 273 | Ga0501080_1097074 | 3300049742 | Unclassified | 687 |
| 274 | Ga0501241_000013 | 3300049758 | Bacteria | 104728 |
| 275 | Ga0501241_001457 | 3300049758 | Plasmid | 4798 |
| 276 | Ga0501241_004184 | 3300049758 | Unclassified | 2709 |
| 277 | Ga0501266_001686 | 3300049763 | Bacteria | 2811 |
| 278 | Ga0501269_000364 | 3300049766 | Bacteria | 11297 |
| 279 | Ga0501270_065367 | 3300049767 | Unclassified | 692 |
| 280 | nmdc:mga0k408_26287_c1 | 3300050493 | Bacteria | 3299 |
| 281 | Ga0500644_0000344 | 3300053088 | Bacteria | 23446 |
| 282 | Ga0500646_0092649 | 3300053090 | Bacteria | 937 |
| 283 | Ga0500583_0069161 | 3300053092 | Bacteria | 1685 |
| 284 | Ga0500651_0000680 | 3300053093 | Bacteria | 16894 |
| 285 | Ga0500651_0151546 | 3300053093 | Bacteria | 1392 |
| 286 | Ga0500566_0321691 | 3300053094 | Bacteria | 720 |
| 287 | Ga0500569_001812 | 3300053109 | Bacteria | 4098 |
| 288 | Ga0500592_030940 | 3300053116 | Bacteria | 863 |
| 289 | Ga0500652_366257 | 3300053131 | Archaea | 541 |
| 290 | Ga0500658_0006919 | 3300053134 | Bacteria | 4197 |
| 291 | Ga0500577_0001238 | 3300053142 | Bacteria | 6535 |
| 292 | Ga0500616_0023179 | 3300053153 | Bacteria | 3459 |
| 293 | Ga0500633_0000305 | 3300053160 | Bacteria | 7239 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300030744 | Ga0316181_1030788 | Ga0316181_10307881 | 94 |
| 2 | 3300031824 | Ga0307413_11938332 | Ga0307413_119383321 | 94 |
| 3 | 3300032004 | Ga0307414_10022163 | Ga0307414_100221631 | 94 |
| 4 | 3300032005 | Ga0307411_10660687 | Ga0307411_106606872 | 94 |
| 5 | 3300044658 | Ga0466972_0259898 | Ga0466972_0259898_11_298 | 95 |
| 6 | 3300014497 | Ga0182008_10000025 | Ga0182008_1000002575 | 97 |
| 7 | 3300005288 | Ga0065714_10002231 | Ga0065714_100022316 | 98 |
| 8 | 2162886007 | SwRhRL2b_contig_3757853 | SwRhRL2b_0703.00006130 | 99 |
| 9 | 3300005288 | Ga0065714_10005940 | Ga0065714_100059407 | 99 |
| 10 | 3300005289 | Ga0065704_10000218 | Ga0065704_1000021818 | 99 |
| 11 | 3300013100 | Ga0157373_10000167 | Ga0157373_1000016710 | 99 |
| 12 | 3300013102 | Ga0157371_10009312 | Ga0157371_1000931210 | 99 |
| 13 | 3300015261 | Ga0182006_1003760 | Ga0182006_10037608 | 99 |
| 14 | 3300031911 | Ga0307412_10000001 | Ga0307412_10000001497 | 99 |
| 15 | 3300032004 | Ga0307414_10002618 | Ga0307414_100026189 | 99 |
| 16 | 3300049758 | Ga0501241_004184 | Ga0501241_004184_2308_2631 | 99 |
| 17 | 3300053093 | Ga0500651_0000680 | Ga0500651_0000680_758_1081 | 99 |
| 18 | 3300053094 | Ga0500566_0321691 | Ga0500566_0321691_134_457 | 99 |
| 19 | iso_pu_bacteria | 2738541284 | 2738761512 | 102 |
| 20 | iso_pu_bacteria | 2775506987 | 2776615852 | 102 |
| 21 | 3300025916 | Ga0207663_10320959 | Ga0207663_103209592 | 103 |
| 22 | iso_pu_bacteria | 2511231000 | 2511232649 | 104 |
| 23 | iso_pu_bacteria | 2582581281 | 2585159323 | 104 |
| 24 | iso_pu_bacteria | 2582581282 | 2585163582 | 104 |
| 25 | iso_pu_bacteria | 2585428060 | 2587748025 | 104 |
| 26 | iso_pu_bacteria | 2588253712 | 2588446285 | 104 |
| 27 | iso_pu_bacteria | 2588254257 | 2590611678 | 104 |
| 28 | iso_pu_bacteria | 2739367874 | 2740057463 | 104 |
| 29 | iso_pu_bacteria | 2842083920 | 2842084065 | 104 |
| 30 | iso_pu_bacteria | 2905999023 | 2906000926 | 104 |
| 31 | iso_pu_bacteria | 2919399522 | 2919402763 | 104 |
| 32 | iso_pu_bacteria | 2946019816 | 2946021262 | 104 |
| 33 | iso_pu_bacteria | 2984572630 | 2984575806 | 104 |
| 34 | iso_pu_bacteria | 2984606641 | 2984609262 | 104 |
| 35 | iso_pu_bacteria | 2582581278 | 2585144888 | 105 |
| 36 | iso_pu_bacteria | 2585428045 | 2587678497 | 105 |
| 37 | iso_pu_bacteria | 2585428182 | 2588208491 | 105 |
| 38 | iso_pu_bacteria | 2585428183 | 2588213010 | 105 |
| 39 | iso_pu_bacteria | 2585428184 | 2588219598 | 105 |
| 40 | iso_pu_bacteria | 2585428185 | 2588224089 | 105 |
| 41 | iso_pu_bacteria | 2585428187 | 2588233594 | 105 |
| 42 | iso_pu_bacteria | 2588254255 | 2590600465 | 105 |
| 43 | iso_pu_bacteria | 2751185877 | 2753672838 | 105 |
| 44 | iso_pu_bacteria | 2765235839 | 2765572388 | 105 |
| 45 | iso_pu_bacteria | 2775506739 | 2775673025 | 105 |
| 46 | iso_pu_bacteria | 2816332188 | 2816872665 | 105 |
| 47 | iso_pu_bacteria | 2871720351 | 2871721801 | 105 |
| 48 | iso_pu_bacteria | 2889290771 | 2889291978 | 105 |
| 49 | iso_pu_bacteria | 2919097161 | 2919099442 | 105 |
| 50 | iso_pu_bacteria | 2945924605 | 2945927458 | 105 |
| 51 | iso_pu_bacteria | 2993480792 | 2993484313 | 105 |
| 52 | 3300013308 | Ga0157375_10023023 | Ga0157375_100230235 | 106 |
| 53 | 3300005834 | Ga0068851_10000104 | Ga0068851_1000010413 | 107 |
| 54 | 3300025321 | Ga0207656_10000149 | Ga0207656_1000014913 | 107 |
| 55 | 3300038443 | Ga0395901_0000875 | Ga0395901_0000875_28122_28445 | 107 |
| 56 | 3300002741 | JGI25157J39369_1004497 | JGI25157J39369_10044974 | 108 |
| 57 | 3300003320 | rootH2_10015343 | rootH2_100153434 | 108 |
| 58 | 3300003320 | rootH2_10169384 | rootH2_101693842 | 108 |
| 59 | 3300003322 | rootL2_10002205 | rootL2_100022059 | 108 |
| 60 | 3300003323 | rootH1_10005480 | rootH1_100054804 | 108 |
| 61 | 3300003354 | JGI25160J50197_1001335 | JGI25160J50197_10013353 | 108 |
| 62 | 3300005289 | Ga0065704_10080857 | Ga0065704_100808572 | 108 |
| 63 | 3300005329 | Ga0070683_100022440 | Ga0070683_1000224405 | 108 |
| 64 | 3300005337 | Ga0070682_100181673 | Ga0070682_1001816732 | 108 |
| 65 | 3300005337 | Ga0070682_100211004 | Ga0070682_1002110042 | 108 |
| 66 | 3300005366 | Ga0070659_100441754 | Ga0070659_1004417542 | 108 |
| 67 | 3300005366 | Ga0070659_101596880 | Ga0070659_1015968801 | 108 |
| 68 | 3300005367 | Ga0070667_101289137 | Ga0070667_1012891371 | 108 |
| 69 | 3300005367 | Ga0070667_101605193 | Ga0070667_1016051931 | 108 |
| 70 | 3300005439 | Ga0070711_100246085 | Ga0070711_1002460852 | 108 |
| 71 | 3300005455 | Ga0070663_100452230 | Ga0070663_1004522302 | 108 |
| 72 | 3300005456 | Ga0070678_101255192 | Ga0070678_1012551922 | 108 |
| 73 | 3300005459 | Ga0068867_100744907 | Ga0068867_1007449072 | 108 |
| 74 | 3300005535 | Ga0070684_100050020 | Ga0070684_1000500201 | 108 |
| 75 | 3300005539 | Ga0068853_100161242 | Ga0068853_1001612422 | 108 |
| 76 | 3300005548 | Ga0070665_101248575 | Ga0070665_1012485752 | 108 |
| 77 | 3300005563 | Ga0068855_100095412 | Ga0068855_1000954123 | 108 |
| 78 | 3300005563 | Ga0068855_100116173 | Ga0068855_1001161733 | 108 |
| 79 | 3300005577 | Ga0068857_100003021 | Ga0068857_1000030213 | 108 |
| 80 | 3300005577 | Ga0068857_100205849 | Ga0068857_1002058493 | 108 |
| 81 | 3300005577 | Ga0068857_100518246 | Ga0068857_1005182462 | 108 |
| 82 | 3300005577 | Ga0068857_100536706 | Ga0068857_1005367062 | 108 |
| 83 | 3300005578 | Ga0068854_100036563 | Ga0068854_1000365633 | 108 |
| 84 | 3300005614 | Ga0068856_100059007 | Ga0068856_1000590072 | 108 |
| 85 | 3300005614 | Ga0068856_100143210 | Ga0068856_1001432102 | 108 |
| 86 | 3300005616 | Ga0068852_100019464 | Ga0068852_1000194643 | 108 |
| 87 | 3300005616 | Ga0068852_100272926 | Ga0068852_1002729262 | 108 |
| 88 | 3300006195 | Ga0075366_10006071 | Ga0075366_100060716 | 108 |
| 89 | 3300006946 | Ga0079104_1000005 | Ga0079104_1000005315 | 108 |
| 90 | 3300006948 | Ga0099826_10001059 | Ga0099826_1000105911 | 108 |
| 91 | 3300009011 | Ga0105251_10050420 | Ga0105251_100504203 | 108 |
| 92 | 3300009092 | Ga0105250_10070513 | Ga0105250_100705132 | 108 |
| 93 | 3300009093 | Ga0105240_10001190 | Ga0105240_1000119022 | 108 |
| 94 | 3300009093 | Ga0105240_10050314 | Ga0105240_100503143 | 108 |
| 95 | 3300009093 | Ga0105240_10278458 | Ga0105240_102784584 | 108 |
| 96 | 3300009174 | Ga0105241_10038358 | Ga0105241_100383584 | 108 |
| 97 | 3300009174 | Ga0105241_12501172 | Ga0105241_125011721 | 108 |
| 98 | 3300009545 | Ga0105237_10030153 | Ga0105237_100301537 | 108 |
| 99 | 3300009545 | Ga0105237_10041755 | Ga0105237_100417554 | 108 |
| 100 | 3300009545 | Ga0105237_10378884 | Ga0105237_103788842 | 108 |
| 101 | 3300009551 | Ga0105238_10013926 | Ga0105238_100139263 | 108 |
| 102 | 3300009551 | Ga0105238_10040719 | Ga0105238_100407192 | 108 |
| 103 | 3300010375 | Ga0105239_10161775 | Ga0105239_101617753 | 108 |
| 104 | 3300010375 | Ga0105239_11644662 | Ga0105239_116446621 | 108 |
| 105 | 3300013100 | Ga0157373_10000002 | Ga0157373_10000002195 | 108 |
| 106 | 3300013100 | Ga0157373_10023444 | Ga0157373_100234442 | 108 |
| 107 | 3300013100 | Ga0157373_10712011 | Ga0157373_107120111 | 108 |
| 108 | 3300013102 | Ga0157371_10036644 | Ga0157371_100366442 | 108 |
| 109 | 3300013104 | Ga0157370_10000222 | Ga0157370_1000022211 | 108 |
| 110 | 3300013104 | Ga0157370_10000399 | Ga0157370_100003998 | 108 |
| 111 | 3300013104 | Ga0157370_10007094 | Ga0157370_100070946 | 108 |
| 112 | 3300013104 | Ga0157370_10007164 | Ga0157370_100071649 | 108 |
| 113 | 3300013105 | Ga0157369_10002091 | Ga0157369_1000209122 | 108 |
| 114 | 3300013105 | Ga0157369_10009719 | Ga0157369_1000971910 | 108 |
| 115 | 3300013105 | Ga0157369_11806201 | Ga0157369_118062012 | 108 |
| 116 | 3300013297 | Ga0157378_10270658 | Ga0157378_102706582 | 108 |
| 117 | 3300013307 | Ga0157372_10004157 | Ga0157372_1000415712 | 108 |
| 118 | 3300013307 | Ga0157372_10653561 | Ga0157372_106535612 | 108 |
| 119 | 3300013307 | Ga0157372_11038751 | Ga0157372_110387512 | 108 |
| 120 | 3300013308 | Ga0157375_10000846 | Ga0157375_100008469 | 108 |
| 121 | 3300015261 | Ga0182006_1000011 | Ga0182006_1000011131 | 108 |
| 122 | 3300015261 | Ga0182006_1004356 | Ga0182006_10043566 | 108 |
| 123 | 3300015261 | Ga0182006_1029884 | Ga0182006_10298843 | 108 |
| 124 | 3300015261 | Ga0182006_1048568 | Ga0182006_10485682 | 108 |
| 125 | 3300015261 | Ga0182006_1057522 | Ga0182006_10575222 | 108 |
| 126 | 3300015261 | Ga0182006_1074212 | Ga0182006_10742122 | 108 |
| 127 | 3300025245 | Ga0207425_1012556 | Ga0207425_10125562 | 108 |
| 128 | 3300025246 | Ga0209646_1000003 | Ga0209646_100000348 | 108 |
| 129 | 3300025250 | Ga0209026_1000202 | Ga0209026_100020249 | 108 |
| 130 | 3300025258 | Ga0209129_1011889 | Ga0209129_10118893 | 108 |
| 131 | 3300025302 | Ga0207426_1000364 | Ga0207426_100036440 | 108 |
| 132 | 3300025302 | Ga0207426_1135939 | Ga0207426_11359392 | 108 |
| 133 | 3300025711 | Ga0207696_1065604 | Ga0207696_10656042 | 108 |
| 134 | 3300025904 | Ga0207647_10064609 | Ga0207647_100646092 | 108 |
| 135 | 3300025911 | Ga0207654_10071802 | Ga0207654_100718024 | 108 |
| 136 | 3300025913 | Ga0207695_10280570 | Ga0207695_102805701 | 108 |
| 137 | 3300025913 | Ga0207695_10810987 | Ga0207695_108109871 | 108 |
| 138 | 3300025914 | Ga0207671_10241285 | Ga0207671_102412852 | 108 |
| 139 | 3300025924 | Ga0207694_10068459 | Ga0207694_100684592 | 108 |
| 140 | 3300025924 | Ga0207694_10926026 | Ga0207694_109260262 | 108 |
| 141 | 3300025932 | Ga0207690_10233630 | Ga0207690_102336302 | 108 |
| 142 | 3300025944 | Ga0207661_10004950 | Ga0207661_100049506 | 108 |
| 143 | 3300025949 | Ga0207667_10008002 | Ga0207667_1000800210 | 108 |
| 144 | 3300025949 | Ga0207667_10081934 | Ga0207667_100819343 | 108 |
| 145 | 3300025949 | Ga0207667_10161819 | Ga0207667_101618191 | 108 |
| 146 | 3300025981 | Ga0207640_10097729 | Ga0207640_100977293 | 108 |
| 147 | 3300025981 | Ga0207640_10354906 | Ga0207640_103549062 | 108 |
| 148 | 3300026041 | Ga0207639_10092356 | Ga0207639_100923563 | 108 |
| 149 | 3300026041 | Ga0207639_10143888 | Ga0207639_101438882 | 108 |
| 150 | 3300026067 | Ga0207678_10332754 | Ga0207678_103327542 | 108 |
| 151 | 3300026078 | Ga0207702_10055791 | Ga0207702_100557914 | 108 |
| 152 | 3300026078 | Ga0207702_10111201 | Ga0207702_101112014 | 108 |
| 153 | 3300026116 | Ga0207674_10024564 | Ga0207674_100245643 | 108 |
| 154 | 3300026116 | Ga0207674_11201084 | Ga0207674_112010841 | 108 |
| 155 | 3300026142 | Ga0207698_10008903 | Ga0207698_100089035 | 108 |
| 156 | 3300026142 | Ga0207698_10178542 | Ga0207698_101785422 | 108 |
| 157 | 3300027111 | Ga0209281_1000216 | Ga0209281_100021698 | 108 |
| 158 | 3300027666 | Ga0209282_1058737 | Ga0209282_10587373 | 108 |
| 159 | 3300028786 | Ga0307517_10522594 | Ga0307517_105225941 | 108 |
| 160 | 3300031456 | Ga0307513_10777246 | Ga0307513_107772461 | 108 |
| 161 | 3300031901 | Ga0307406_11958225 | Ga0307406_119582251 | 108 |
| 162 | 3300031911 | Ga0307412_10000012 | Ga0307412_10000012326 | 108 |
| 163 | 3300031911 | Ga0307412_10005610 | Ga0307412_100056106 | 108 |
| 164 | 3300031911 | Ga0307412_10796737 | Ga0307412_107967372 | 108 |
| 165 | 3300031995 | Ga0307409_100666717 | Ga0307409_1006667172 | 108 |
| 166 | 3300032002 | Ga0307416_100004689 | Ga0307416_1000046895 | 108 |
| 167 | 3300032004 | Ga0307414_10042917 | Ga0307414_100429175 | 108 |
| 168 | 3300032004 | Ga0307414_10251342 | Ga0307414_102513422 | 108 |
| 169 | 3300032004 | Ga0307414_10328097 | Ga0307414_103280972 | 108 |
| 170 | 3300032004 | Ga0307414_10823913 | Ga0307414_108239132 | 108 |
| 171 | 3300032005 | Ga0307411_11973069 | Ga0307411_119730691 | 108 |
| 172 | 3300041453 | Ga0451797_0462431 | Ga0451797_0462431_778_1104 | 108 |
| 173 | 3300041501 | Ga0451845_0361213 | Ga0451845_0361213_171_497 | 108 |
| 174 | 3300041505 | Ga0451849_0334274 | Ga0451849_0334274_209_535 | 108 |
| 175 | 3300041511 | Ga0451855_0689903 | Ga0451855_0689903_116_442 | 108 |
| 176 | 3300042002 | Ga0439442_052214 | Ga0439442_052214_41_367 | 108 |
| 177 | 3300042004 | Ga0439445_0000044 | Ga0439445_0000044_11334_11660 | 108 |
| 178 | 3300044656 | Ga0466969_0000443 | Ga0466969_0000443_19770_20096 | 108 |
| 179 | 3300044658 | Ga0466972_0000002 | Ga0466972_0000002_206888_207214 | 108 |
| 180 | 3300044683 | Ga0466965_0779761 | Ga0466965_0779761_118_444 | 108 |
| 181 | 3300044684 | Ga0466966_0000393 | Ga0466966_0000393_14013_14339 | 108 |
| 182 | 3300044706 | Ga0466964_0542360 | Ga0466964_0542360_131_457 | 108 |
| 183 | 3300044719 | Ga0466971_0510722 | Ga0466971_0510722_242_568 | 108 |
| 184 | 3300044765 | Ga0466970_0000489 | Ga0466970_0000489_12448_12774 | 108 |
| 185 | 3300044765 | Ga0466970_0462444 | Ga0466970_0462444_149_475 | 108 |
| 186 | 3300044842 | Ga0466957_0395403 | Ga0466957_0395403_461_787 | 108 |
| 187 | 3300045049 | Ga0466959_0000083 | Ga0466959_0000083_14042_14368 | 108 |
| 188 | 3300046453 | Ga0495627_000003 | Ga0495627_000003_484608_484934 | 108 |
| 189 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_1330758_1331084 | 108 |
| 190 | 3300046519 | Ga0495632_0509453 | Ga0495632_0509453_49_450 | 108 |
| 191 | 3300046530 | Ga0495654_0000001 | Ga0495654_0000001_631481_631807 | 108 |
| 192 | 3300046616 | Ga0495668_0008488 | Ga0495668_0008488_405_731 | 108 |
| 193 | 3300048918 | Ga0496115_0700125 | Ga0496115_0700125_50_376 | 108 |
| 194 | 3300048919 | Ga0496116_0000047 | Ga0496116_0000047_102120_102446 | 108 |
| 195 | 3300048920 | Ga0496117_0240679 | Ga0496117_0240679_503_829 | 108 |
| 196 | 3300048921 | Ga0496118_0597740 | Ga0496118_0597740_191_517 | 108 |
| 197 | 3300048924 | Ga0496121_0029873 | Ga0496121_0029873_2237_2563 | 108 |
| 198 | 3300048924 | Ga0496121_0067655 | Ga0496121_0067655_1269_1595 | 108 |
| 199 | 3300048925 | Ga0496122_0547685 | Ga0496122_0547685_121_447 | 108 |
| 200 | 3300048926 | Ga0496123_0121522 | Ga0496123_0121522_241_591 | 108 |
| 201 | 3300048927 | Ga0496124_0130573 | Ga0496124_0130573_1618_1944 | 108 |
| 202 | 3300048927 | Ga0496124_0134544 | Ga0496124_0134544_1534_1860 | 108 |
| 203 | 3300048928 | Ga0496125_0000050 | Ga0496125_0000050_209147_209473 | 108 |
| 204 | 3300048928 | Ga0496125_0413783 | Ga0496125_0413783_23_349 | 108 |
| 205 | 3300048928 | Ga0496125_0518310 | Ga0496125_0518310_49_375 | 108 |
| 206 | 3300048929 | Ga0496126_0031794 | Ga0496126_0031794_2955_3281 | 108 |
| 207 | 3300048929 | Ga0496126_0191429 | Ga0496126_0191429_416_742 | 108 |
| 208 | 3300049661 | Ga0501217_008703 | Ga0501217_008703_232_558 | 108 |
| 209 | 3300049675 | Ga0501243_002816 | Ga0501243_002816_1160_1486 | 108 |
| 210 | 3300049681 | Ga0501251_024820 | Ga0501251_024820_283_609 | 108 |
| 211 | 3300049682 | Ga0501252_018535 | Ga0501252_018535_385_711 | 108 |
| 212 | 3300049688 | Ga0501259_035508 | Ga0501259_035508_223_549 | 108 |
| 213 | 3300049708 | Ga0501245_064859 | Ga0501245_064859_93_419 | 108 |
| 214 | 3300049758 | Ga0501241_000013 | Ga0501241_000013_47585_47911 | 108 |
| 215 | 3300049763 | Ga0501266_001686 | Ga0501266_001686_1156_1482 | 108 |
| 216 | 3300049767 | Ga0501270_065367 | Ga0501270_065367_279_605 | 108 |
| 217 | 3300050493 | nmdc:mga0k408_26287_c1 | nmdc:mga0k408_26287_c1_2676_3002 | 108 |
| 218 | 3300053088 | Ga0500644_0000344 | Ga0500644_0000344_13585_13911 | 108 |
| 219 | 3300053090 | Ga0500646_0092649 | Ga0500646_0092649_186_587 | 108 |
| 220 | 3300053092 | Ga0500583_0069161 | Ga0500583_0069161_252_578 | 108 |
| 221 | 3300053093 | Ga0500651_0151546 | Ga0500651_0151546_901_1302 | 108 |
| 222 | 3300053109 | Ga0500569_001812 | Ga0500569_001812_1440_1841 | 108 |
| 223 | 3300053116 | Ga0500592_030940 | Ga0500592_030940_273_599 | 108 |
| 224 | 3300053131 | Ga0500652_366257 | Ga0500652_366257_41_367 | 108 |
| 225 | 3300053134 | Ga0500658_0006919 | Ga0500658_0006919_1351_1752 | 108 |
| 226 | 3300053142 | Ga0500577_0001238 | Ga0500577_0001238_1647_2048 | 108 |
| 227 | 3300053153 | Ga0500616_0023179 | Ga0500616_0023179_1380_1781 | 108 |
| 228 | 3300053160 | Ga0500633_0000305 | Ga0500633_0000305_6494_6820 | 108 |
| 229 | 2162886007 | SwRhRL2b_contig_1663468 | SwRhRL2b_0819.00002220 | 109 |
| 230 | 2162886007 | SwRhRL2b_contig_1985813 | SwRhRL2b_0929.00004830 | 109 |
| 231 | 2162886007 | SwRhRL2b_contig_236177 | SwRhRL2b_0618.00007510 | 109 |
| 232 | 3300003320 | rootH2_10064779 | rootH2_100647794 | 109 |
| 233 | 3300003320 | rootH2_10254400 | rootH2_102544002 | 109 |
| 234 | 3300003323 | rootH1_10097937 | rootH1_100979374 | 109 |
| 235 | 3300003354 | JGI25160J50197_1000831 | JGI25160J50197_10008318 | 109 |
| 236 | 3300003354 | JGI25160J50197_1067975 | JGI25160J50197_10679751 | 109 |
| 237 | 3300003790 | Ga0055528_1001659 | Ga0055528_10016591 | 109 |
| 238 | 3300003790 | Ga0055528_1002049 | Ga0055528_100204913 | 109 |
| 239 | 3300003791 | Ga0055530_10012562 | Ga0055530_100125623 | 109 |
| 240 | 3300003794 | Ga0055531_10067731 | Ga0055531_100677312 | 109 |
| 241 | 3300005262 | Ga0065165_1000038 | Ga0065165_1000038146 | 109 |
| 242 | 3300005289 | Ga0065704_10071407 | Ga0065704_100714075 | 109 |
| 243 | 3300005289 | Ga0065704_10075750 | Ga0065704_100757502 | 109 |
| 244 | 3300005327 | Ga0070658_10326730 | Ga0070658_103267301 | 109 |
| 245 | 3300005337 | Ga0070682_100000206 | Ga0070682_10000020637 | 109 |
| 246 | 3300005339 | Ga0070660_100273931 | Ga0070660_1002739314 | 109 |
| 247 | 3300005347 | Ga0070668_100090314 | Ga0070668_1000903144 | 109 |
| 248 | 3300005578 | Ga0068854_100634808 | Ga0068854_1006348082 | 109 |
| 249 | 3300006173 | Ga0070716_100115607 | Ga0070716_1001156072 | 109 |
| 250 | 3300006195 | Ga0075366_10329288 | Ga0075366_103292882 | 109 |
| 251 | 3300009036 | Ga0105244_10000114 | Ga0105244_1000011428 | 109 |
| 252 | 3300009036 | Ga0105244_10219259 | Ga0105244_102192591 | 109 |
| 253 | 3300009148 | Ga0105243_10000043 | Ga0105243_1000004332 | 109 |
| 254 | 3300009148 | Ga0105243_10001230 | Ga0105243_1000123014 | 109 |
| 255 | 3300010375 | Ga0105239_12256665 | Ga0105239_122566651 | 109 |
| 256 | 3300012495 | Ga0157323_1033669 | Ga0157323_10336691 | 109 |
| 257 | 3300013100 | Ga0157373_10335748 | Ga0157373_103357482 | 109 |
| 258 | 3300013102 | Ga0157371_10000019 | Ga0157371_1000001963 | 109 |
| 259 | 3300013102 | Ga0157371_10314459 | Ga0157371_103144592 | 109 |
| 260 | 3300013104 | Ga0157370_10034455 | Ga0157370_100344551 | 109 |
| 261 | 3300013104 | Ga0157370_10760367 | Ga0157370_107603671 | 109 |
| 262 | 3300013307 | Ga0157372_10008046 | Ga0157372_100080466 | 109 |
| 263 | 3300017792 | Ga0163161_10725543 | Ga0163161_107255431 | 109 |
| 264 | 3300021384 | Ga0213876_10016258 | Ga0213876_100162582 | 109 |
| 265 | 3300025273 | Ga0209673_1000123 | Ga0209673_1000123144 | 109 |
| 266 | 3300025291 | Ga0209675_1000032 | Ga0209675_1000032251 | 109 |
| 267 | 3300025295 | Ga0209564_1000705 | Ga0209564_100070516 | 109 |
| 268 | 3300025295 | Ga0209564_1002197 | Ga0209564_10021973 | 109 |
| 269 | 3300025297 | Ga0209758_1002624 | Ga0209758_10026243 | 109 |
| 270 | 3300025297 | Ga0209758_1004422 | Ga0209758_100442211 | 109 |
| 271 | 3300025297 | Ga0209758_1124170 | Ga0209758_11241702 | 109 |
| 272 | 3300025298 | Ga0209050_1000692 | Ga0209050_100069230 | 109 |
| 273 | 3300025302 | Ga0207426_1001365 | Ga0207426_100136519 | 109 |
| 274 | 3300025304 | Ga0209257_1000064 | Ga0209257_1000064117 | 109 |
| 275 | 3300025304 | Ga0209257_1010858 | Ga0209257_10108583 | 109 |
| 276 | 3300025728 | Ga0207655_1000631 | Ga0207655_100063116 | 109 |
| 277 | 3300025909 | Ga0207705_10115969 | Ga0207705_101159692 | 109 |
| 278 | 3300025935 | Ga0207709_10000021 | Ga0207709_10000021279 | 109 |
| 279 | 3300025935 | Ga0207709_10000992 | Ga0207709_100009928 | 109 |
| 280 | 3300025972 | Ga0207668_10078764 | Ga0207668_100787644 | 109 |
| 281 | 3300026067 | Ga0207678_10741792 | Ga0207678_107417921 | 109 |
| 282 | 3300031251 | Ga0265327_10000319 | Ga0265327_1000031973 | 109 |
| 283 | 3300032004 | Ga0307414_10021128 | Ga0307414_100211283 | 109 |
| 284 | 3300032004 | Ga0307414_10028680 | Ga0307414_100286802 | 109 |
| 285 | 3300032004 | Ga0307414_10088068 | Ga0307414_100880683 | 109 |
| 286 | 3300037312 | Ga0395899_0624221 | Ga0395899_0624221_284_613 | 109 |
| 287 | 3300037418 | Ga0395900_0210249 | Ga0395900_0210249_815_1144 | 109 |
| 288 | 3300037466 | Ga0395898_0915303 | Ga0395898_0915303_131_460 | 109 |
| 289 | 3300037471 | Ga0395905_0000587 | Ga0395905_0000587_36743_37072 | 109 |
| 290 | 3300038443 | Ga0395901_0720338 | Ga0395901_0720338_239_568 | 109 |
| 291 | 3300038443 | Ga0395901_1256257 | Ga0395901_1256257_119_466 | 109 |
| 292 | 3300039437 | Ga0436365_1186448 | Ga0436365_1186448_1282_1611 | 109 |
| 293 | 3300042438 | Ga0439459_0101381 | Ga0439459_0101381_312_641 | 109 |
| 294 | 3300046460 | Ga0495638_0588502 | Ga0495638_0588502_21_350 | 109 |
| 295 | 3300046500 | Ga0495596_0003542 | Ga0495596_0003542_1067_1399 | 109 |
| 296 | 3300046519 | Ga0495632_0001417 | Ga0495632_0001417_2691_3020 | 109 |
| 297 | 3300046522 | Ga0495643_0247032 | Ga0495643_0247032_350_679 | 109 |
| 298 | 3300046558 | Ga0495633_0015009 | Ga0495633_0015009_599_928 | 109 |
| 299 | 3300046691 | Ga0495670_0502473 | Ga0495670_0502473_271_603 | 109 |
| 300 | 3300047472 | Ga0495686_0000118 | Ga0495686_0000118_18720_19049 | 109 |
| 301 | 3300048904 | Ga0496101_0562815 | Ga0496101_0562815_449_778 | 109 |
| 302 | 3300048907 | Ga0496104_0605307 | Ga0496104_0605307_76_408 | 109 |
| 303 | 3300048919 | Ga0496116_0000012 | Ga0496116_0000012_72787_73119 | 109 |
| 304 | 3300048920 | Ga0496117_0000050 | Ga0496117_0000050_47318_47650 | 109 |
| 305 | 3300048920 | Ga0496117_0268131 | Ga0496117_0268131_381_710 | 109 |
| 306 | 3300048921 | Ga0496118_0000044 | Ga0496118_0000044_245105_245437 | 109 |
| 307 | 3300048922 | Ga0496119_0000002 | Ga0496119_0000002_247283_247615 | 109 |
| 308 | 3300048924 | Ga0496121_0000007 | Ga0496121_0000007_918873_919202 | 109 |
| 309 | 3300048925 | Ga0496122_0000386 | Ga0496122_0000386_68625_68957 | 109 |
| 310 | 3300048925 | Ga0496122_0000848 | Ga0496122_0000848_15714_16046 | 109 |
| 311 | 3300048925 | Ga0496122_0002418 | Ga0496122_0002418_24946_25278 | 109 |
| 312 | 3300048925 | Ga0496122_0027275 | Ga0496122_0027275_1255_1587 | 109 |
| 313 | 3300048926 | Ga0496123_0002309 | Ga0496123_0002309_22328_22660 | 109 |
| 314 | 3300048926 | Ga0496123_0014375 | Ga0496123_0014375_3110_3442 | 109 |
| 315 | 3300048927 | Ga0496124_0006605 | Ga0496124_0006605_9557_9889 | 109 |
| 316 | 3300048928 | Ga0496125_0004193 | Ga0496125_0004193_8920_9252 | 109 |
| 317 | 3300048929 | Ga0496126_0001648 | Ga0496126_0001648_3340_3672 | 109 |
| 318 | 3300048929 | Ga0496126_0009353 | Ga0496126_0009353_1407_1736 | 109 |
| 319 | 3300048929 | Ga0496126_0117506 | Ga0496126_0117506_1325_1657 | 109 |
| 320 | 3300049551 | Ga0501335_023363 | Ga0501335_023363_122_451 | 109 |
| 321 | 3300049705 | Ga0501225_0009813 | Ga0501225_0009813_579_908 | 109 |
| 322 | 3300049742 | Ga0501080_1097074 | Ga0501080_1097074_100_429 | 109 |
| 323 | 3300049758 | Ga0501241_001457 | Ga0501241_001457_3266_3595 | 109 |
| 324 | 3300049766 | Ga0501269_000364 | Ga0501269_000364_3487_3816 | 109 |
| 325 | iso_pu_bacteria | 2772190705 | 2772606573 | 109 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8tgy-assembly1.cif.gz_E | crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea | 0.9146 | 1 | 107 |
| 8tgy-assembly1.cif.gz_E | crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea | 0.9064 | 1 | 107 |
| 7ssu-assembly1.cif.gz_B | structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium | 0.8547 | 1 | 101 |
| 7mgx-assembly1.cif.gz_B | structure of emre-d3 mutant in complex with monobody l10 and methyl viologen | 0.8491 | 1 | 101 |
| 7mgx-assembly2.cif.gz_F | structure of emre-d3 mutant in complex with monobody l10 and methyl viologen | 0.8215 | 1 | 101 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P69937_1_105_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.9378 | 1 | 107 | 1.10.3730.20 |
| af_Q0DVJ4_6_84_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.9293 | 5 | 84 | 1.10.3730.20 |
| af_P69937_1_105_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.9207 | 1 | 107 | 1.10.3730.20 |
| af_I1KSB6_13_116_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.905 | 1 | 109 | 1.10.3730.20 |
| af_I1KSB6_13_116_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.897 | 1 | 109 | 1.10.3730.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258KUH7-F1-model_v4 | QacE family quaternary ammonium compound efflux SMR transporter | 0.9966 | 1 | 77 |
GO:0005886
GO:0022857 |
| AF-A0A2A3N6Z6-F1-model_v4 | deleted | 0.9942 | 1 | 106 |
|
| AF-A0A2U0ZN18-F1-model_v4 | deleted | 0.9929 | 1 | 107 |
|
| AF-A0A258KUH7-F1-model_v4 | QacE family quaternary ammonium compound efflux SMR transporter | 0.9838 | 1 | 77 |
GO:0005886
GO:0022857 |
| AF-A0A2Z6IE80-F1-model_v4 | Guanidinium exporter | 0.9816 | 2 | 106 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar