F407667

General Info

Members Datasets Scaffolds Average Seq Length
325 207 323 305

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100005503|Ga0070670_1000055033
Length 340
Sequence MTVPRDPASRSVSDAVSGRRVPEAHPTGPVDPADFNRAFAIGIVLNLLFVAVEAFYGWKVDSLALLADAGHNLSDVAGLAVAWGGALAAGMRPDARYTYGRKRASILAAFANAVLLLVAMGSLAWEALGRLRVPQPPADGVTLMVVAGIGIVVNLGTALLFLRGRHGDLNVRGAFLHMAGDALVSAGVVVTGALALRFGWPWLDPAVSLVIALVIVLGTWSLFRQSLHLLFDGVPEGIDLHAVRRELEALPGVDRVHDLHVWATGTTETALTAHLVMPDVRADDHFLEDATRRLQARFRIGHVTLQVVREPFMALCADAVPPSSSPGLANESNRTGSIPS

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
115 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
199 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
207 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.92
Nodule 0
Rhizoplane 2.77
Rhizosphere 73.54
Stem 0
Stem Tuber 0
Unclassified 10.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10016395 3300003316 Bacteria 5664
2 rootH1_10016395 3300003323 Bacteria 39282
3 Ga0070658_10336012 3300005327 Bacteria 1291
4 Ga0070676_10002874 3300005328 Bacteria 8894
5 Ga0070676_10011223 3300005328 Bacteria 4872
6 Ga0070683_100040677 3300005329 Bacteria 4274
7 Ga0070683_100181681 3300005329 Bacteria 1997
8 Ga0070670_100005503 3300005331 Bacteria 10686
9 Ga0070670_100155998 3300005331 Bacteria 1977
10 Ga0070677_10001348 3300005333 Bacteria 7834
11 Ga0070677_10016579 3300005333 Bacteria 2626
12 Ga0070677_10093314 3300005333 Bacteria 1313
13 Ga0068869_100007456 3300005334 Bacteria 6995
14 Ga0068869_100197662 3300005334 Bacteria 1584
15 Ga0070680_100011528 3300005336 Bacteria 6840
16 Ga0068868_100100358 3300005338 Bacteria 2342
17 Ga0070660_100202683 3300005339 Bacteria 1609
18 Ga0070661_100148927 3300005344 Bacteria 1768
19 Ga0070668_100000387 3300005347 Bacteria 29141
20 Ga0070669_100013992 3300005353 Bacteria 5706
21 Ga0070675_100000811 3300005354 Bacteria 22016
22 Ga0070675_100002494 3300005354 Bacteria 13776
23 Ga0070675_100032057 3300005354 Bacteria 4250
24 Ga0070675_100053151 3300005354 Bacteria 3331
25 Ga0070675_100132339 3300005354 Bacteria 2126
26 Ga0070675_100201446 3300005354 Bacteria 1728
27 Ga0070671_100029734 3300005355 Bacteria 4506
28 Ga0070671_100043264 3300005355 Bacteria 3743
29 Ga0070671_100133172 3300005355 Bacteria 2094
30 Ga0070671_100158526 3300005355 Bacteria 1913
31 Ga0070674_100032959 3300005356 Bacteria 3444
32 Ga0070673_100009675 3300005364 Bacteria 6483
33 Ga0070673_100027447 3300005364 Bacteria 4221
34 Ga0070673_100180736 3300005364 Bacteria 1806
35 Ga0070667_100002072 3300005367 Bacteria 17742
36 Ga0070667_100024146 3300005367 Bacteria 5049
37 Ga0070663_100024312 3300005455 Bacteria 4075
38 Ga0070663_100185237 3300005455 Bacteria 1617
39 Ga0070678_100108731 3300005456 Bacteria 2165
40 Ga0070678_100278572 3300005456 Bacteria 1413
41 Ga0070662_100011370 3300005457 Bacteria 5875
42 Ga0070662_100064139 3300005457 Bacteria 2689
43 Ga0068867_100003441 3300005459 Bacteria 11133
44 Ga0068867_100017549 3300005459 Bacteria 5082
45 Ga0068867_100022167 3300005459 Bacteria 4538
46 Ga0070706_100003212 3300005467 Bacteria 16141
47 Ga0070707_100091325 3300005468 Bacteria 2948
48 Ga0070679_100013748 3300005530 Bacteria 7754
49 Ga0068853_100230003 3300005539 Bacteria 1696
50 Ga0070672_100005290 3300005543 Bacteria 8541
51 Ga0070665_100003128 3300005548 Bacteria 17825
52 Ga0070665_100012781 3300005548 Bacteria 8458
53 Ga0070664_100201548 3300005564 Bacteria 1776
54 Ga0068857_100061892 3300005577 Bacteria 3326
55 Ga0068857_100201061 3300005577 Bacteria 1816
56 Ga0068854_100002276 3300005578 Bacteria 11815
57 Ga0068854_100055466 3300005578 Bacteria 2853
58 Ga0068854_100105943 3300005578 Bacteria 2114
59 Ga0068852_100008274 3300005616 Bacteria 7654
60 Ga0068852_100155488 3300005616 Bacteria 2130
61 Ga0068859_100091336 3300005617 Bacteria 3095
62 Ga0068864_100006860 3300005618 Bacteria 9330
63 Ga0068864_100020590 3300005618 Bacteria 5518
64 Ga0068861_100007201 3300005719 Bacteria 7622
65 Ga0068851_10075809 3300005834 Bacteria 1748
66 Ga0068870_10010036 3300005840 Bacteria 4332
67 Ga0068863_100011702 3300005841 Bacteria 8485
68 Ga0068863_100230451 3300005841 Bacteria 1786
69 Ga0068858_100123069 3300005842 Bacteria 2427
70 Ga0068858_100306479 3300005842 Bacteria 1516
71 Ga0068858_100349778 3300005842 Bacteria 1416
72 Ga0068860_100309884 3300005843 Bacteria 1548
73 Ga0068862_100097846 3300005844 Bacteria 2562
74 Ga0075368_10002119 3300006042 Bacteria 6405
75 Ga0075368_10031925 3300006042 Bacteria 2044
76 Ga0075362_10004079 3300006177 Bacteria 5206
77 Ga0075362_10048350 3300006177 Bacteria 1898
78 Ga0075367_10004037 3300006178 Bacteria 7100
79 Ga0075366_10001252 3300006195 Bacteria 12602
80 Ga0075366_10024936 3300006195 Bacteria 3489
81 Ga0075366_10073292 3300006195 Bacteria 2041
82 Ga0097621_100011993 3300006237 Bacteria 6413
83 Ga0097621_100175287 3300006237 Bacteria 1850
84 Ga0075370_10000505 3300006353 Bacteria 14819
85 Ga0075370_10000533 3300006353 Bacteria 14584
86 Ga0075370_10000983 3300006353 Bacteria 11796
87 Ga0075370_10026902 3300006353 Bacteria 3189
88 Ga0075370_10058015 3300006353 Bacteria 2201
89 Ga0068871_100016332 3300006358 Bacteria 5588
90 Ga0068871_100016640 3300006358 Bacteria 5547
91 Ga0075434_100213250 3300006871 Bacteria 1951
92 Ga0097620_100091332 3300006931 Bacteria 3095
93 Ga0105240_10302027 3300009093 Bacteria 1831
94 Ga0105245_10019544 3300009098 Bacteria 5934
95 Ga0105245_10057984 3300009098 Bacteria 3485
96 Ga0105243_10045598 3300009148 Bacteria 3445
97 Ga0105241_10022727 3300009174 Bacteria 4647
98 Ga0105237_10045653 3300009545 Bacteria 4408
99 Ga0105238_10099811 3300009551 Bacteria 2886
100 Ga0105249_10100333 3300009553 Bacteria 2722
101 Ga0105239_10045083 3300010375 Bacteria 4833
102 Ga0105239_10070831 3300010375 Bacteria 3830
103 Ga0157371_10029521 3300013102 Bacteria 3963
104 Ga0157369_10695324 3300013105 Bacteria 1047
105 Ga0157374_10011182 3300013296 Bacteria 7758
106 Ga0163162_10082804 3300013306 Bacteria 3281
107 Ga0157372_10031358 3300013307 Bacteria 5821
108 Ga0157375_10037585 3300013308 Bacteria 4640
109 Ga0157375_10060676 3300013308 Bacteria 3752
110 Ga0157377_10006411 3300014745 Bacteria 5611
111 Ga0157376_10005452 3300014969 Bacteria 8893
112 Ga0163161_10268134 3300017792 Bacteria 1335
113 Ga0209026_1001241 3300025250 Bacteria 11674
114 Ga0207697_10017407 3300025315 Bacteria 2954
115 Ga0207682_10000902 3300025893 Bacteria 13752
116 Ga0207682_10079594 3300025893 Bacteria 1402
117 Ga0207688_10082591 3300025901 Bacteria 1836
118 Ga0207645_10002682 3300025907 Bacteria 13864
119 Ga0207645_10007284 3300025907 Bacteria 7824
120 Ga0207645_10033862 3300025907 Bacteria 3283
121 Ga0207643_10081971 3300025908 Bacteria 1870
122 Ga0207684_10001976 3300025910 Bacteria 21165
123 Ga0207671_10045353 3300025914 Bacteria 3251
124 Ga0207671_10083430 3300025914 Bacteria 2399
125 Ga0207660_10023759 3300025917 Bacteria 4142
126 Ga0207657_10139335 3300025919 Bacteria 1983
127 Ga0207652_10016775 3300025921 Bacteria 5984
128 Ga0207646_10040066 3300025922 Bacteria 4214
129 Ga0207650_10000580 3300025925 Bacteria 29427
130 Ga0207650_10019257 3300025925 Bacteria 4793
131 Ga0207650_10043291 3300025925 Bacteria 3304
132 Ga0207659_10002887 3300025926 Bacteria 10226
133 Ga0207659_10004403 3300025926 Bacteria 8512
134 Ga0207659_10013599 3300025926 Bacteria 5219
135 Ga0207659_10187568 3300025926 Bacteria 1643
136 Ga0207659_10297936 3300025926 Bacteria 1323
137 Ga0207687_10009282 3300025927 Bacteria 6434
138 Ga0207644_10003339 3300025931 Bacteria 10351
139 Ga0207644_10015161 3300025931 Bacteria 5171
140 Ga0207644_10020707 3300025931 Bacteria 4475
141 Ga0207644_10101367 3300025931 Bacteria 2163
142 Ga0207706_10004799 3300025933 Bacteria 12661
143 Ga0207709_10035286 3300025935 Bacteria 2956
144 Ga0207669_10009375 3300025937 Bacteria 4658
145 Ga0207669_10028042 3300025937 Bacteria 3092
146 Ga0207691_10026833 3300025940 Bacteria 5404
147 Ga0207689_10001372 3300025942 Bacteria 23344
148 Ga0207689_10030787 3300025942 Bacteria 4471
149 Ga0207689_10120524 3300025942 Bacteria 2158
150 Ga0207661_10102204 3300025944 Bacteria 2409
151 Ga0207679_10166911 3300025945 Bacteria 1808
152 Ga0207679_10229017 3300025945 Bacteria 1568
153 Ga0207651_10013527 3300025960 Bacteria 4673
154 Ga0207651_10014111 3300025960 Bacteria 4601
155 Ga0207712_10108196 3300025961 Bacteria 2080
156 Ga0207668_10000019 3300025972 Bacteria 152108
157 Ga0207640_10008779 3300025981 Bacteria 5627
158 Ga0207640_10046154 3300025981 Bacteria 2801
159 Ga0207658_10008774 3300025986 Bacteria 6864
160 Ga0207658_10087666 3300025986 Bacteria 2404
161 Ga0207677_10001471 3300026023 Bacteria 12473
162 Ga0207677_10023806 3300026023 Bacteria 3790
163 Ga0207677_10024773 3300026023 Bacteria 3733
164 Ga0207703_10053286 3300026035 Bacteria 3288
165 Ga0207703_10277524 3300026035 Bacteria 1521
166 Ga0207703_10303542 3300026035 Bacteria 1457
167 Ga0207639_10044585 3300026041 Bacteria 3336
168 Ga0207678_10007734 3300026067 Bacteria 9495
169 Ga0207702_10056465 3300026078 Bacteria 3334
170 Ga0207702_10464933 3300026078 Bacteria 1229
171 Ga0207641_10048710 3300026088 Bacteria 3578
172 Ga0207648_10003099 3300026089 Bacteria 17554
173 Ga0207648_10003741 3300026089 Bacteria 15906
174 Ga0207676_10013888 3300026095 Bacteria 5782
175 Ga0207676_10020756 3300026095 Bacteria 4810
176 Ga0207676_10027635 3300026095 Bacteria 4228
177 Ga0207674_10028708 3300026116 Bacteria 5868
178 Ga0207675_100005156 3300026118 Bacteria 12584
179 Ga0207683_10004944 3300026121 Bacteria 11467
180 Ga0207698_10171997 3300026142 Bacteria 1909
181 Ga0207698_10252525 3300026142 Bacteria 1615
182 Ga0268266_10002885 3300028379 Bacteria 17854
183 Ga0268266_10035150 3300028379 Bacteria 4262
184 Ga0268264_10224964 3300028381 Bacteria 1729
185 Ga0307517_10000394 3300028786 Bacteria 74695
186 Ga0307517_10002371 3300028786 Bacteria 30326
187 Ga0307517_10068490 3300028786 Bacteria 3232
188 Ga0307517_10097433 3300028786 Bacteria 2348
189 Ga0307515_10034576 3300028794 Bacteria 8264
190 Ga0307515_10048040 3300028794 Bacteria 6464
191 Ga0265324_10000205 3300029957 Bacteria 45035
192 Ga0307512_10018166 3300030522 Bacteria 6430
193 Ga0307512_10108949 3300030522 Bacteria 1835
194 Ga0265332_10000037 3300031238 Bacteria 134250
195 Ga0265328_10006004 3300031239 Bacteria 5172
196 Ga0265320_10037383 3300031240 Bacteria 2445
197 Ga0265325_10012582 3300031241 Bacteria 4834
198 Ga0265331_10001917 3300031250 Bacteria 14580
199 Ga0265327_10016337 3300031251 Bacteria 4718
200 Ga0265327_10023943 3300031251 Unclassified 3599
201 Ga0265316_10016992 3300031344 Bacteria 6300
202 Ga0265316_10270778 3300031344 Bacteria 1243
203 Ga0307513_10032604 3300031456 Bacteria 5871
204 Ga0307513_10091581 3300031456 Bacteria 3098
205 Ga0307513_10097702 3300031456 Bacteria 2971
206 Ga0307513_10182027 3300031456 Bacteria 1963
207 Ga0307509_10001869 3300031507 Bacteria 34796
208 Ga0307509_10014864 3300031507 Bacteria 9124
209 Ga0307509_10052233 3300031507 Bacteria 4364
210 Ga0307509_10147664 3300031507 Bacteria 2273
211 Ga0307508_10000150 3300031616 Bacteria 83110
212 Ga0307508_10003594 3300031616 Bacteria 15591
213 Ga0307508_10076742 3300031616 Bacteria 2919
214 Ga0307514_10008353 3300031649 Bacteria 8836
215 Ga0265314_10000740 3300031711 Bacteria 39277
216 Ga0265314_10008059 3300031711 Bacteria 9068
217 Ga0307516_10001680 3300031730 Bacteria 30456
218 Ga0307516_10041912 3300031730 Bacteria 4545
219 Ga0307516_10045381 3300031730 Bacteria 4341
220 Ga0307405_10015836 3300031731 Bacteria 4094
221 Ga0307413_10127203 3300031824 Bacteria 1737
222 Ga0307406_10006930 3300031901 Bacteria 6276
223 Ga0307412_10002558 3300031911 Bacteria 10107
224 Ga0307409_100001798 3300031995 Bacteria 10845
225 Ga0307409_100168538 3300031995 Bacteria 1925
226 Ga0307416_100130733 3300032002 Bacteria 2259
227 Ga0307416_100151368 3300032002 Bacteria 2128
228 Ga0307411_10355871 3300032005 Bacteria 1195
229 Ga0307415_100034430 3300032126 Bacteria 3298
230 Ga0307415_100089606 3300032126 Bacteria 2222
231 Ga0307507_10042869 3300033179 Bacteria 4499
232 Ga0307510_10000360 3300033180 Bacteria 42908
233 Ga0373960_0021481 3300035121 Bacteria 1717
234 Ga0373946_0096354 3300035171 Bacteria 1319
235 Ga0373931_0005739 3300035691 Bacteria 5767
236 Ga0373933_0120202 3300035724 Bacteria 1645
237 Ga0395899_0010271 3300037312 Bacteria 7176
238 Ga0395900_0030783 3300037418 Bacteria 5511
239 Ga0395898_0037189 3300037466 Bacteria 4830
240 Ga0436364_1102035 3300037853 Bacteria 2407
241 Ga0395901_0040356 3300038443 Bacteria 4833
242 Ga0436365_1045043 3300039437 Bacteria 3188
243 Ga0451577_0010403 3300042876 Bacteria 8898
244 Ga0451577_0043679 3300042876 Bacteria 4014
245 Ga0453683_0003052 3300044673 Bacteria 12538
246 Ga0453684_0013764 3300044712 Bacteria 13080
247 Ga0453684_0027491 3300044712 Bacteria 8155
248 Ga0453684_0177518 3300044712 Bacteria 2503
249 Ga0466957_0136699 3300044842 Bacteria 1576
250 Ga0451576_0004366 3300045051 Bacteria 18441
251 Ga0451576_0017689 3300045051 Bacteria 7835
252 Ga0451576_0075815 3300045051 Bacteria 3500
253 Ga0451576_0119061 3300045051 Bacteria 2749
254 Ga0495592_0000145 3300046454 Bacteria 62850
255 Ga0495643_0138148 3300046522 Bacteria 1218
256 Ga0495598_0064335 3300046537 Bacteria 1139
257 Ga0495597_0023805 3300046542 Bacteria 2831
258 Ga0495645_0017626 3300046543 Bacteria 5117
259 Ga0495668_0037292 3300046616 Bacteria 2720
260 Ga0495625_0012800 3300046660 Bacteria 6782
261 Ga0495625_0086942 3300046660 Bacteria 2168
262 Ga0495647_0045227 3300046681 Bacteria 1691
263 Ga0495658_0207895 3300046683 Bacteria 1222
264 Ga0495669_0076481 3300046684 Bacteria 1532
265 Ga0495613_0000559 3300046689 Bacteria 30599
266 Ga0495649_0022635 3300046694 Bacteria 3516
267 Ga0495660_0009993 3300046810 Bacteria 5521
268 Ga0495687_002674 3300047443 Bacteria 13880
269 Ga0495687_012461 3300047443 Bacteria 4494
270 Ga0495593_0125960 3300047673 Bacteria 1302
271 Ga0496101_0056855 3300048904 Bacteria 2828
272 Ga0496102_0030746 3300048905 Bacteria 4808
273 Ga0496106_0027054 3300048909 Bacteria 4270
274 Ga0496107_0039938 3300048910 Bacteria 3367
275 Ga0496110_0011602 3300048913 Bacteria 7223
276 Ga0496110_0032095 3300048913 Bacteria 4533
277 Ga0496114_0022175 3300048917 Bacteria 5173
278 Ga0496114_0029409 3300048917 Bacteria 4516
279 Ga0496115_0030737 3300048918 Bacteria 4227
280 Ga0496118_0028623 3300048921 Bacteria 4688
281 Ga0496121_0000078 3300048924 Bacteria 233455
282 Ga0496126_0013746 3300048929 Bacteria 8210
283 Ga0496126_0057963 3300048929 Bacteria 3493
284 Ga0501033_0119673 3300049570 Bacteria 1912
285 Ga0501034_0048718 3300049571 Bacteria 4276
286 Ga0501034_0092626 3300049571 Bacteria 3019
287 Ga0501036_0230399 3300049572 Bacteria 1555
288 Ga0501038_0098720 3300049574 Bacteria 2435
289 Ga0501047_0099411 3300049581 Bacteria 2788
290 Ga0501047_0173493 3300049581 Bacteria 2025
291 Ga0501070_0159062 3300049586 Bacteria 1863
292 Ga0501044_0070986 3300049823 Bacteria 3542
293 nmdc:mga03683_3203_c1 3300050489 Bacteria 5232
294 nmdc:mga03683_32980_c1 3300050489 Bacteria 2086
295 nmdc:mga0yw44_200578_c1 3300050492 Bacteria 1317
296 nmdc:mga0k408_12958_c1 3300050493 Bacteria 4565
297 nmdc:mga0k408_1837_c1 3300050493 Bacteria 11392
298 nmdc:mga0k408_27059_c1 3300050493 Bacteria 3255
299 nmdc:mga0k408_46296_c1 3300050493 Bacteria 2512
300 nmdc:mga0k408_57903_c1 3300050493 Bacteria 2250
301 nmdc:mga0k408_8189_c1 3300050493 Bacteria 5603
302 nmdc:mga06z11_214390_c1 3300050494 Bacteria 1123
303 nmdc:mga07m45_118740_c1 3300050496 Bacteria 1527
304 nmdc:mga07m45_2072_c1 3300050496 Bacteria 9311
305 nmdc:mga07m45_50459_c1 3300050496 Bacteria 2345
306 nmdc:mga0n895_175112_c1 3300050512 Bacteria 2176
307 Ga0495619_0171843 3300053085 Bacteria 1499
308 Ga0500578_0099134 3300053086 Bacteria 1845
309 Ga0500555_011888 3300053103 Bacteria 2503
310 Ga0500556_0003618 3300053104 Bacteria 4501
311 Ga0500593_107204 3300053117 Bacteria 1155
312 Ga0500595_016826 3300053119 Bacteria 2716
313 Ga0500652_125628 3300053131 Bacteria 1071
314 Ga0500658_0018775 3300053134 Bacteria 2597
315 Ga0500559_0000107 3300053136 Bacteria 65560
316 Ga0500568_0049958 3300053139 Bacteria 1649
317 Ga0500619_034772 3300053154 Bacteria 1559
318 Ga0500622_0004859 3300053156 Bacteria 8234
319 Ga0500636_0037579 3300053177 Bacteria 2865
320 Ga0500636_0062503 3300053177 Bacteria 2171
321 Ga0500645_001321 3300053730 Bacteria 12861
322 Ga0500587_002450 3300053739 Bacteria 2638
323 Ga0500587_004859 3300053739 Bacteria 1833

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025250 Ga0209026_1001241 Ga0209026_10012416 250
2 3300044842 Ga0466957_0136699 Ga0466957_0136699_528_1409 252
3 3300028786 Ga0307517_10002371 Ga0307517_100023712 253
4 3300031730 Ga0307516_10045381 Ga0307516_100453812 254
5 3300026041 Ga0207639_10044585 Ga0207639_100445852 255
6 3300049570 Ga0501033_0119673 Ga0501033_0119673_124_1056 257
7 3300049586 Ga0501070_0159062 Ga0501070_0159062_35_967 257
8 3300049571 Ga0501034_0092626 Ga0501034_0092626_1412_2344 263
9 3300049574 Ga0501038_0098720 Ga0501038_0098720_1098_2030 263
10 3300049581 Ga0501047_0099411 Ga0501047_0099411_516_1448 263
11 3300049823 Ga0501044_0070986 Ga0501044_0070986_2045_2977 263
12 3300053119 Ga0500595_016826 Ga0500595_016826_1391_2197 265
13 3300053177 Ga0500636_0037579 Ga0500636_0037579_1060_1992 265
14 3300005336 Ga0070680_100011528 Ga0070680_1000115286 268
15 3300005530 Ga0070679_100013748 Ga0070679_1000137486 268
16 3300025921 Ga0207652_10016775 Ga0207652_100167755 268
17 3300005347 Ga0070668_100000387 Ga0070668_1000003873 269
18 3300025972 Ga0207668_10000019 Ga0207668_1000001916 269
19 3300031344 Ga0265316_10270778 Ga0265316_102707782 269
20 3300044673 Ga0453683_0003052 Ga0453683_0003052_8477_9397 270
21 3300045051 Ga0451576_0004366 Ga0451576_0004366_14923_15843 270
22 3300005548 Ga0070665_100003128 Ga0070665_1000031289 272
23 3300028379 Ga0268266_10002885 Ga0268266_100028859 272
24 3300037853 Ga0436364_1102035 Ga0436364_1102035_475_1341 272
25 3300039437 Ga0436365_1045043 Ga0436365_1045043_1415_2281 272
26 3300053103 Ga0500555_011888 Ga0500555_011888_1479_2345 272
27 3300053104 Ga0500556_0003618 Ga0500556_0003618_3315_4310 272
28 3300048913 Ga0496110_0011602 Ga0496110_0011602_4582_5451 273
29 3300044712 Ga0453684_0177518 Ga0453684_0177518_189_1142 274
30 iso_pu_bacteria 8055225921 8055226676 274
31 3300005329 Ga0070683_100040677 Ga0070683_1000406774 275
32 3300005577 Ga0068857_100201061 Ga0068857_1002010611 275
33 3300025944 Ga0207661_10102204 Ga0207661_101022043 275
34 3300005329 Ga0070683_100181681 Ga0070683_1001816812 276
35 3300005548 Ga0070665_100012781 Ga0070665_1000127815 276
36 3300005618 Ga0068864_100020590 Ga0068864_1000205904 276
37 3300026035 Ga0207703_10303542 Ga0207703_103035422 276
38 3300026095 Ga0207676_10027635 Ga0207676_100276352 276
39 3300028379 Ga0268266_10035150 Ga0268266_100351504 276
40 3300028786 Ga0307517_10097433 Ga0307517_100974332 276
41 3300031240 Ga0265320_10037383 Ga0265320_100373832 276
42 3300031711 Ga0265314_10008059 Ga0265314_100080593 276
43 3300037418 Ga0395900_0030783 Ga0395900_0030783_596_1648 276
44 3300046684 Ga0495669_0076481 Ga0495669_0076481_358_1365 276
45 3300046689 Ga0495613_0000559 Ga0495613_0000559_20028_21050 276
46 3300048929 Ga0496126_0057963 Ga0496126_0057963_1291_2187 276
47 3300050493 nmdc:mga0k408_1837_c1 nmdc:mga0k408_1837_c1_2196_3191 276
48 3300005617 Ga0068859_100091336 Ga0068859_1000913363 277
49 3300005841 Ga0068863_100011702 Ga0068863_1000117025 277
50 3300005842 Ga0068858_100306479 Ga0068858_1003064791 277
51 3300005842 Ga0068858_100349778 Ga0068858_1003497782 277
52 3300006931 Ga0097620_100091332 Ga0097620_1000913323 277
53 3300009098 Ga0105245_10057984 Ga0105245_100579843 277
54 3300025927 Ga0207687_10009282 Ga0207687_100092823 277
55 3300026035 Ga0207703_10053286 Ga0207703_100532863 277
56 3300026088 Ga0207641_10048710 Ga0207641_100487104 277
57 3300026095 Ga0207676_10020756 Ga0207676_100207562 277
58 3300031344 Ga0265316_10016992 Ga0265316_100169921 277
59 3300031507 Ga0307509_10147664 Ga0307509_101476641 277
60 3300046616 Ga0495668_0037292 Ga0495668_0037292_639_1688 277
61 3300048921 Ga0496118_0028623 Ga0496118_0028623_447_1397 277
62 3300048924 Ga0496121_0000078 Ga0496121_0000078_87937_88887 277
63 3300048929 Ga0496126_0013746 Ga0496126_0013746_1535_2485 277
64 3300049572 Ga0501036_0230399 Ga0501036_0230399_555_1517 277
65 3300049581 Ga0501047_0173493 Ga0501047_0173493_479_1441 277
66 3300053117 Ga0500593_107204 Ga0500593_107204_169_1125 277
67 3300031239 Ga0265328_10006004 Ga0265328_100060041 278
68 3300031250 Ga0265331_10001917 Ga0265331_100019176 278
69 3300031251 Ga0265327_10016337 Ga0265327_100163374 278
70 3300037312 Ga0395899_0010271 Ga0395899_0010271_4222_5205 278
71 3300037466 Ga0395898_0037189 Ga0395898_0037189_592_1575 278
72 3300038443 Ga0395901_0040356 Ga0395901_0040356_3256_4239 278
73 3300025917 Ga0207660_10023759 Ga0207660_100237591 279
74 3300028794 Ga0307515_10048040 Ga0307515_100480404 279
75 3300046683 Ga0495658_0207895 Ga0495658_0207895_132_1139 279
76 3300049571 Ga0501034_0048718 Ga0501034_0048718_1124_2083 279
77 3300028786 Ga0307517_10000394 Ga0307517_1000039468 280
78 3300030522 Ga0307512_10108949 Ga0307512_101089492 280
79 3300031507 Ga0307509_10014864 Ga0307509_100148648 280
80 3300031616 Ga0307508_10076742 Ga0307508_100767422 280
81 3300033179 Ga0307507_10042869 Ga0307507_100428694 280
82 3300033180 Ga0307510_10000360 Ga0307510_1000036016 280
83 3300047673 Ga0495593_0125960 Ga0495593_0125960_162_1139 280
84 3300053131 Ga0500652_125628 Ga0500652_125628_27_1061 280
85 3300025926 Ga0207659_10297936 Ga0207659_102979363 281
86 3300028786 Ga0307517_10068490 Ga0307517_100684904 281
87 3300031456 Ga0307513_10091581 Ga0307513_100915813 281
88 3300031616 Ga0307508_10000150 Ga0307508_1000015038 281
89 3300031616 Ga0307508_10003594 Ga0307508_100035946 281
90 3300042876 Ga0451577_0043679 Ga0451577_0043679_2409_3329 281
91 3300044712 Ga0453684_0027491 Ga0453684_0027491_6985_7905 281
92 3300046660 Ga0495625_0086942 Ga0495625_0086942_804_1784 281
93 3300029957 Ga0265324_10000205 Ga0265324_1000020511 282
94 3300031241 Ga0265325_10012582 Ga0265325_100125822 282
95 3300031507 Ga0307509_10052233 Ga0307509_100522337 282
96 3300031711 Ga0265314_10000740 Ga0265314_1000074020 282
97 3300031995 Ga0307409_100001798 Ga0307409_1000017983 282
98 3300032002 Ga0307416_100130733 Ga0307416_1001307332 282
99 3300032005 Ga0307411_10355871 Ga0307411_103558712 282
100 3300032126 Ga0307415_100034430 Ga0307415_1000344303 282
101 3300042876 Ga0451577_0010403 Ga0451577_0010403_1888_2796 282
102 3300045051 Ga0451576_0017689 Ga0451576_0017689_889_1797 282
103 3300045051 Ga0451576_0119061 Ga0451576_0119061_1486_2394 282
104 3300025914 Ga0207671_10083430 Ga0207671_100834302 283
105 3300026078 Ga0207702_10056465 Ga0207702_100564652 283
106 3300031238 Ga0265332_10000037 Ga0265332_100000375 283
107 3300031251 Ga0265327_10023943 Ga0265327_100239432 283
108 3300044712 Ga0453684_0013764 Ga0453684_0013764_2544_3602 285
109 3300026142 Ga0207698_10252525 Ga0207698_102525253 286
110 3300046681 Ga0495647_0045227 Ga0495647_0045227_32_1093 286
111 iso_pu_bacteria 2919704043 2919708909 286
112 3300013102 Ga0157371_10029521 Ga0157371_100295213 287
113 3300013105 Ga0157369_10695324 Ga0157369_106953241 287
114 3300035724 Ga0373933_0120202 Ga0373933_0120202_538_1575 287
115 3300053085 Ga0495619_0171843 Ga0495619_0171843_302_1339 287
116 3300053086 Ga0500578_0099134 Ga0500578_0099134_404_1438 287
117 3300053730 Ga0500645_001321 Ga0500645_001321_2713_3747 287
118 3300053739 Ga0500587_004859 Ga0500587_004859_581_1615 287
119 3300005331 Ga0070670_100155998 Ga0070670_1001559982 288
120 3300005334 Ga0068869_100197662 Ga0068869_1001976622 288
121 3300005338 Ga0068868_100100358 Ga0068868_1001003583 288
122 3300005354 Ga0070675_100053151 Ga0070675_1000531514 288
123 3300005355 Ga0070671_100029734 Ga0070671_1000297342 288
124 3300005364 Ga0070673_100180736 Ga0070673_1001807362 288
125 3300005367 Ga0070667_100002072 Ga0070667_1000020727 288
126 3300005367 Ga0070667_100024146 Ga0070667_1000241462 288
127 3300005457 Ga0070662_100064139 Ga0070662_1000641392 288
128 3300005459 Ga0068867_100003441 Ga0068867_1000034414 288
129 3300005468 Ga0070707_100091325 Ga0070707_1000913252 288
130 3300005564 Ga0070664_100201548 Ga0070664_1002015482 288
131 3300013308 Ga0157375_10037585 Ga0157375_100375854 288
132 3300025907 Ga0207645_10002682 Ga0207645_1000268218 288
133 3300025922 Ga0207646_10040066 Ga0207646_100400662 288
134 3300025925 Ga0207650_10043291 Ga0207650_100432914 288
135 3300025926 Ga0207659_10013599 Ga0207659_100135992 288
136 3300025931 Ga0207644_10015161 Ga0207644_100151612 288
137 3300025942 Ga0207689_10120524 Ga0207689_101205242 288
138 3300025960 Ga0207651_10013527 Ga0207651_100135272 288
139 3300025986 Ga0207658_10008774 Ga0207658_100087745 288
140 3300026023 Ga0207677_10023806 Ga0207677_100238064 288
141 3300026089 Ga0207648_10003099 Ga0207648_1000309911 288
142 3300031456 Ga0307513_10097702 Ga0307513_100977022 288
143 3300046543 Ga0495645_0017626 Ga0495645_0017626_4047_5069 288
144 3300050493 nmdc:mga0k408_57903_c1 nmdc:mga0k408_57903_c1_111_1178 288
145 3300005327 Ga0070658_10336012 Ga0070658_103360121 289
146 3300005328 Ga0070676_10011223 Ga0070676_100112232 289
147 3300005333 Ga0070677_10016579 Ga0070677_100165792 289
148 3300005334 Ga0068869_100007456 Ga0068869_1000074565 289
149 3300005339 Ga0070660_100202683 Ga0070660_1002026832 289
150 3300005344 Ga0070661_100148927 Ga0070661_1001489271 289
151 3300005354 Ga0070675_100002494 Ga0070675_10000249412 289
152 3300005354 Ga0070675_100032057 Ga0070675_1000320572 289
153 3300005355 Ga0070671_100158526 Ga0070671_1001585261 289
154 3300005364 Ga0070673_100009675 Ga0070673_1000096755 289
155 3300005455 Ga0070663_100185237 Ga0070663_1001852372 289
156 3300005456 Ga0070678_100108731 Ga0070678_1001087312 289
157 3300005457 Ga0070662_100011370 Ga0070662_1000113704 289
158 3300005543 Ga0070672_100005290 Ga0070672_1000052905 289
159 3300005578 Ga0068854_100002276 Ga0068854_1000022766 289
160 3300005616 Ga0068852_100008274 Ga0068852_1000082742 289
161 3300005618 Ga0068864_100006860 Ga0068864_10000686012 289
162 3300005719 Ga0068861_100007201 Ga0068861_1000072016 289
163 3300005841 Ga0068863_100230451 Ga0068863_1002304512 289
164 3300005842 Ga0068858_100123069 Ga0068858_1001230692 289
165 3300005844 Ga0068862_100097846 Ga0068862_1000978462 289
166 3300006237 Ga0097621_100011993 Ga0097621_1000119935 289
167 3300006237 Ga0097621_100175287 Ga0097621_1001752872 289
168 3300006358 Ga0068871_100016332 Ga0068871_1000163327 289
169 3300006358 Ga0068871_100016640 Ga0068871_1000166405 289
170 3300006871 Ga0075434_100213250 Ga0075434_1002132502 289
171 3300009098 Ga0105245_10019544 Ga0105245_100195444 289
172 3300009148 Ga0105243_10045598 Ga0105243_100455982 289
173 3300009174 Ga0105241_10022727 Ga0105241_100227274 289
174 3300009545 Ga0105237_10045653 Ga0105237_100456534 289
175 3300009551 Ga0105238_10099811 Ga0105238_100998114 289
176 3300009553 Ga0105249_10100333 Ga0105249_101003332 289
177 3300010375 Ga0105239_10070831 Ga0105239_100708313 289
178 3300013296 Ga0157374_10011182 Ga0157374_100111825 289
179 3300013306 Ga0163162_10082804 Ga0163162_100828044 289
180 3300013307 Ga0157372_10031358 Ga0157372_100313587 289
181 3300013308 Ga0157375_10060676 Ga0157375_100606764 289
182 3300014745 Ga0157377_10006411 Ga0157377_100064112 289
183 3300014969 Ga0157376_10005452 Ga0157376_100054529 289
184 3300025907 Ga0207645_10007284 Ga0207645_100072849 289
185 3300025914 Ga0207671_10045353 Ga0207671_100453533 289
186 3300025919 Ga0207657_10139335 Ga0207657_101393352 289
187 3300025925 Ga0207650_10019257 Ga0207650_100192572 289
188 3300025926 Ga0207659_10002887 Ga0207659_100028879 289
189 3300025926 Ga0207659_10004403 Ga0207659_100044036 289
190 3300025933 Ga0207706_10004799 Ga0207706_1000479912 289
191 3300025935 Ga0207709_10035286 Ga0207709_100352862 289
192 3300025940 Ga0207691_10026833 Ga0207691_100268332 289
193 3300025942 Ga0207689_10001372 Ga0207689_100013727 289
194 3300025945 Ga0207679_10229017 Ga0207679_102290172 289
195 3300025961 Ga0207712_10108196 Ga0207712_101081962 289
196 3300025981 Ga0207640_10008779 Ga0207640_100087793 289
197 3300026023 Ga0207677_10001471 Ga0207677_100014719 289
198 3300026035 Ga0207703_10277524 Ga0207703_102775242 289
199 3300026067 Ga0207678_10007734 Ga0207678_100077342 289
200 3300026078 Ga0207702_10464933 Ga0207702_104649332 289
201 3300026095 Ga0207676_10013888 Ga0207676_100138886 289
202 3300026118 Ga0207675_100005156 Ga0207675_1000051566 289
203 3300026121 Ga0207683_10004944 Ga0207683_100049449 289
204 3300035121 Ga0373960_0021481 Ga0373960_0021481_38_1018 289
205 3300035691 Ga0373931_0005739 Ga0373931_0005739_581_1561 289
206 3300045051 Ga0451576_0075815 Ga0451576_0075815_1455_2435 289
207 3300048904 Ga0496101_0056855 Ga0496101_0056855_1520_2500 289
208 3300048905 Ga0496102_0030746 Ga0496102_0030746_955_1935 289
209 3300048909 Ga0496106_0027054 Ga0496106_0027054_2761_3741 289
210 3300048910 Ga0496107_0039938 Ga0496107_0039938_1815_2795 289
211 3300048913 Ga0496110_0032095 Ga0496110_0032095_2508_3488 289
212 3300048917 Ga0496114_0029409 Ga0496114_0029409_1760_2740 289
213 3300048918 Ga0496115_0030737 Ga0496115_0030737_433_1413 289
214 3300050512 nmdc:mga0n895_175112_c1 nmdc:mga0n895_175112_c1_531_1511 289
215 3300006353 Ga0075370_10000505 Ga0075370_1000050511 290
216 3300031456 Ga0307513_10032604 Ga0307513_100326043 290
217 3300031730 Ga0307516_10001680 Ga0307516_1000168019 290
218 3300005331 Ga0070670_100005503 Ga0070670_1000055033 291
219 3300005333 Ga0070677_10001348 Ga0070677_100013484 291
220 3300005333 Ga0070677_10093314 Ga0070677_100933141 291
221 3300005353 Ga0070669_100013992 Ga0070669_1000139922 291
222 3300005354 Ga0070675_100000811 Ga0070675_10000081111 291
223 3300005354 Ga0070675_100132339 Ga0070675_1001323392 291
224 3300005354 Ga0070675_100201446 Ga0070675_1002014462 291
225 3300005355 Ga0070671_100133172 Ga0070671_1001331722 291
226 3300005356 Ga0070674_100032959 Ga0070674_1000329591 291
227 3300005364 Ga0070673_100027447 Ga0070673_1000274472 291
228 3300005455 Ga0070663_100024312 Ga0070663_1000243122 291
229 3300005456 Ga0070678_100278572 Ga0070678_1002785722 291
230 3300005459 Ga0068867_100022167 Ga0068867_1000221675 291
231 3300005467 Ga0070706_100003212 Ga0070706_1000032127 291
232 3300005539 Ga0068853_100230003 Ga0068853_1002300032 291
233 3300005577 Ga0068857_100061892 Ga0068857_1000618923 291
234 3300005578 Ga0068854_100105943 Ga0068854_1001059433 291
235 3300005834 Ga0068851_10075809 Ga0068851_100758092 291
236 3300005840 Ga0068870_10010036 Ga0068870_100100362 291
237 3300005843 Ga0068860_100309884 Ga0068860_1003098841 291
238 3300006042 Ga0075368_10002119 Ga0075368_100021197 291
239 3300006042 Ga0075368_10031925 Ga0075368_100319252 291
240 3300006177 Ga0075362_10004079 Ga0075362_100040792 291
241 3300006177 Ga0075362_10048350 Ga0075362_100483502 291
242 3300006178 Ga0075367_10004037 Ga0075367_100040378 291
243 3300006195 Ga0075366_10001252 Ga0075366_100012522 291
244 3300006195 Ga0075366_10024936 Ga0075366_100249364 291
245 3300006195 Ga0075366_10073292 Ga0075366_100732921 291
246 3300006353 Ga0075370_10000533 Ga0075370_1000053314 291
247 3300006353 Ga0075370_10000983 Ga0075370_100009837 291
248 3300006353 Ga0075370_10026902 Ga0075370_100269022 291
249 3300006353 Ga0075370_10058015 Ga0075370_100580152 291
250 3300009093 Ga0105240_10302027 Ga0105240_103020272 291
251 3300010375 Ga0105239_10045083 Ga0105239_100450834 291
252 3300017792 Ga0163161_10268134 Ga0163161_102681342 291
253 3300025315 Ga0207697_10017407 Ga0207697_100174072 291
254 3300025893 Ga0207682_10000902 Ga0207682_1000090212 291
255 3300025893 Ga0207682_10079594 Ga0207682_100795942 291
256 3300025901 Ga0207688_10082591 Ga0207688_100825912 291
257 3300025908 Ga0207643_10081971 Ga0207643_100819712 291
258 3300025910 Ga0207684_10001976 Ga0207684_1000197611 291
259 3300025925 Ga0207650_10000580 Ga0207650_1000058016 291
260 3300025926 Ga0207659_10187568 Ga0207659_101875682 291
261 3300025931 Ga0207644_10003339 Ga0207644_1000333910 291
262 3300025931 Ga0207644_10020707 Ga0207644_100207071 291
263 3300025937 Ga0207669_10009375 Ga0207669_100093755 291
264 3300025942 Ga0207689_10030787 Ga0207689_100307874 291
265 3300025945 Ga0207679_10166911 Ga0207679_101669112 291
266 3300025960 Ga0207651_10014111 Ga0207651_100141113 291
267 3300025981 Ga0207640_10046154 Ga0207640_100461542 291
268 3300025986 Ga0207658_10087666 Ga0207658_100876662 291
269 3300026089 Ga0207648_10003741 Ga0207648_1000374112 291
270 3300026116 Ga0207674_10028708 Ga0207674_100287085 291
271 3300026142 Ga0207698_10171997 Ga0207698_101719972 291
272 3300028381 Ga0268264_10224964 Ga0268264_102249642 291
273 3300031456 Ga0307513_10182027 Ga0307513_101820272 291
274 3300031730 Ga0307516_10041912 Ga0307516_100419125 291
275 3300035171 Ga0373946_0096354 Ga0373946_0096354_185_1309 291
276 3300046522 Ga0495643_0138148 Ga0495643_0138148_118_1131 291
277 3300046537 Ga0495598_0064335 Ga0495598_0064335_32_1045 291
278 3300046542 Ga0495597_0023805 Ga0495597_0023805_805_1818 291
279 3300046694 Ga0495649_0022635 Ga0495649_0022635_210_1241 291
280 3300046810 Ga0495660_0009993 Ga0495660_0009993_2394_3425 291
281 3300047443 Ga0495687_002674 Ga0495687_002674_3727_4740 291
282 3300047443 Ga0495687_012461 Ga0495687_012461_1124_2155 291
283 3300048917 Ga0496114_0022175 Ga0496114_0022175_1360_2343 291
284 3300050489 nmdc:mga03683_3203_c1 nmdc:mga03683_3203_c1_3734_4738 291
285 3300050489 nmdc:mga03683_32980_c1 nmdc:mga03683_32980_c1_379_1383 291
286 3300050492 nmdc:mga0yw44_200578_c1 nmdc:mga0yw44_200578_c1_171_1175 291
287 3300050493 nmdc:mga0k408_12958_c1 nmdc:mga0k408_12958_c1_2483_3505 291
288 3300050493 nmdc:mga0k408_27059_c1 nmdc:mga0k408_27059_c1_768_1787 291
289 3300050493 nmdc:mga0k408_46296_c1 nmdc:mga0k408_46296_c1_109_1170 291
290 3300050493 nmdc:mga0k408_8189_c1 nmdc:mga0k408_8189_c1_262_1266 291
291 3300050494 nmdc:mga06z11_214390_c1 nmdc:mga06z11_214390_c1_85_1113 291
292 3300050496 nmdc:mga07m45_118740_c1 nmdc:mga07m45_118740_c1_506_1510 291
293 3300050496 nmdc:mga07m45_2072_c1 nmdc:mga07m45_2072_c1_2376_3380 291
294 3300050496 nmdc:mga07m45_50459_c1 nmdc:mga07m45_50459_c1_745_1764 291
295 3300053134 Ga0500658_0018775 Ga0500658_0018775_1469_2500 291
296 iso_pu_bacteria 2643221654 2644305573 291
297 3300030522 Ga0307512_10018166 Ga0307512_100181664 292
298 3300031507 Ga0307509_10001869 Ga0307509_1000186924 292
299 3300031649 Ga0307514_10008353 Ga0307514_100083537 292
300 3300031824 Ga0307413_10127203 Ga0307413_101272032 292
301 3300046454 Ga0495592_0000145 Ga0495592_0000145_28101_29117 292
302 3300046660 Ga0495625_0012800 Ga0495625_0012800_1506_2561 292
303 3300053139 Ga0500568_0049958 Ga0500568_0049958_607_1608 292
304 3300053154 Ga0500619_034772 Ga0500619_034772_166_1182 292
305 3300005328 Ga0070676_10002874 Ga0070676_100028749 293
306 3300005355 Ga0070671_100043264 Ga0070671_1000432642 293
307 3300005459 Ga0068867_100017549 Ga0068867_1000175496 293
308 3300005578 Ga0068854_100055466 Ga0068854_1000554663 293
309 3300005616 Ga0068852_100155488 Ga0068852_1001554882 293
310 3300025907 Ga0207645_10033862 Ga0207645_100338623 293
311 3300025931 Ga0207644_10101367 Ga0207644_101013672 293
312 3300026023 Ga0207677_10024773 Ga0207677_100247733 293
313 3300028794 Ga0307515_10034576 Ga0307515_100345767 293
314 3300053136 Ga0500559_0000107 Ga0500559_0000107_35425_36438 293
315 3300053156 Ga0500622_0004859 Ga0500622_0004859_6035_7060 293
316 3300053177 Ga0500636_0062503 Ga0500636_0062503_1014_2027 293
317 3300053739 Ga0500587_002450 Ga0500587_002450_38_1063 293
318 3300003316 rootH1_10016395 rootH1_100163958 294
319 3300025937 Ga0207669_10028042 Ga0207669_100280422 294
320 3300031731 Ga0307405_10015836 Ga0307405_100158364 294
321 3300031901 Ga0307406_10006930 Ga0307406_100069306 294
322 3300031911 Ga0307412_10002558 Ga0307412_100025589 294
323 3300031995 Ga0307409_100168538 Ga0307409_1001685382 294
324 3300032002 Ga0307416_100151368 Ga0307416_1001513682 294
325 3300032126 Ga0307415_100089606 Ga0307415_1000896062 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01545

Cation_efflux

Cation efflux family

39

231

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xpf-assembly1.cif.gz_A cryo-em structure of human znt8 wt, in the absence of zinc, determined in heterogeneous conformations- one subunit in an inward-facing and the other in an outward-facing conformation 0.8866 2 268
6vd9-assembly2.cif.gz_B metal-bound c-terminal domain of the czcd transporter from cuprividus metallidurans 0.8839 198 268
6vd8-assembly1.cif.gz_B-2 metal-bound c-terminal domain of czcd transporter from pseudomonas aeruginosa 0.8597 198 271
6vd9-assembly2.cif.gz_B metal-bound c-terminal domain of the czcd transporter from cuprividus metallidurans 0.8511 198 268
6vd8-assembly1.cif.gz_A metal-bound c-terminal domain of czcd transporter from pseudomonas aeruginosa 0.8288 192 271
ID Description Score Start End Superfamily
af_P75757_17_213_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9379 2 188 1.20.1510.10
af_Q2FWA9_216_326_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.9174 192 268 3.30.70.1350
af_Q9M271_29_255_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9165 2 188 1.20.1510.10
af_O35149_110_332_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9141 2 187 1.20.1510.10
af_Q6DBM8_296_375_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.9002 192 268 3.30.70.1350
ID Description Score Start End GO Terms
AF-A0A4Q2RFN1-F1-model_v4 Cation transporter 0.9663 2 270 GO:0005385
GO:0005886
AF-A0A5C6FB96-F1-model_v4 Cadmium, cobalt and zinc/H(+)-K(+) antiporter 0.9516 2 280 GO:0005385
GO:0005886
AF-A0A2T4CSY2-F1-model_v4 Cation transporter 0.9512 4 191 GO:0005385
GO:0005886
AF-A0A3M8B4U8-F1-model_v4 Cation transporter 0.9502 2 268 GO:0005385
GO:0005886
AF-A0A350SKD4-F1-model_v4 deleted 0.95 2 270

Feature Viewer

pLDDT pTM Quality
85.15 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map