F407667
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 207 | 323 | 305 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100005503|Ga0070670_1000055033 |
| Length | 340 |
| Sequence | MTVPRDPASRSVSDAVSGRRVPEAHPTGPVDPADFNRAFAIGIVLNLLFVAVEAFYGWKVDSLALLADAGHNLSDVAGLAVAWGGALAAGMRPDARYTYGRKRASILAAFANAVLLLVAMGSLAWEALGRLRVPQPPADGVTLMVVAGIGIVVNLGTALLFLRGRHGDLNVRGAFLHMAGDALVSAGVVVTGALALRFGWPWLDPAVSLVIALVIVLGTWSLFRQSLHLLFDGVPEGIDLHAVRRELEALPGVDRVHDLHVWATGTTETALTAHLVMPDVRADDHFLEDATRRLQARFRIGHVTLQVVREPFMALCADAVPPSSSPGLANESNRTGSIPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 2 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 45 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 113 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 114 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 116 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 118 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 120 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 124 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 125 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 126 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 127 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 129 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 131 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 138 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 139 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 140 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 141 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 143 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 144 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 147 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 148 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 149 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 150 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 151 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 154 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 171 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 172 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 173 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 174 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 175 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 176 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 177 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 178 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 179 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 187 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 188 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 189 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 190 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 191 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 194 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 195 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 196 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 197 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 198 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 199 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 200 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 201 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 202 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 203 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 204 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 205 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 206 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 207 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.08 |
| Metatranscriptomes | 0 |
| Isolates | 0.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.92 |
| Nodule | 0 |
| Rhizoplane | 2.77 |
| Rhizosphere | 73.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10016395 | 3300003316 | Bacteria | 5664 |
| 2 | rootH1_10016395 | 3300003323 | Bacteria | 39282 |
| 3 | Ga0070658_10336012 | 3300005327 | Bacteria | 1291 |
| 4 | Ga0070676_10002874 | 3300005328 | Bacteria | 8894 |
| 5 | Ga0070676_10011223 | 3300005328 | Bacteria | 4872 |
| 6 | Ga0070683_100040677 | 3300005329 | Bacteria | 4274 |
| 7 | Ga0070683_100181681 | 3300005329 | Bacteria | 1997 |
| 8 | Ga0070670_100005503 | 3300005331 | Bacteria | 10686 |
| 9 | Ga0070670_100155998 | 3300005331 | Bacteria | 1977 |
| 10 | Ga0070677_10001348 | 3300005333 | Bacteria | 7834 |
| 11 | Ga0070677_10016579 | 3300005333 | Bacteria | 2626 |
| 12 | Ga0070677_10093314 | 3300005333 | Bacteria | 1313 |
| 13 | Ga0068869_100007456 | 3300005334 | Bacteria | 6995 |
| 14 | Ga0068869_100197662 | 3300005334 | Bacteria | 1584 |
| 15 | Ga0070680_100011528 | 3300005336 | Bacteria | 6840 |
| 16 | Ga0068868_100100358 | 3300005338 | Bacteria | 2342 |
| 17 | Ga0070660_100202683 | 3300005339 | Bacteria | 1609 |
| 18 | Ga0070661_100148927 | 3300005344 | Bacteria | 1768 |
| 19 | Ga0070668_100000387 | 3300005347 | Bacteria | 29141 |
| 20 | Ga0070669_100013992 | 3300005353 | Bacteria | 5706 |
| 21 | Ga0070675_100000811 | 3300005354 | Bacteria | 22016 |
| 22 | Ga0070675_100002494 | 3300005354 | Bacteria | 13776 |
| 23 | Ga0070675_100032057 | 3300005354 | Bacteria | 4250 |
| 24 | Ga0070675_100053151 | 3300005354 | Bacteria | 3331 |
| 25 | Ga0070675_100132339 | 3300005354 | Bacteria | 2126 |
| 26 | Ga0070675_100201446 | 3300005354 | Bacteria | 1728 |
| 27 | Ga0070671_100029734 | 3300005355 | Bacteria | 4506 |
| 28 | Ga0070671_100043264 | 3300005355 | Bacteria | 3743 |
| 29 | Ga0070671_100133172 | 3300005355 | Bacteria | 2094 |
| 30 | Ga0070671_100158526 | 3300005355 | Bacteria | 1913 |
| 31 | Ga0070674_100032959 | 3300005356 | Bacteria | 3444 |
| 32 | Ga0070673_100009675 | 3300005364 | Bacteria | 6483 |
| 33 | Ga0070673_100027447 | 3300005364 | Bacteria | 4221 |
| 34 | Ga0070673_100180736 | 3300005364 | Bacteria | 1806 |
| 35 | Ga0070667_100002072 | 3300005367 | Bacteria | 17742 |
| 36 | Ga0070667_100024146 | 3300005367 | Bacteria | 5049 |
| 37 | Ga0070663_100024312 | 3300005455 | Bacteria | 4075 |
| 38 | Ga0070663_100185237 | 3300005455 | Bacteria | 1617 |
| 39 | Ga0070678_100108731 | 3300005456 | Bacteria | 2165 |
| 40 | Ga0070678_100278572 | 3300005456 | Bacteria | 1413 |
| 41 | Ga0070662_100011370 | 3300005457 | Bacteria | 5875 |
| 42 | Ga0070662_100064139 | 3300005457 | Bacteria | 2689 |
| 43 | Ga0068867_100003441 | 3300005459 | Bacteria | 11133 |
| 44 | Ga0068867_100017549 | 3300005459 | Bacteria | 5082 |
| 45 | Ga0068867_100022167 | 3300005459 | Bacteria | 4538 |
| 46 | Ga0070706_100003212 | 3300005467 | Bacteria | 16141 |
| 47 | Ga0070707_100091325 | 3300005468 | Bacteria | 2948 |
| 48 | Ga0070679_100013748 | 3300005530 | Bacteria | 7754 |
| 49 | Ga0068853_100230003 | 3300005539 | Bacteria | 1696 |
| 50 | Ga0070672_100005290 | 3300005543 | Bacteria | 8541 |
| 51 | Ga0070665_100003128 | 3300005548 | Bacteria | 17825 |
| 52 | Ga0070665_100012781 | 3300005548 | Bacteria | 8458 |
| 53 | Ga0070664_100201548 | 3300005564 | Bacteria | 1776 |
| 54 | Ga0068857_100061892 | 3300005577 | Bacteria | 3326 |
| 55 | Ga0068857_100201061 | 3300005577 | Bacteria | 1816 |
| 56 | Ga0068854_100002276 | 3300005578 | Bacteria | 11815 |
| 57 | Ga0068854_100055466 | 3300005578 | Bacteria | 2853 |
| 58 | Ga0068854_100105943 | 3300005578 | Bacteria | 2114 |
| 59 | Ga0068852_100008274 | 3300005616 | Bacteria | 7654 |
| 60 | Ga0068852_100155488 | 3300005616 | Bacteria | 2130 |
| 61 | Ga0068859_100091336 | 3300005617 | Bacteria | 3095 |
| 62 | Ga0068864_100006860 | 3300005618 | Bacteria | 9330 |
| 63 | Ga0068864_100020590 | 3300005618 | Bacteria | 5518 |
| 64 | Ga0068861_100007201 | 3300005719 | Bacteria | 7622 |
| 65 | Ga0068851_10075809 | 3300005834 | Bacteria | 1748 |
| 66 | Ga0068870_10010036 | 3300005840 | Bacteria | 4332 |
| 67 | Ga0068863_100011702 | 3300005841 | Bacteria | 8485 |
| 68 | Ga0068863_100230451 | 3300005841 | Bacteria | 1786 |
| 69 | Ga0068858_100123069 | 3300005842 | Bacteria | 2427 |
| 70 | Ga0068858_100306479 | 3300005842 | Bacteria | 1516 |
| 71 | Ga0068858_100349778 | 3300005842 | Bacteria | 1416 |
| 72 | Ga0068860_100309884 | 3300005843 | Bacteria | 1548 |
| 73 | Ga0068862_100097846 | 3300005844 | Bacteria | 2562 |
| 74 | Ga0075368_10002119 | 3300006042 | Bacteria | 6405 |
| 75 | Ga0075368_10031925 | 3300006042 | Bacteria | 2044 |
| 76 | Ga0075362_10004079 | 3300006177 | Bacteria | 5206 |
| 77 | Ga0075362_10048350 | 3300006177 | Bacteria | 1898 |
| 78 | Ga0075367_10004037 | 3300006178 | Bacteria | 7100 |
| 79 | Ga0075366_10001252 | 3300006195 | Bacteria | 12602 |
| 80 | Ga0075366_10024936 | 3300006195 | Bacteria | 3489 |
| 81 | Ga0075366_10073292 | 3300006195 | Bacteria | 2041 |
| 82 | Ga0097621_100011993 | 3300006237 | Bacteria | 6413 |
| 83 | Ga0097621_100175287 | 3300006237 | Bacteria | 1850 |
| 84 | Ga0075370_10000505 | 3300006353 | Bacteria | 14819 |
| 85 | Ga0075370_10000533 | 3300006353 | Bacteria | 14584 |
| 86 | Ga0075370_10000983 | 3300006353 | Bacteria | 11796 |
| 87 | Ga0075370_10026902 | 3300006353 | Bacteria | 3189 |
| 88 | Ga0075370_10058015 | 3300006353 | Bacteria | 2201 |
| 89 | Ga0068871_100016332 | 3300006358 | Bacteria | 5588 |
| 90 | Ga0068871_100016640 | 3300006358 | Bacteria | 5547 |
| 91 | Ga0075434_100213250 | 3300006871 | Bacteria | 1951 |
| 92 | Ga0097620_100091332 | 3300006931 | Bacteria | 3095 |
| 93 | Ga0105240_10302027 | 3300009093 | Bacteria | 1831 |
| 94 | Ga0105245_10019544 | 3300009098 | Bacteria | 5934 |
| 95 | Ga0105245_10057984 | 3300009098 | Bacteria | 3485 |
| 96 | Ga0105243_10045598 | 3300009148 | Bacteria | 3445 |
| 97 | Ga0105241_10022727 | 3300009174 | Bacteria | 4647 |
| 98 | Ga0105237_10045653 | 3300009545 | Bacteria | 4408 |
| 99 | Ga0105238_10099811 | 3300009551 | Bacteria | 2886 |
| 100 | Ga0105249_10100333 | 3300009553 | Bacteria | 2722 |
| 101 | Ga0105239_10045083 | 3300010375 | Bacteria | 4833 |
| 102 | Ga0105239_10070831 | 3300010375 | Bacteria | 3830 |
| 103 | Ga0157371_10029521 | 3300013102 | Bacteria | 3963 |
| 104 | Ga0157369_10695324 | 3300013105 | Bacteria | 1047 |
| 105 | Ga0157374_10011182 | 3300013296 | Bacteria | 7758 |
| 106 | Ga0163162_10082804 | 3300013306 | Bacteria | 3281 |
| 107 | Ga0157372_10031358 | 3300013307 | Bacteria | 5821 |
| 108 | Ga0157375_10037585 | 3300013308 | Bacteria | 4640 |
| 109 | Ga0157375_10060676 | 3300013308 | Bacteria | 3752 |
| 110 | Ga0157377_10006411 | 3300014745 | Bacteria | 5611 |
| 111 | Ga0157376_10005452 | 3300014969 | Bacteria | 8893 |
| 112 | Ga0163161_10268134 | 3300017792 | Bacteria | 1335 |
| 113 | Ga0209026_1001241 | 3300025250 | Bacteria | 11674 |
| 114 | Ga0207697_10017407 | 3300025315 | Bacteria | 2954 |
| 115 | Ga0207682_10000902 | 3300025893 | Bacteria | 13752 |
| 116 | Ga0207682_10079594 | 3300025893 | Bacteria | 1402 |
| 117 | Ga0207688_10082591 | 3300025901 | Bacteria | 1836 |
| 118 | Ga0207645_10002682 | 3300025907 | Bacteria | 13864 |
| 119 | Ga0207645_10007284 | 3300025907 | Bacteria | 7824 |
| 120 | Ga0207645_10033862 | 3300025907 | Bacteria | 3283 |
| 121 | Ga0207643_10081971 | 3300025908 | Bacteria | 1870 |
| 122 | Ga0207684_10001976 | 3300025910 | Bacteria | 21165 |
| 123 | Ga0207671_10045353 | 3300025914 | Bacteria | 3251 |
| 124 | Ga0207671_10083430 | 3300025914 | Bacteria | 2399 |
| 125 | Ga0207660_10023759 | 3300025917 | Bacteria | 4142 |
| 126 | Ga0207657_10139335 | 3300025919 | Bacteria | 1983 |
| 127 | Ga0207652_10016775 | 3300025921 | Bacteria | 5984 |
| 128 | Ga0207646_10040066 | 3300025922 | Bacteria | 4214 |
| 129 | Ga0207650_10000580 | 3300025925 | Bacteria | 29427 |
| 130 | Ga0207650_10019257 | 3300025925 | Bacteria | 4793 |
| 131 | Ga0207650_10043291 | 3300025925 | Bacteria | 3304 |
| 132 | Ga0207659_10002887 | 3300025926 | Bacteria | 10226 |
| 133 | Ga0207659_10004403 | 3300025926 | Bacteria | 8512 |
| 134 | Ga0207659_10013599 | 3300025926 | Bacteria | 5219 |
| 135 | Ga0207659_10187568 | 3300025926 | Bacteria | 1643 |
| 136 | Ga0207659_10297936 | 3300025926 | Bacteria | 1323 |
| 137 | Ga0207687_10009282 | 3300025927 | Bacteria | 6434 |
| 138 | Ga0207644_10003339 | 3300025931 | Bacteria | 10351 |
| 139 | Ga0207644_10015161 | 3300025931 | Bacteria | 5171 |
| 140 | Ga0207644_10020707 | 3300025931 | Bacteria | 4475 |
| 141 | Ga0207644_10101367 | 3300025931 | Bacteria | 2163 |
| 142 | Ga0207706_10004799 | 3300025933 | Bacteria | 12661 |
| 143 | Ga0207709_10035286 | 3300025935 | Bacteria | 2956 |
| 144 | Ga0207669_10009375 | 3300025937 | Bacteria | 4658 |
| 145 | Ga0207669_10028042 | 3300025937 | Bacteria | 3092 |
| 146 | Ga0207691_10026833 | 3300025940 | Bacteria | 5404 |
| 147 | Ga0207689_10001372 | 3300025942 | Bacteria | 23344 |
| 148 | Ga0207689_10030787 | 3300025942 | Bacteria | 4471 |
| 149 | Ga0207689_10120524 | 3300025942 | Bacteria | 2158 |
| 150 | Ga0207661_10102204 | 3300025944 | Bacteria | 2409 |
| 151 | Ga0207679_10166911 | 3300025945 | Bacteria | 1808 |
| 152 | Ga0207679_10229017 | 3300025945 | Bacteria | 1568 |
| 153 | Ga0207651_10013527 | 3300025960 | Bacteria | 4673 |
| 154 | Ga0207651_10014111 | 3300025960 | Bacteria | 4601 |
| 155 | Ga0207712_10108196 | 3300025961 | Bacteria | 2080 |
| 156 | Ga0207668_10000019 | 3300025972 | Bacteria | 152108 |
| 157 | Ga0207640_10008779 | 3300025981 | Bacteria | 5627 |
| 158 | Ga0207640_10046154 | 3300025981 | Bacteria | 2801 |
| 159 | Ga0207658_10008774 | 3300025986 | Bacteria | 6864 |
| 160 | Ga0207658_10087666 | 3300025986 | Bacteria | 2404 |
| 161 | Ga0207677_10001471 | 3300026023 | Bacteria | 12473 |
| 162 | Ga0207677_10023806 | 3300026023 | Bacteria | 3790 |
| 163 | Ga0207677_10024773 | 3300026023 | Bacteria | 3733 |
| 164 | Ga0207703_10053286 | 3300026035 | Bacteria | 3288 |
| 165 | Ga0207703_10277524 | 3300026035 | Bacteria | 1521 |
| 166 | Ga0207703_10303542 | 3300026035 | Bacteria | 1457 |
| 167 | Ga0207639_10044585 | 3300026041 | Bacteria | 3336 |
| 168 | Ga0207678_10007734 | 3300026067 | Bacteria | 9495 |
| 169 | Ga0207702_10056465 | 3300026078 | Bacteria | 3334 |
| 170 | Ga0207702_10464933 | 3300026078 | Bacteria | 1229 |
| 171 | Ga0207641_10048710 | 3300026088 | Bacteria | 3578 |
| 172 | Ga0207648_10003099 | 3300026089 | Bacteria | 17554 |
| 173 | Ga0207648_10003741 | 3300026089 | Bacteria | 15906 |
| 174 | Ga0207676_10013888 | 3300026095 | Bacteria | 5782 |
| 175 | Ga0207676_10020756 | 3300026095 | Bacteria | 4810 |
| 176 | Ga0207676_10027635 | 3300026095 | Bacteria | 4228 |
| 177 | Ga0207674_10028708 | 3300026116 | Bacteria | 5868 |
| 178 | Ga0207675_100005156 | 3300026118 | Bacteria | 12584 |
| 179 | Ga0207683_10004944 | 3300026121 | Bacteria | 11467 |
| 180 | Ga0207698_10171997 | 3300026142 | Bacteria | 1909 |
| 181 | Ga0207698_10252525 | 3300026142 | Bacteria | 1615 |
| 182 | Ga0268266_10002885 | 3300028379 | Bacteria | 17854 |
| 183 | Ga0268266_10035150 | 3300028379 | Bacteria | 4262 |
| 184 | Ga0268264_10224964 | 3300028381 | Bacteria | 1729 |
| 185 | Ga0307517_10000394 | 3300028786 | Bacteria | 74695 |
| 186 | Ga0307517_10002371 | 3300028786 | Bacteria | 30326 |
| 187 | Ga0307517_10068490 | 3300028786 | Bacteria | 3232 |
| 188 | Ga0307517_10097433 | 3300028786 | Bacteria | 2348 |
| 189 | Ga0307515_10034576 | 3300028794 | Bacteria | 8264 |
| 190 | Ga0307515_10048040 | 3300028794 | Bacteria | 6464 |
| 191 | Ga0265324_10000205 | 3300029957 | Bacteria | 45035 |
| 192 | Ga0307512_10018166 | 3300030522 | Bacteria | 6430 |
| 193 | Ga0307512_10108949 | 3300030522 | Bacteria | 1835 |
| 194 | Ga0265332_10000037 | 3300031238 | Bacteria | 134250 |
| 195 | Ga0265328_10006004 | 3300031239 | Bacteria | 5172 |
| 196 | Ga0265320_10037383 | 3300031240 | Bacteria | 2445 |
| 197 | Ga0265325_10012582 | 3300031241 | Bacteria | 4834 |
| 198 | Ga0265331_10001917 | 3300031250 | Bacteria | 14580 |
| 199 | Ga0265327_10016337 | 3300031251 | Bacteria | 4718 |
| 200 | Ga0265327_10023943 | 3300031251 | Unclassified | 3599 |
| 201 | Ga0265316_10016992 | 3300031344 | Bacteria | 6300 |
| 202 | Ga0265316_10270778 | 3300031344 | Bacteria | 1243 |
| 203 | Ga0307513_10032604 | 3300031456 | Bacteria | 5871 |
| 204 | Ga0307513_10091581 | 3300031456 | Bacteria | 3098 |
| 205 | Ga0307513_10097702 | 3300031456 | Bacteria | 2971 |
| 206 | Ga0307513_10182027 | 3300031456 | Bacteria | 1963 |
| 207 | Ga0307509_10001869 | 3300031507 | Bacteria | 34796 |
| 208 | Ga0307509_10014864 | 3300031507 | Bacteria | 9124 |
| 209 | Ga0307509_10052233 | 3300031507 | Bacteria | 4364 |
| 210 | Ga0307509_10147664 | 3300031507 | Bacteria | 2273 |
| 211 | Ga0307508_10000150 | 3300031616 | Bacteria | 83110 |
| 212 | Ga0307508_10003594 | 3300031616 | Bacteria | 15591 |
| 213 | Ga0307508_10076742 | 3300031616 | Bacteria | 2919 |
| 214 | Ga0307514_10008353 | 3300031649 | Bacteria | 8836 |
| 215 | Ga0265314_10000740 | 3300031711 | Bacteria | 39277 |
| 216 | Ga0265314_10008059 | 3300031711 | Bacteria | 9068 |
| 217 | Ga0307516_10001680 | 3300031730 | Bacteria | 30456 |
| 218 | Ga0307516_10041912 | 3300031730 | Bacteria | 4545 |
| 219 | Ga0307516_10045381 | 3300031730 | Bacteria | 4341 |
| 220 | Ga0307405_10015836 | 3300031731 | Bacteria | 4094 |
| 221 | Ga0307413_10127203 | 3300031824 | Bacteria | 1737 |
| 222 | Ga0307406_10006930 | 3300031901 | Bacteria | 6276 |
| 223 | Ga0307412_10002558 | 3300031911 | Bacteria | 10107 |
| 224 | Ga0307409_100001798 | 3300031995 | Bacteria | 10845 |
| 225 | Ga0307409_100168538 | 3300031995 | Bacteria | 1925 |
| 226 | Ga0307416_100130733 | 3300032002 | Bacteria | 2259 |
| 227 | Ga0307416_100151368 | 3300032002 | Bacteria | 2128 |
| 228 | Ga0307411_10355871 | 3300032005 | Bacteria | 1195 |
| 229 | Ga0307415_100034430 | 3300032126 | Bacteria | 3298 |
| 230 | Ga0307415_100089606 | 3300032126 | Bacteria | 2222 |
| 231 | Ga0307507_10042869 | 3300033179 | Bacteria | 4499 |
| 232 | Ga0307510_10000360 | 3300033180 | Bacteria | 42908 |
| 233 | Ga0373960_0021481 | 3300035121 | Bacteria | 1717 |
| 234 | Ga0373946_0096354 | 3300035171 | Bacteria | 1319 |
| 235 | Ga0373931_0005739 | 3300035691 | Bacteria | 5767 |
| 236 | Ga0373933_0120202 | 3300035724 | Bacteria | 1645 |
| 237 | Ga0395899_0010271 | 3300037312 | Bacteria | 7176 |
| 238 | Ga0395900_0030783 | 3300037418 | Bacteria | 5511 |
| 239 | Ga0395898_0037189 | 3300037466 | Bacteria | 4830 |
| 240 | Ga0436364_1102035 | 3300037853 | Bacteria | 2407 |
| 241 | Ga0395901_0040356 | 3300038443 | Bacteria | 4833 |
| 242 | Ga0436365_1045043 | 3300039437 | Bacteria | 3188 |
| 243 | Ga0451577_0010403 | 3300042876 | Bacteria | 8898 |
| 244 | Ga0451577_0043679 | 3300042876 | Bacteria | 4014 |
| 245 | Ga0453683_0003052 | 3300044673 | Bacteria | 12538 |
| 246 | Ga0453684_0013764 | 3300044712 | Bacteria | 13080 |
| 247 | Ga0453684_0027491 | 3300044712 | Bacteria | 8155 |
| 248 | Ga0453684_0177518 | 3300044712 | Bacteria | 2503 |
| 249 | Ga0466957_0136699 | 3300044842 | Bacteria | 1576 |
| 250 | Ga0451576_0004366 | 3300045051 | Bacteria | 18441 |
| 251 | Ga0451576_0017689 | 3300045051 | Bacteria | 7835 |
| 252 | Ga0451576_0075815 | 3300045051 | Bacteria | 3500 |
| 253 | Ga0451576_0119061 | 3300045051 | Bacteria | 2749 |
| 254 | Ga0495592_0000145 | 3300046454 | Bacteria | 62850 |
| 255 | Ga0495643_0138148 | 3300046522 | Bacteria | 1218 |
| 256 | Ga0495598_0064335 | 3300046537 | Bacteria | 1139 |
| 257 | Ga0495597_0023805 | 3300046542 | Bacteria | 2831 |
| 258 | Ga0495645_0017626 | 3300046543 | Bacteria | 5117 |
| 259 | Ga0495668_0037292 | 3300046616 | Bacteria | 2720 |
| 260 | Ga0495625_0012800 | 3300046660 | Bacteria | 6782 |
| 261 | Ga0495625_0086942 | 3300046660 | Bacteria | 2168 |
| 262 | Ga0495647_0045227 | 3300046681 | Bacteria | 1691 |
| 263 | Ga0495658_0207895 | 3300046683 | Bacteria | 1222 |
| 264 | Ga0495669_0076481 | 3300046684 | Bacteria | 1532 |
| 265 | Ga0495613_0000559 | 3300046689 | Bacteria | 30599 |
| 266 | Ga0495649_0022635 | 3300046694 | Bacteria | 3516 |
| 267 | Ga0495660_0009993 | 3300046810 | Bacteria | 5521 |
| 268 | Ga0495687_002674 | 3300047443 | Bacteria | 13880 |
| 269 | Ga0495687_012461 | 3300047443 | Bacteria | 4494 |
| 270 | Ga0495593_0125960 | 3300047673 | Bacteria | 1302 |
| 271 | Ga0496101_0056855 | 3300048904 | Bacteria | 2828 |
| 272 | Ga0496102_0030746 | 3300048905 | Bacteria | 4808 |
| 273 | Ga0496106_0027054 | 3300048909 | Bacteria | 4270 |
| 274 | Ga0496107_0039938 | 3300048910 | Bacteria | 3367 |
| 275 | Ga0496110_0011602 | 3300048913 | Bacteria | 7223 |
| 276 | Ga0496110_0032095 | 3300048913 | Bacteria | 4533 |
| 277 | Ga0496114_0022175 | 3300048917 | Bacteria | 5173 |
| 278 | Ga0496114_0029409 | 3300048917 | Bacteria | 4516 |
| 279 | Ga0496115_0030737 | 3300048918 | Bacteria | 4227 |
| 280 | Ga0496118_0028623 | 3300048921 | Bacteria | 4688 |
| 281 | Ga0496121_0000078 | 3300048924 | Bacteria | 233455 |
| 282 | Ga0496126_0013746 | 3300048929 | Bacteria | 8210 |
| 283 | Ga0496126_0057963 | 3300048929 | Bacteria | 3493 |
| 284 | Ga0501033_0119673 | 3300049570 | Bacteria | 1912 |
| 285 | Ga0501034_0048718 | 3300049571 | Bacteria | 4276 |
| 286 | Ga0501034_0092626 | 3300049571 | Bacteria | 3019 |
| 287 | Ga0501036_0230399 | 3300049572 | Bacteria | 1555 |
| 288 | Ga0501038_0098720 | 3300049574 | Bacteria | 2435 |
| 289 | Ga0501047_0099411 | 3300049581 | Bacteria | 2788 |
| 290 | Ga0501047_0173493 | 3300049581 | Bacteria | 2025 |
| 291 | Ga0501070_0159062 | 3300049586 | Bacteria | 1863 |
| 292 | Ga0501044_0070986 | 3300049823 | Bacteria | 3542 |
| 293 | nmdc:mga03683_3203_c1 | 3300050489 | Bacteria | 5232 |
| 294 | nmdc:mga03683_32980_c1 | 3300050489 | Bacteria | 2086 |
| 295 | nmdc:mga0yw44_200578_c1 | 3300050492 | Bacteria | 1317 |
| 296 | nmdc:mga0k408_12958_c1 | 3300050493 | Bacteria | 4565 |
| 297 | nmdc:mga0k408_1837_c1 | 3300050493 | Bacteria | 11392 |
| 298 | nmdc:mga0k408_27059_c1 | 3300050493 | Bacteria | 3255 |
| 299 | nmdc:mga0k408_46296_c1 | 3300050493 | Bacteria | 2512 |
| 300 | nmdc:mga0k408_57903_c1 | 3300050493 | Bacteria | 2250 |
| 301 | nmdc:mga0k408_8189_c1 | 3300050493 | Bacteria | 5603 |
| 302 | nmdc:mga06z11_214390_c1 | 3300050494 | Bacteria | 1123 |
| 303 | nmdc:mga07m45_118740_c1 | 3300050496 | Bacteria | 1527 |
| 304 | nmdc:mga07m45_2072_c1 | 3300050496 | Bacteria | 9311 |
| 305 | nmdc:mga07m45_50459_c1 | 3300050496 | Bacteria | 2345 |
| 306 | nmdc:mga0n895_175112_c1 | 3300050512 | Bacteria | 2176 |
| 307 | Ga0495619_0171843 | 3300053085 | Bacteria | 1499 |
| 308 | Ga0500578_0099134 | 3300053086 | Bacteria | 1845 |
| 309 | Ga0500555_011888 | 3300053103 | Bacteria | 2503 |
| 310 | Ga0500556_0003618 | 3300053104 | Bacteria | 4501 |
| 311 | Ga0500593_107204 | 3300053117 | Bacteria | 1155 |
| 312 | Ga0500595_016826 | 3300053119 | Bacteria | 2716 |
| 313 | Ga0500652_125628 | 3300053131 | Bacteria | 1071 |
| 314 | Ga0500658_0018775 | 3300053134 | Bacteria | 2597 |
| 315 | Ga0500559_0000107 | 3300053136 | Bacteria | 65560 |
| 316 | Ga0500568_0049958 | 3300053139 | Bacteria | 1649 |
| 317 | Ga0500619_034772 | 3300053154 | Bacteria | 1559 |
| 318 | Ga0500622_0004859 | 3300053156 | Bacteria | 8234 |
| 319 | Ga0500636_0037579 | 3300053177 | Bacteria | 2865 |
| 320 | Ga0500636_0062503 | 3300053177 | Bacteria | 2171 |
| 321 | Ga0500645_001321 | 3300053730 | Bacteria | 12861 |
| 322 | Ga0500587_002450 | 3300053739 | Bacteria | 2638 |
| 323 | Ga0500587_004859 | 3300053739 | Bacteria | 1833 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025250 | Ga0209026_1001241 | Ga0209026_10012416 | 250 |
| 2 | 3300044842 | Ga0466957_0136699 | Ga0466957_0136699_528_1409 | 252 |
| 3 | 3300028786 | Ga0307517_10002371 | Ga0307517_100023712 | 253 |
| 4 | 3300031730 | Ga0307516_10045381 | Ga0307516_100453812 | 254 |
| 5 | 3300026041 | Ga0207639_10044585 | Ga0207639_100445852 | 255 |
| 6 | 3300049570 | Ga0501033_0119673 | Ga0501033_0119673_124_1056 | 257 |
| 7 | 3300049586 | Ga0501070_0159062 | Ga0501070_0159062_35_967 | 257 |
| 8 | 3300049571 | Ga0501034_0092626 | Ga0501034_0092626_1412_2344 | 263 |
| 9 | 3300049574 | Ga0501038_0098720 | Ga0501038_0098720_1098_2030 | 263 |
| 10 | 3300049581 | Ga0501047_0099411 | Ga0501047_0099411_516_1448 | 263 |
| 11 | 3300049823 | Ga0501044_0070986 | Ga0501044_0070986_2045_2977 | 263 |
| 12 | 3300053119 | Ga0500595_016826 | Ga0500595_016826_1391_2197 | 265 |
| 13 | 3300053177 | Ga0500636_0037579 | Ga0500636_0037579_1060_1992 | 265 |
| 14 | 3300005336 | Ga0070680_100011528 | Ga0070680_1000115286 | 268 |
| 15 | 3300005530 | Ga0070679_100013748 | Ga0070679_1000137486 | 268 |
| 16 | 3300025921 | Ga0207652_10016775 | Ga0207652_100167755 | 268 |
| 17 | 3300005347 | Ga0070668_100000387 | Ga0070668_1000003873 | 269 |
| 18 | 3300025972 | Ga0207668_10000019 | Ga0207668_1000001916 | 269 |
| 19 | 3300031344 | Ga0265316_10270778 | Ga0265316_102707782 | 269 |
| 20 | 3300044673 | Ga0453683_0003052 | Ga0453683_0003052_8477_9397 | 270 |
| 21 | 3300045051 | Ga0451576_0004366 | Ga0451576_0004366_14923_15843 | 270 |
| 22 | 3300005548 | Ga0070665_100003128 | Ga0070665_1000031289 | 272 |
| 23 | 3300028379 | Ga0268266_10002885 | Ga0268266_100028859 | 272 |
| 24 | 3300037853 | Ga0436364_1102035 | Ga0436364_1102035_475_1341 | 272 |
| 25 | 3300039437 | Ga0436365_1045043 | Ga0436365_1045043_1415_2281 | 272 |
| 26 | 3300053103 | Ga0500555_011888 | Ga0500555_011888_1479_2345 | 272 |
| 27 | 3300053104 | Ga0500556_0003618 | Ga0500556_0003618_3315_4310 | 272 |
| 28 | 3300048913 | Ga0496110_0011602 | Ga0496110_0011602_4582_5451 | 273 |
| 29 | 3300044712 | Ga0453684_0177518 | Ga0453684_0177518_189_1142 | 274 |
| 30 | iso_pu_bacteria | 8055225921 | 8055226676 | 274 |
| 31 | 3300005329 | Ga0070683_100040677 | Ga0070683_1000406774 | 275 |
| 32 | 3300005577 | Ga0068857_100201061 | Ga0068857_1002010611 | 275 |
| 33 | 3300025944 | Ga0207661_10102204 | Ga0207661_101022043 | 275 |
| 34 | 3300005329 | Ga0070683_100181681 | Ga0070683_1001816812 | 276 |
| 35 | 3300005548 | Ga0070665_100012781 | Ga0070665_1000127815 | 276 |
| 36 | 3300005618 | Ga0068864_100020590 | Ga0068864_1000205904 | 276 |
| 37 | 3300026035 | Ga0207703_10303542 | Ga0207703_103035422 | 276 |
| 38 | 3300026095 | Ga0207676_10027635 | Ga0207676_100276352 | 276 |
| 39 | 3300028379 | Ga0268266_10035150 | Ga0268266_100351504 | 276 |
| 40 | 3300028786 | Ga0307517_10097433 | Ga0307517_100974332 | 276 |
| 41 | 3300031240 | Ga0265320_10037383 | Ga0265320_100373832 | 276 |
| 42 | 3300031711 | Ga0265314_10008059 | Ga0265314_100080593 | 276 |
| 43 | 3300037418 | Ga0395900_0030783 | Ga0395900_0030783_596_1648 | 276 |
| 44 | 3300046684 | Ga0495669_0076481 | Ga0495669_0076481_358_1365 | 276 |
| 45 | 3300046689 | Ga0495613_0000559 | Ga0495613_0000559_20028_21050 | 276 |
| 46 | 3300048929 | Ga0496126_0057963 | Ga0496126_0057963_1291_2187 | 276 |
| 47 | 3300050493 | nmdc:mga0k408_1837_c1 | nmdc:mga0k408_1837_c1_2196_3191 | 276 |
| 48 | 3300005617 | Ga0068859_100091336 | Ga0068859_1000913363 | 277 |
| 49 | 3300005841 | Ga0068863_100011702 | Ga0068863_1000117025 | 277 |
| 50 | 3300005842 | Ga0068858_100306479 | Ga0068858_1003064791 | 277 |
| 51 | 3300005842 | Ga0068858_100349778 | Ga0068858_1003497782 | 277 |
| 52 | 3300006931 | Ga0097620_100091332 | Ga0097620_1000913323 | 277 |
| 53 | 3300009098 | Ga0105245_10057984 | Ga0105245_100579843 | 277 |
| 54 | 3300025927 | Ga0207687_10009282 | Ga0207687_100092823 | 277 |
| 55 | 3300026035 | Ga0207703_10053286 | Ga0207703_100532863 | 277 |
| 56 | 3300026088 | Ga0207641_10048710 | Ga0207641_100487104 | 277 |
| 57 | 3300026095 | Ga0207676_10020756 | Ga0207676_100207562 | 277 |
| 58 | 3300031344 | Ga0265316_10016992 | Ga0265316_100169921 | 277 |
| 59 | 3300031507 | Ga0307509_10147664 | Ga0307509_101476641 | 277 |
| 60 | 3300046616 | Ga0495668_0037292 | Ga0495668_0037292_639_1688 | 277 |
| 61 | 3300048921 | Ga0496118_0028623 | Ga0496118_0028623_447_1397 | 277 |
| 62 | 3300048924 | Ga0496121_0000078 | Ga0496121_0000078_87937_88887 | 277 |
| 63 | 3300048929 | Ga0496126_0013746 | Ga0496126_0013746_1535_2485 | 277 |
| 64 | 3300049572 | Ga0501036_0230399 | Ga0501036_0230399_555_1517 | 277 |
| 65 | 3300049581 | Ga0501047_0173493 | Ga0501047_0173493_479_1441 | 277 |
| 66 | 3300053117 | Ga0500593_107204 | Ga0500593_107204_169_1125 | 277 |
| 67 | 3300031239 | Ga0265328_10006004 | Ga0265328_100060041 | 278 |
| 68 | 3300031250 | Ga0265331_10001917 | Ga0265331_100019176 | 278 |
| 69 | 3300031251 | Ga0265327_10016337 | Ga0265327_100163374 | 278 |
| 70 | 3300037312 | Ga0395899_0010271 | Ga0395899_0010271_4222_5205 | 278 |
| 71 | 3300037466 | Ga0395898_0037189 | Ga0395898_0037189_592_1575 | 278 |
| 72 | 3300038443 | Ga0395901_0040356 | Ga0395901_0040356_3256_4239 | 278 |
| 73 | 3300025917 | Ga0207660_10023759 | Ga0207660_100237591 | 279 |
| 74 | 3300028794 | Ga0307515_10048040 | Ga0307515_100480404 | 279 |
| 75 | 3300046683 | Ga0495658_0207895 | Ga0495658_0207895_132_1139 | 279 |
| 76 | 3300049571 | Ga0501034_0048718 | Ga0501034_0048718_1124_2083 | 279 |
| 77 | 3300028786 | Ga0307517_10000394 | Ga0307517_1000039468 | 280 |
| 78 | 3300030522 | Ga0307512_10108949 | Ga0307512_101089492 | 280 |
| 79 | 3300031507 | Ga0307509_10014864 | Ga0307509_100148648 | 280 |
| 80 | 3300031616 | Ga0307508_10076742 | Ga0307508_100767422 | 280 |
| 81 | 3300033179 | Ga0307507_10042869 | Ga0307507_100428694 | 280 |
| 82 | 3300033180 | Ga0307510_10000360 | Ga0307510_1000036016 | 280 |
| 83 | 3300047673 | Ga0495593_0125960 | Ga0495593_0125960_162_1139 | 280 |
| 84 | 3300053131 | Ga0500652_125628 | Ga0500652_125628_27_1061 | 280 |
| 85 | 3300025926 | Ga0207659_10297936 | Ga0207659_102979363 | 281 |
| 86 | 3300028786 | Ga0307517_10068490 | Ga0307517_100684904 | 281 |
| 87 | 3300031456 | Ga0307513_10091581 | Ga0307513_100915813 | 281 |
| 88 | 3300031616 | Ga0307508_10000150 | Ga0307508_1000015038 | 281 |
| 89 | 3300031616 | Ga0307508_10003594 | Ga0307508_100035946 | 281 |
| 90 | 3300042876 | Ga0451577_0043679 | Ga0451577_0043679_2409_3329 | 281 |
| 91 | 3300044712 | Ga0453684_0027491 | Ga0453684_0027491_6985_7905 | 281 |
| 92 | 3300046660 | Ga0495625_0086942 | Ga0495625_0086942_804_1784 | 281 |
| 93 | 3300029957 | Ga0265324_10000205 | Ga0265324_1000020511 | 282 |
| 94 | 3300031241 | Ga0265325_10012582 | Ga0265325_100125822 | 282 |
| 95 | 3300031507 | Ga0307509_10052233 | Ga0307509_100522337 | 282 |
| 96 | 3300031711 | Ga0265314_10000740 | Ga0265314_1000074020 | 282 |
| 97 | 3300031995 | Ga0307409_100001798 | Ga0307409_1000017983 | 282 |
| 98 | 3300032002 | Ga0307416_100130733 | Ga0307416_1001307332 | 282 |
| 99 | 3300032005 | Ga0307411_10355871 | Ga0307411_103558712 | 282 |
| 100 | 3300032126 | Ga0307415_100034430 | Ga0307415_1000344303 | 282 |
| 101 | 3300042876 | Ga0451577_0010403 | Ga0451577_0010403_1888_2796 | 282 |
| 102 | 3300045051 | Ga0451576_0017689 | Ga0451576_0017689_889_1797 | 282 |
| 103 | 3300045051 | Ga0451576_0119061 | Ga0451576_0119061_1486_2394 | 282 |
| 104 | 3300025914 | Ga0207671_10083430 | Ga0207671_100834302 | 283 |
| 105 | 3300026078 | Ga0207702_10056465 | Ga0207702_100564652 | 283 |
| 106 | 3300031238 | Ga0265332_10000037 | Ga0265332_100000375 | 283 |
| 107 | 3300031251 | Ga0265327_10023943 | Ga0265327_100239432 | 283 |
| 108 | 3300044712 | Ga0453684_0013764 | Ga0453684_0013764_2544_3602 | 285 |
| 109 | 3300026142 | Ga0207698_10252525 | Ga0207698_102525253 | 286 |
| 110 | 3300046681 | Ga0495647_0045227 | Ga0495647_0045227_32_1093 | 286 |
| 111 | iso_pu_bacteria | 2919704043 | 2919708909 | 286 |
| 112 | 3300013102 | Ga0157371_10029521 | Ga0157371_100295213 | 287 |
| 113 | 3300013105 | Ga0157369_10695324 | Ga0157369_106953241 | 287 |
| 114 | 3300035724 | Ga0373933_0120202 | Ga0373933_0120202_538_1575 | 287 |
| 115 | 3300053085 | Ga0495619_0171843 | Ga0495619_0171843_302_1339 | 287 |
| 116 | 3300053086 | Ga0500578_0099134 | Ga0500578_0099134_404_1438 | 287 |
| 117 | 3300053730 | Ga0500645_001321 | Ga0500645_001321_2713_3747 | 287 |
| 118 | 3300053739 | Ga0500587_004859 | Ga0500587_004859_581_1615 | 287 |
| 119 | 3300005331 | Ga0070670_100155998 | Ga0070670_1001559982 | 288 |
| 120 | 3300005334 | Ga0068869_100197662 | Ga0068869_1001976622 | 288 |
| 121 | 3300005338 | Ga0068868_100100358 | Ga0068868_1001003583 | 288 |
| 122 | 3300005354 | Ga0070675_100053151 | Ga0070675_1000531514 | 288 |
| 123 | 3300005355 | Ga0070671_100029734 | Ga0070671_1000297342 | 288 |
| 124 | 3300005364 | Ga0070673_100180736 | Ga0070673_1001807362 | 288 |
| 125 | 3300005367 | Ga0070667_100002072 | Ga0070667_1000020727 | 288 |
| 126 | 3300005367 | Ga0070667_100024146 | Ga0070667_1000241462 | 288 |
| 127 | 3300005457 | Ga0070662_100064139 | Ga0070662_1000641392 | 288 |
| 128 | 3300005459 | Ga0068867_100003441 | Ga0068867_1000034414 | 288 |
| 129 | 3300005468 | Ga0070707_100091325 | Ga0070707_1000913252 | 288 |
| 130 | 3300005564 | Ga0070664_100201548 | Ga0070664_1002015482 | 288 |
| 131 | 3300013308 | Ga0157375_10037585 | Ga0157375_100375854 | 288 |
| 132 | 3300025907 | Ga0207645_10002682 | Ga0207645_1000268218 | 288 |
| 133 | 3300025922 | Ga0207646_10040066 | Ga0207646_100400662 | 288 |
| 134 | 3300025925 | Ga0207650_10043291 | Ga0207650_100432914 | 288 |
| 135 | 3300025926 | Ga0207659_10013599 | Ga0207659_100135992 | 288 |
| 136 | 3300025931 | Ga0207644_10015161 | Ga0207644_100151612 | 288 |
| 137 | 3300025942 | Ga0207689_10120524 | Ga0207689_101205242 | 288 |
| 138 | 3300025960 | Ga0207651_10013527 | Ga0207651_100135272 | 288 |
| 139 | 3300025986 | Ga0207658_10008774 | Ga0207658_100087745 | 288 |
| 140 | 3300026023 | Ga0207677_10023806 | Ga0207677_100238064 | 288 |
| 141 | 3300026089 | Ga0207648_10003099 | Ga0207648_1000309911 | 288 |
| 142 | 3300031456 | Ga0307513_10097702 | Ga0307513_100977022 | 288 |
| 143 | 3300046543 | Ga0495645_0017626 | Ga0495645_0017626_4047_5069 | 288 |
| 144 | 3300050493 | nmdc:mga0k408_57903_c1 | nmdc:mga0k408_57903_c1_111_1178 | 288 |
| 145 | 3300005327 | Ga0070658_10336012 | Ga0070658_103360121 | 289 |
| 146 | 3300005328 | Ga0070676_10011223 | Ga0070676_100112232 | 289 |
| 147 | 3300005333 | Ga0070677_10016579 | Ga0070677_100165792 | 289 |
| 148 | 3300005334 | Ga0068869_100007456 | Ga0068869_1000074565 | 289 |
| 149 | 3300005339 | Ga0070660_100202683 | Ga0070660_1002026832 | 289 |
| 150 | 3300005344 | Ga0070661_100148927 | Ga0070661_1001489271 | 289 |
| 151 | 3300005354 | Ga0070675_100002494 | Ga0070675_10000249412 | 289 |
| 152 | 3300005354 | Ga0070675_100032057 | Ga0070675_1000320572 | 289 |
| 153 | 3300005355 | Ga0070671_100158526 | Ga0070671_1001585261 | 289 |
| 154 | 3300005364 | Ga0070673_100009675 | Ga0070673_1000096755 | 289 |
| 155 | 3300005455 | Ga0070663_100185237 | Ga0070663_1001852372 | 289 |
| 156 | 3300005456 | Ga0070678_100108731 | Ga0070678_1001087312 | 289 |
| 157 | 3300005457 | Ga0070662_100011370 | Ga0070662_1000113704 | 289 |
| 158 | 3300005543 | Ga0070672_100005290 | Ga0070672_1000052905 | 289 |
| 159 | 3300005578 | Ga0068854_100002276 | Ga0068854_1000022766 | 289 |
| 160 | 3300005616 | Ga0068852_100008274 | Ga0068852_1000082742 | 289 |
| 161 | 3300005618 | Ga0068864_100006860 | Ga0068864_10000686012 | 289 |
| 162 | 3300005719 | Ga0068861_100007201 | Ga0068861_1000072016 | 289 |
| 163 | 3300005841 | Ga0068863_100230451 | Ga0068863_1002304512 | 289 |
| 164 | 3300005842 | Ga0068858_100123069 | Ga0068858_1001230692 | 289 |
| 165 | 3300005844 | Ga0068862_100097846 | Ga0068862_1000978462 | 289 |
| 166 | 3300006237 | Ga0097621_100011993 | Ga0097621_1000119935 | 289 |
| 167 | 3300006237 | Ga0097621_100175287 | Ga0097621_1001752872 | 289 |
| 168 | 3300006358 | Ga0068871_100016332 | Ga0068871_1000163327 | 289 |
| 169 | 3300006358 | Ga0068871_100016640 | Ga0068871_1000166405 | 289 |
| 170 | 3300006871 | Ga0075434_100213250 | Ga0075434_1002132502 | 289 |
| 171 | 3300009098 | Ga0105245_10019544 | Ga0105245_100195444 | 289 |
| 172 | 3300009148 | Ga0105243_10045598 | Ga0105243_100455982 | 289 |
| 173 | 3300009174 | Ga0105241_10022727 | Ga0105241_100227274 | 289 |
| 174 | 3300009545 | Ga0105237_10045653 | Ga0105237_100456534 | 289 |
| 175 | 3300009551 | Ga0105238_10099811 | Ga0105238_100998114 | 289 |
| 176 | 3300009553 | Ga0105249_10100333 | Ga0105249_101003332 | 289 |
| 177 | 3300010375 | Ga0105239_10070831 | Ga0105239_100708313 | 289 |
| 178 | 3300013296 | Ga0157374_10011182 | Ga0157374_100111825 | 289 |
| 179 | 3300013306 | Ga0163162_10082804 | Ga0163162_100828044 | 289 |
| 180 | 3300013307 | Ga0157372_10031358 | Ga0157372_100313587 | 289 |
| 181 | 3300013308 | Ga0157375_10060676 | Ga0157375_100606764 | 289 |
| 182 | 3300014745 | Ga0157377_10006411 | Ga0157377_100064112 | 289 |
| 183 | 3300014969 | Ga0157376_10005452 | Ga0157376_100054529 | 289 |
| 184 | 3300025907 | Ga0207645_10007284 | Ga0207645_100072849 | 289 |
| 185 | 3300025914 | Ga0207671_10045353 | Ga0207671_100453533 | 289 |
| 186 | 3300025919 | Ga0207657_10139335 | Ga0207657_101393352 | 289 |
| 187 | 3300025925 | Ga0207650_10019257 | Ga0207650_100192572 | 289 |
| 188 | 3300025926 | Ga0207659_10002887 | Ga0207659_100028879 | 289 |
| 189 | 3300025926 | Ga0207659_10004403 | Ga0207659_100044036 | 289 |
| 190 | 3300025933 | Ga0207706_10004799 | Ga0207706_1000479912 | 289 |
| 191 | 3300025935 | Ga0207709_10035286 | Ga0207709_100352862 | 289 |
| 192 | 3300025940 | Ga0207691_10026833 | Ga0207691_100268332 | 289 |
| 193 | 3300025942 | Ga0207689_10001372 | Ga0207689_100013727 | 289 |
| 194 | 3300025945 | Ga0207679_10229017 | Ga0207679_102290172 | 289 |
| 195 | 3300025961 | Ga0207712_10108196 | Ga0207712_101081962 | 289 |
| 196 | 3300025981 | Ga0207640_10008779 | Ga0207640_100087793 | 289 |
| 197 | 3300026023 | Ga0207677_10001471 | Ga0207677_100014719 | 289 |
| 198 | 3300026035 | Ga0207703_10277524 | Ga0207703_102775242 | 289 |
| 199 | 3300026067 | Ga0207678_10007734 | Ga0207678_100077342 | 289 |
| 200 | 3300026078 | Ga0207702_10464933 | Ga0207702_104649332 | 289 |
| 201 | 3300026095 | Ga0207676_10013888 | Ga0207676_100138886 | 289 |
| 202 | 3300026118 | Ga0207675_100005156 | Ga0207675_1000051566 | 289 |
| 203 | 3300026121 | Ga0207683_10004944 | Ga0207683_100049449 | 289 |
| 204 | 3300035121 | Ga0373960_0021481 | Ga0373960_0021481_38_1018 | 289 |
| 205 | 3300035691 | Ga0373931_0005739 | Ga0373931_0005739_581_1561 | 289 |
| 206 | 3300045051 | Ga0451576_0075815 | Ga0451576_0075815_1455_2435 | 289 |
| 207 | 3300048904 | Ga0496101_0056855 | Ga0496101_0056855_1520_2500 | 289 |
| 208 | 3300048905 | Ga0496102_0030746 | Ga0496102_0030746_955_1935 | 289 |
| 209 | 3300048909 | Ga0496106_0027054 | Ga0496106_0027054_2761_3741 | 289 |
| 210 | 3300048910 | Ga0496107_0039938 | Ga0496107_0039938_1815_2795 | 289 |
| 211 | 3300048913 | Ga0496110_0032095 | Ga0496110_0032095_2508_3488 | 289 |
| 212 | 3300048917 | Ga0496114_0029409 | Ga0496114_0029409_1760_2740 | 289 |
| 213 | 3300048918 | Ga0496115_0030737 | Ga0496115_0030737_433_1413 | 289 |
| 214 | 3300050512 | nmdc:mga0n895_175112_c1 | nmdc:mga0n895_175112_c1_531_1511 | 289 |
| 215 | 3300006353 | Ga0075370_10000505 | Ga0075370_1000050511 | 290 |
| 216 | 3300031456 | Ga0307513_10032604 | Ga0307513_100326043 | 290 |
| 217 | 3300031730 | Ga0307516_10001680 | Ga0307516_1000168019 | 290 |
| 218 | 3300005331 | Ga0070670_100005503 | Ga0070670_1000055033 | 291 |
| 219 | 3300005333 | Ga0070677_10001348 | Ga0070677_100013484 | 291 |
| 220 | 3300005333 | Ga0070677_10093314 | Ga0070677_100933141 | 291 |
| 221 | 3300005353 | Ga0070669_100013992 | Ga0070669_1000139922 | 291 |
| 222 | 3300005354 | Ga0070675_100000811 | Ga0070675_10000081111 | 291 |
| 223 | 3300005354 | Ga0070675_100132339 | Ga0070675_1001323392 | 291 |
| 224 | 3300005354 | Ga0070675_100201446 | Ga0070675_1002014462 | 291 |
| 225 | 3300005355 | Ga0070671_100133172 | Ga0070671_1001331722 | 291 |
| 226 | 3300005356 | Ga0070674_100032959 | Ga0070674_1000329591 | 291 |
| 227 | 3300005364 | Ga0070673_100027447 | Ga0070673_1000274472 | 291 |
| 228 | 3300005455 | Ga0070663_100024312 | Ga0070663_1000243122 | 291 |
| 229 | 3300005456 | Ga0070678_100278572 | Ga0070678_1002785722 | 291 |
| 230 | 3300005459 | Ga0068867_100022167 | Ga0068867_1000221675 | 291 |
| 231 | 3300005467 | Ga0070706_100003212 | Ga0070706_1000032127 | 291 |
| 232 | 3300005539 | Ga0068853_100230003 | Ga0068853_1002300032 | 291 |
| 233 | 3300005577 | Ga0068857_100061892 | Ga0068857_1000618923 | 291 |
| 234 | 3300005578 | Ga0068854_100105943 | Ga0068854_1001059433 | 291 |
| 235 | 3300005834 | Ga0068851_10075809 | Ga0068851_100758092 | 291 |
| 236 | 3300005840 | Ga0068870_10010036 | Ga0068870_100100362 | 291 |
| 237 | 3300005843 | Ga0068860_100309884 | Ga0068860_1003098841 | 291 |
| 238 | 3300006042 | Ga0075368_10002119 | Ga0075368_100021197 | 291 |
| 239 | 3300006042 | Ga0075368_10031925 | Ga0075368_100319252 | 291 |
| 240 | 3300006177 | Ga0075362_10004079 | Ga0075362_100040792 | 291 |
| 241 | 3300006177 | Ga0075362_10048350 | Ga0075362_100483502 | 291 |
| 242 | 3300006178 | Ga0075367_10004037 | Ga0075367_100040378 | 291 |
| 243 | 3300006195 | Ga0075366_10001252 | Ga0075366_100012522 | 291 |
| 244 | 3300006195 | Ga0075366_10024936 | Ga0075366_100249364 | 291 |
| 245 | 3300006195 | Ga0075366_10073292 | Ga0075366_100732921 | 291 |
| 246 | 3300006353 | Ga0075370_10000533 | Ga0075370_1000053314 | 291 |
| 247 | 3300006353 | Ga0075370_10000983 | Ga0075370_100009837 | 291 |
| 248 | 3300006353 | Ga0075370_10026902 | Ga0075370_100269022 | 291 |
| 249 | 3300006353 | Ga0075370_10058015 | Ga0075370_100580152 | 291 |
| 250 | 3300009093 | Ga0105240_10302027 | Ga0105240_103020272 | 291 |
| 251 | 3300010375 | Ga0105239_10045083 | Ga0105239_100450834 | 291 |
| 252 | 3300017792 | Ga0163161_10268134 | Ga0163161_102681342 | 291 |
| 253 | 3300025315 | Ga0207697_10017407 | Ga0207697_100174072 | 291 |
| 254 | 3300025893 | Ga0207682_10000902 | Ga0207682_1000090212 | 291 |
| 255 | 3300025893 | Ga0207682_10079594 | Ga0207682_100795942 | 291 |
| 256 | 3300025901 | Ga0207688_10082591 | Ga0207688_100825912 | 291 |
| 257 | 3300025908 | Ga0207643_10081971 | Ga0207643_100819712 | 291 |
| 258 | 3300025910 | Ga0207684_10001976 | Ga0207684_1000197611 | 291 |
| 259 | 3300025925 | Ga0207650_10000580 | Ga0207650_1000058016 | 291 |
| 260 | 3300025926 | Ga0207659_10187568 | Ga0207659_101875682 | 291 |
| 261 | 3300025931 | Ga0207644_10003339 | Ga0207644_1000333910 | 291 |
| 262 | 3300025931 | Ga0207644_10020707 | Ga0207644_100207071 | 291 |
| 263 | 3300025937 | Ga0207669_10009375 | Ga0207669_100093755 | 291 |
| 264 | 3300025942 | Ga0207689_10030787 | Ga0207689_100307874 | 291 |
| 265 | 3300025945 | Ga0207679_10166911 | Ga0207679_101669112 | 291 |
| 266 | 3300025960 | Ga0207651_10014111 | Ga0207651_100141113 | 291 |
| 267 | 3300025981 | Ga0207640_10046154 | Ga0207640_100461542 | 291 |
| 268 | 3300025986 | Ga0207658_10087666 | Ga0207658_100876662 | 291 |
| 269 | 3300026089 | Ga0207648_10003741 | Ga0207648_1000374112 | 291 |
| 270 | 3300026116 | Ga0207674_10028708 | Ga0207674_100287085 | 291 |
| 271 | 3300026142 | Ga0207698_10171997 | Ga0207698_101719972 | 291 |
| 272 | 3300028381 | Ga0268264_10224964 | Ga0268264_102249642 | 291 |
| 273 | 3300031456 | Ga0307513_10182027 | Ga0307513_101820272 | 291 |
| 274 | 3300031730 | Ga0307516_10041912 | Ga0307516_100419125 | 291 |
| 275 | 3300035171 | Ga0373946_0096354 | Ga0373946_0096354_185_1309 | 291 |
| 276 | 3300046522 | Ga0495643_0138148 | Ga0495643_0138148_118_1131 | 291 |
| 277 | 3300046537 | Ga0495598_0064335 | Ga0495598_0064335_32_1045 | 291 |
| 278 | 3300046542 | Ga0495597_0023805 | Ga0495597_0023805_805_1818 | 291 |
| 279 | 3300046694 | Ga0495649_0022635 | Ga0495649_0022635_210_1241 | 291 |
| 280 | 3300046810 | Ga0495660_0009993 | Ga0495660_0009993_2394_3425 | 291 |
| 281 | 3300047443 | Ga0495687_002674 | Ga0495687_002674_3727_4740 | 291 |
| 282 | 3300047443 | Ga0495687_012461 | Ga0495687_012461_1124_2155 | 291 |
| 283 | 3300048917 | Ga0496114_0022175 | Ga0496114_0022175_1360_2343 | 291 |
| 284 | 3300050489 | nmdc:mga03683_3203_c1 | nmdc:mga03683_3203_c1_3734_4738 | 291 |
| 285 | 3300050489 | nmdc:mga03683_32980_c1 | nmdc:mga03683_32980_c1_379_1383 | 291 |
| 286 | 3300050492 | nmdc:mga0yw44_200578_c1 | nmdc:mga0yw44_200578_c1_171_1175 | 291 |
| 287 | 3300050493 | nmdc:mga0k408_12958_c1 | nmdc:mga0k408_12958_c1_2483_3505 | 291 |
| 288 | 3300050493 | nmdc:mga0k408_27059_c1 | nmdc:mga0k408_27059_c1_768_1787 | 291 |
| 289 | 3300050493 | nmdc:mga0k408_46296_c1 | nmdc:mga0k408_46296_c1_109_1170 | 291 |
| 290 | 3300050493 | nmdc:mga0k408_8189_c1 | nmdc:mga0k408_8189_c1_262_1266 | 291 |
| 291 | 3300050494 | nmdc:mga06z11_214390_c1 | nmdc:mga06z11_214390_c1_85_1113 | 291 |
| 292 | 3300050496 | nmdc:mga07m45_118740_c1 | nmdc:mga07m45_118740_c1_506_1510 | 291 |
| 293 | 3300050496 | nmdc:mga07m45_2072_c1 | nmdc:mga07m45_2072_c1_2376_3380 | 291 |
| 294 | 3300050496 | nmdc:mga07m45_50459_c1 | nmdc:mga07m45_50459_c1_745_1764 | 291 |
| 295 | 3300053134 | Ga0500658_0018775 | Ga0500658_0018775_1469_2500 | 291 |
| 296 | iso_pu_bacteria | 2643221654 | 2644305573 | 291 |
| 297 | 3300030522 | Ga0307512_10018166 | Ga0307512_100181664 | 292 |
| 298 | 3300031507 | Ga0307509_10001869 | Ga0307509_1000186924 | 292 |
| 299 | 3300031649 | Ga0307514_10008353 | Ga0307514_100083537 | 292 |
| 300 | 3300031824 | Ga0307413_10127203 | Ga0307413_101272032 | 292 |
| 301 | 3300046454 | Ga0495592_0000145 | Ga0495592_0000145_28101_29117 | 292 |
| 302 | 3300046660 | Ga0495625_0012800 | Ga0495625_0012800_1506_2561 | 292 |
| 303 | 3300053139 | Ga0500568_0049958 | Ga0500568_0049958_607_1608 | 292 |
| 304 | 3300053154 | Ga0500619_034772 | Ga0500619_034772_166_1182 | 292 |
| 305 | 3300005328 | Ga0070676_10002874 | Ga0070676_100028749 | 293 |
| 306 | 3300005355 | Ga0070671_100043264 | Ga0070671_1000432642 | 293 |
| 307 | 3300005459 | Ga0068867_100017549 | Ga0068867_1000175496 | 293 |
| 308 | 3300005578 | Ga0068854_100055466 | Ga0068854_1000554663 | 293 |
| 309 | 3300005616 | Ga0068852_100155488 | Ga0068852_1001554882 | 293 |
| 310 | 3300025907 | Ga0207645_10033862 | Ga0207645_100338623 | 293 |
| 311 | 3300025931 | Ga0207644_10101367 | Ga0207644_101013672 | 293 |
| 312 | 3300026023 | Ga0207677_10024773 | Ga0207677_100247733 | 293 |
| 313 | 3300028794 | Ga0307515_10034576 | Ga0307515_100345767 | 293 |
| 314 | 3300053136 | Ga0500559_0000107 | Ga0500559_0000107_35425_36438 | 293 |
| 315 | 3300053156 | Ga0500622_0004859 | Ga0500622_0004859_6035_7060 | 293 |
| 316 | 3300053177 | Ga0500636_0062503 | Ga0500636_0062503_1014_2027 | 293 |
| 317 | 3300053739 | Ga0500587_002450 | Ga0500587_002450_38_1063 | 293 |
| 318 | 3300003316 | rootH1_10016395 | rootH1_100163958 | 294 |
| 319 | 3300025937 | Ga0207669_10028042 | Ga0207669_100280422 | 294 |
| 320 | 3300031731 | Ga0307405_10015836 | Ga0307405_100158364 | 294 |
| 321 | 3300031901 | Ga0307406_10006930 | Ga0307406_100069306 | 294 |
| 322 | 3300031911 | Ga0307412_10002558 | Ga0307412_100025589 | 294 |
| 323 | 3300031995 | Ga0307409_100168538 | Ga0307409_1001685382 | 294 |
| 324 | 3300032002 | Ga0307416_100151368 | Ga0307416_1001513682 | 294 |
| 325 | 3300032126 | Ga0307415_100089606 | Ga0307415_1000896062 | 294 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xpf-assembly1.cif.gz_A | cryo-em structure of human znt8 wt, in the absence of zinc, determined in heterogeneous conformations- one subunit in an inward-facing and the other in an outward-facing conformation | 0.8866 | 2 | 268 |
| 6vd9-assembly2.cif.gz_B | metal-bound c-terminal domain of the czcd transporter from cuprividus metallidurans | 0.8839 | 198 | 268 |
| 6vd8-assembly1.cif.gz_B-2 | metal-bound c-terminal domain of czcd transporter from pseudomonas aeruginosa | 0.8597 | 198 | 271 |
| 6vd9-assembly2.cif.gz_B | metal-bound c-terminal domain of the czcd transporter from cuprividus metallidurans | 0.8511 | 198 | 268 |
| 6vd8-assembly1.cif.gz_A | metal-bound c-terminal domain of czcd transporter from pseudomonas aeruginosa | 0.8288 | 192 | 271 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75757_17_213_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.9379 | 2 | 188 | 1.20.1510.10 |
| af_Q2FWA9_216_326_3.30.70.1350 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain | 0.9174 | 192 | 268 | 3.30.70.1350 |
| af_Q9M271_29_255_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.9165 | 2 | 188 | 1.20.1510.10 |
| af_O35149_110_332_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.9141 | 2 | 187 | 1.20.1510.10 |
| af_Q6DBM8_296_375_3.30.70.1350 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain | 0.9002 | 192 | 268 | 3.30.70.1350 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2RFN1-F1-model_v4 | Cation transporter | 0.9663 | 2 | 270 |
GO:0005385
GO:0005886 |
| AF-A0A5C6FB96-F1-model_v4 | Cadmium, cobalt and zinc/H(+)-K(+) antiporter | 0.9516 | 2 | 280 |
GO:0005385
GO:0005886 |
| AF-A0A2T4CSY2-F1-model_v4 | Cation transporter | 0.9512 | 4 | 191 |
GO:0005385
GO:0005886 |
| AF-A0A3M8B4U8-F1-model_v4 | Cation transporter | 0.9502 | 2 | 268 |
GO:0005385
GO:0005886 |
| AF-A0A350SKD4-F1-model_v4 | deleted | 0.95 | 2 | 270 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar