F407563
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 324 | 186 | 322 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0000043|Ga0501034_0000043_193931_194269 |
| Length | 112 |
| Sequence | MQLLSIFLMMDPQGKGSSTSTLIMMGLMVLVFWLFMIRPQAKKAKQQKNFINELQKGDKVVTIAGIHGTVNKVEDNTIMLETSPGSYIKIEKSAISMEWTSNLNKKAEEPKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 2 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 135 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 138 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 139 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 140 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 143 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 144 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 145 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 146 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 147 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 148 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 149 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 150 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 156 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 157 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 158 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 171 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 172 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 173 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 174 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 179 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 181 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 182 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 183 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 184 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 185 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.46 |
| Metatranscriptomes | 0.93 |
| Isolates | 0.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.78 |
| Nodule | 0 |
| Rhizoplane | 1.54 |
| Rhizosphere | 92.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10008154 | 3300003203 | Bacteria | 4757 |
| 2 | rootH2_10110839 | 3300003320 | Bacteria | 2751 |
| 3 | rootH2_10228236 | 3300003320 | Bacteria | 3949 |
| 4 | rootL2_10262782 | 3300003322 | Bacteria | 3002 |
| 5 | rootH1_10213669 | 3300003323 | Bacteria | 4646 |
| 6 | JGI25160J50197_1002034 | 3300003354 | Bacteria | 9644 |
| 7 | Ga0065712_10136788 | 3300005290 | Unclassified | 1489 |
| 8 | Ga0070676_10241458 | 3300005328 | Unclassified | 1202 |
| 9 | Ga0070683_100015154 | 3300005329 | Bacteria | 6767 |
| 10 | Ga0070683_100018061 | 3300005329 | Bacteria | 6240 |
| 11 | Ga0070690_100021661 | 3300005330 | Bacteria | 3926 |
| 12 | Ga0070690_100092900 | 3300005330 | Bacteria | 1990 |
| 13 | Ga0070677_10418286 | 3300005333 | Bacteria | 710 |
| 14 | Ga0068869_100033253 | 3300005334 | Bacteria | 3640 |
| 15 | Ga0070666_10070193 | 3300005335 | Bacteria | 2383 |
| 16 | Ga0070666_10151960 | 3300005335 | Unclassified | 1615 |
| 17 | Ga0070680_100201220 | 3300005336 | Bacteria | 1680 |
| 18 | Ga0070682_100000060 | 3300005337 | Bacteria | 105136 |
| 19 | Ga0070682_100003140 | 3300005337 | Bacteria | 9151 |
| 20 | Ga0070682_100638240 | 3300005337 | Unclassified | 846 |
| 21 | Ga0070682_100789353 | 3300005337 | Bacteria | 770 |
| 22 | Ga0068868_100276780 | 3300005338 | Bacteria | 1419 |
| 23 | Ga0070660_100034437 | 3300005339 | Bacteria | 3826 |
| 24 | Ga0070660_100248926 | 3300005339 | Bacteria | 1449 |
| 25 | Ga0070660_100700403 | 3300005339 | Unclassified | 849 |
| 26 | Ga0070691_10004393 | 3300005341 | Bacteria | 6405 |
| 27 | Ga0070691_10014565 | 3300005341 | Unclassified | 3609 |
| 28 | Ga0070691_10086939 | 3300005341 | Bacteria | 1537 |
| 29 | Ga0070687_100079673 | 3300005343 | Bacteria | 1783 |
| 30 | Ga0070661_100027595 | 3300005344 | Bacteria | 4089 |
| 31 | Ga0070661_100575691 | 3300005344 | Bacteria | 908 |
| 32 | Ga0070669_100238344 | 3300005353 | Bacteria | 1444 |
| 33 | Ga0070675_100032314 | 3300005354 | Bacteria | 4235 |
| 34 | Ga0070675_100051092 | 3300005354 | Bacteria | 3396 |
| 35 | Ga0070671_100237332 | 3300005355 | Bacteria | 1548 |
| 36 | Ga0070671_100339563 | 3300005355 | Bacteria | 1281 |
| 37 | Ga0070674_100139334 | 3300005356 | Bacteria | 1819 |
| 38 | Ga0070673_100022607 | 3300005364 | Bacteria | 4580 |
| 39 | Ga0070673_100023820 | 3300005364 | Bacteria | 4478 |
| 40 | Ga0070673_100655382 | 3300005364 | Bacteria | 961 |
| 41 | Ga0070659_100027007 | 3300005366 | Bacteria | 4420 |
| 42 | Ga0070659_101434447 | 3300005366 | Unclassified | 614 |
| 43 | Ga0070667_100091760 | 3300005367 | Bacteria | 2612 |
| 44 | Ga0070667_101025513 | 3300005367 | Bacteria | 770 |
| 45 | Ga0070663_100105223 | 3300005455 | Unclassified | 2112 |
| 46 | Ga0070678_100026602 | 3300005456 | Bacteria | 3914 |
| 47 | Ga0070678_100192330 | 3300005456 | Bacteria | 1678 |
| 48 | Ga0070662_100071565 | 3300005457 | Bacteria | 2557 |
| 49 | Ga0070662_100300849 | 3300005457 | Bacteria | 1303 |
| 50 | Ga0070681_10182971 | 3300005458 | Bacteria | 2017 |
| 51 | Ga0070681_10223180 | 3300005458 | Bacteria | 1799 |
| 52 | Ga0070681_10497101 | 3300005458 | Unclassified | 1133 |
| 53 | Ga0068867_100122959 | 3300005459 | Bacteria | 2008 |
| 54 | Ga0070679_100121319 | 3300005530 | Bacteria | 2599 |
| 55 | Ga0070679_100170337 | 3300005530 | Bacteria | 2150 |
| 56 | Ga0070679_100426211 | 3300005530 | Bacteria | 1272 |
| 57 | Ga0070679_101889675 | 3300005530 | Bacteria | 546 |
| 58 | Ga0070684_100011105 | 3300005535 | Bacteria | 7166 |
| 59 | Ga0070684_100134028 | 3300005535 | Bacteria | 2236 |
| 60 | Ga0068853_100129148 | 3300005539 | Bacteria | 2260 |
| 61 | Ga0068853_100213920 | 3300005539 | Bacteria | 1758 |
| 62 | Ga0068853_101115281 | 3300005539 | Unclassified | 761 |
| 63 | Ga0070672_100072835 | 3300005543 | Bacteria | 2736 |
| 64 | Ga0070672_100312071 | 3300005543 | Bacteria | 1335 |
| 65 | Ga0070672_100889369 | 3300005543 | Bacteria | 786 |
| 66 | Ga0070672_101939375 | 3300005543 | Bacteria | 530 |
| 67 | Ga0070672_102060497 | 3300005543 | Bacteria | 514 |
| 68 | Ga0070686_100143453 | 3300005544 | Bacteria | 1665 |
| 69 | Ga0070693_100022813 | 3300005547 | Unclassified | 3335 |
| 70 | Ga0070693_100273587 | 3300005547 | Unclassified | 1128 |
| 71 | Ga0070665_101389531 | 3300005548 | Bacteria | 711 |
| 72 | Ga0070704_101257327 | 3300005549 | Bacteria | 676 |
| 73 | Ga0068855_100001225 | 3300005563 | Bacteria | 31850 |
| 74 | Ga0068855_100005467 | 3300005563 | Bacteria | 15499 |
| 75 | Ga0068855_100053158 | 3300005563 | Unclassified | 4766 |
| 76 | Ga0068855_100748020 | 3300005563 | Bacteria | 1043 |
| 77 | Ga0070664_100069660 | 3300005564 | Bacteria | 3010 |
| 78 | Ga0070664_100235868 | 3300005564 | Bacteria | 1641 |
| 79 | Ga0070664_100261408 | 3300005564 | Unclassified | 1557 |
| 80 | Ga0070664_100357193 | 3300005564 | Bacteria | 1330 |
| 81 | Ga0068857_100034712 | 3300005577 | Bacteria | 4461 |
| 82 | Ga0068857_100735393 | 3300005577 | Bacteria | 939 |
| 83 | Ga0068857_101989482 | 3300005577 | Bacteria | 570 |
| 84 | Ga0068854_100086495 | 3300005578 | Bacteria | 2324 |
| 85 | Ga0068856_100057709 | 3300005614 | Bacteria | 3833 |
| 86 | Ga0068856_100081874 | 3300005614 | Bacteria | 3203 |
| 87 | Ga0070702_100039750 | 3300005615 | Bacteria | 2627 |
| 88 | Ga0068852_100109598 | 3300005616 | Bacteria | 2508 |
| 89 | Ga0068852_100174975 | 3300005616 | Bacteria | 2015 |
| 90 | Ga0068852_100687133 | 3300005616 | Bacteria | 1033 |
| 91 | Ga0068852_100972008 | 3300005616 | Unclassified | 867 |
| 92 | Ga0068859_100249241 | 3300005617 | Bacteria | 1866 |
| 93 | Ga0068859_100455625 | 3300005617 | Bacteria | 1375 |
| 94 | Ga0068864_100358851 | 3300005618 | Bacteria | 1377 |
| 95 | Ga0068864_100593238 | 3300005618 | Bacteria | 1074 |
| 96 | Ga0068851_10061828 | 3300005834 | Bacteria | 1920 |
| 97 | Ga0068863_100741191 | 3300005841 | Bacteria | 978 |
| 98 | Ga0068858_100367111 | 3300005842 | Bacteria | 1380 |
| 99 | Ga0068860_100003184 | 3300005843 | Bacteria | 16934 |
| 100 | Ga0068860_100313210 | 3300005843 | Bacteria | 1539 |
| 101 | Ga0068860_100605532 | 3300005843 | Bacteria | 1101 |
| 102 | Ga0068860_101287198 | 3300005843 | Bacteria | 752 |
| 103 | Ga0068862_100910931 | 3300005844 | Bacteria | 865 |
| 104 | Ga0081539_10000037 | 3300005985 | Bacteria | 296160 |
| 105 | Ga0081539_10160816 | 3300005985 | Bacteria | 1070 |
| 106 | Ga0070715_10827158 | 3300006163 | Bacteria | 564 |
| 107 | Ga0070712_100446472 | 3300006175 | Bacteria | 1076 |
| 108 | Ga0097621_100027317 | 3300006237 | Bacteria | 4486 |
| 109 | Ga0097621_100586926 | 3300006237 | Bacteria | 1017 |
| 110 | Ga0068871_100017790 | 3300006358 | Bacteria | 5388 |
| 111 | Ga0068871_100066687 | 3300006358 | Bacteria | 2951 |
| 112 | Ga0068871_101695662 | 3300006358 | Bacteria | 599 |
| 113 | Ga0075433_10546628 | 3300006852 | Bacteria | 1018 |
| 114 | Ga0068865_100716825 | 3300006881 | Bacteria | 856 |
| 115 | Ga0097620_100249246 | 3300006931 | Bacteria | 1866 |
| 116 | Ga0097620_100455642 | 3300006931 | Bacteria | 1375 |
| 117 | Ga0105240_10002434 | 3300009093 | Bacteria | 29930 |
| 118 | Ga0105240_10003457 | 3300009093 | Bacteria | 24509 |
| 119 | Ga0105240_10277969 | 3300009093 | Bacteria | 1925 |
| 120 | Ga0111539_10841418 | 3300009094 | Bacteria | 1068 |
| 121 | Ga0114129_10012470 | 3300009147 | Bacteria | 12100 |
| 122 | Ga0105241_10001522 | 3300009174 | Bacteria | 17775 |
| 123 | Ga0105241_10013626 | 3300009174 | Bacteria | 5957 |
| 124 | Ga0105241_10692749 | 3300009174 | Bacteria | 929 |
| 125 | Ga0105241_11418760 | 3300009174 | Bacteria | 665 |
| 126 | Ga0105242_12562708 | 3300009176 | Unclassified | 559 |
| 127 | Ga0105237_10071558 | 3300009545 | Bacteria | 3462 |
| 128 | Ga0105237_10113197 | 3300009545 | Unclassified | 2706 |
| 129 | Ga0105237_10221345 | 3300009545 | Bacteria | 1893 |
| 130 | Ga0105238_10900999 | 3300009551 | Unclassified | 903 |
| 131 | Ga0105239_10654593 | 3300010375 | Bacteria | 1200 |
| 132 | Ga0157373_10032333 | 3300013100 | Bacteria | 3766 |
| 133 | Ga0157373_10059299 | 3300013100 | Bacteria | 2712 |
| 134 | Ga0157373_10172300 | 3300013100 | Unclassified | 1523 |
| 135 | Ga0157373_10178290 | 3300013100 | Bacteria | 1496 |
| 136 | Ga0157373_11229085 | 3300013100 | Bacteria | 565 |
| 137 | Ga0157371_10028621 | 3300013102 | Bacteria | 4033 |
| 138 | Ga0157371_10038357 | 3300013102 | Bacteria | 3428 |
| 139 | Ga0157371_10091575 | 3300013102 | Bacteria | 2154 |
| 140 | Ga0157371_10125028 | 3300013102 | Bacteria | 1829 |
| 141 | Ga0157370_10069417 | 3300013104 | Bacteria | 3328 |
| 142 | Ga0157370_10138848 | 3300013104 | Bacteria | 2264 |
| 143 | Ga0157370_10286097 | 3300013104 | Bacteria | 1523 |
| 144 | Ga0157370_10293791 | 3300013104 | Bacteria | 1501 |
| 145 | Ga0157370_10504529 | 3300013104 | Bacteria | 1111 |
| 146 | Ga0157369_10047516 | 3300013105 | Bacteria | 4659 |
| 147 | Ga0157369_10068422 | 3300013105 | Bacteria | 3815 |
| 148 | Ga0157369_10309850 | 3300013105 | Bacteria | 1642 |
| 149 | Ga0157374_10031775 | 3300013296 | Bacteria | 4802 |
| 150 | Ga0157378_10010512 | 3300013297 | Bacteria | 8087 |
| 151 | Ga0157378_10137199 | 3300013297 | Bacteria | 2268 |
| 152 | Ga0163162_10002043 | 3300013306 | Bacteria | 18983 |
| 153 | Ga0163162_10110894 | 3300013306 | Bacteria | 2841 |
| 154 | Ga0163162_11008935 | 3300013306 | Bacteria | 941 |
| 155 | Ga0163162_13333167 | 3300013306 | Bacteria | 514 |
| 156 | Ga0157372_10019994 | 3300013307 | Bacteria | 7218 |
| 157 | Ga0157372_10104075 | 3300013307 | Unclassified | 3244 |
| 158 | Ga0157372_10279882 | 3300013307 | Bacteria | 1940 |
| 159 | Ga0157372_10459304 | 3300013307 | Bacteria | 1484 |
| 160 | Ga0157372_10808050 | 3300013307 | Bacteria | 1089 |
| 161 | Ga0157372_10914987 | 3300013307 | Bacteria | 1017 |
| 162 | Ga0157372_10937443 | 3300013307 | Bacteria | 1004 |
| 163 | Ga0157372_12665953 | 3300013307 | Bacteria | 573 |
| 164 | Ga0157375_10080649 | 3300013308 | Bacteria | 3293 |
| 165 | Ga0157375_11441023 | 3300013308 | Bacteria | 812 |
| 166 | Ga0157380_10361294 | 3300014326 | Bacteria | 1363 |
| 167 | Ga0157380_10789773 | 3300014326 | Bacteria | 965 |
| 168 | Ga0157380_12075863 | 3300014326 | Unclassified | 631 |
| 169 | Ga0157377_10012082 | 3300014745 | Bacteria | 4331 |
| 170 | Ga0157377_10995729 | 3300014745 | Bacteria | 634 |
| 171 | Ga0157379_10224489 | 3300014968 | Bacteria | 1702 |
| 172 | Ga0157379_10615919 | 3300014968 | Unclassified | 1014 |
| 173 | Ga0157376_10706841 | 3300014969 | Unclassified | 1013 |
| 174 | Ga0157376_10799801 | 3300014969 | Bacteria | 955 |
| 175 | Ga0157376_11531823 | 3300014969 | Bacteria | 700 |
| 176 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 177 | Ga0207656_10042835 | 3300025321 | Bacteria | 1928 |
| 178 | Ga0207682_10450855 | 3300025893 | Bacteria | 609 |
| 179 | Ga0207688_10017028 | 3300025901 | Bacteria | 3950 |
| 180 | Ga0207680_10066145 | 3300025903 | Bacteria | 2222 |
| 181 | Ga0207680_11074363 | 3300025903 | Bacteria | 576 |
| 182 | Ga0207645_10109593 | 3300025907 | Bacteria | 1786 |
| 183 | Ga0207645_10760230 | 3300025907 | Bacteria | 659 |
| 184 | Ga0207705_10093666 | 3300025909 | Unclassified | 2202 |
| 185 | Ga0207705_11426238 | 3300025909 | Unclassified | 526 |
| 186 | Ga0207654_10392274 | 3300025911 | Unclassified | 964 |
| 187 | Ga0207654_11447374 | 3300025911 | Bacteria | 501 |
| 188 | Ga0207707_10000889 | 3300025912 | Bacteria | 29199 |
| 189 | Ga0207707_10161652 | 3300025912 | Bacteria | 1958 |
| 190 | Ga0207695_10000128 | 3300025913 | Bacteria | 226098 |
| 191 | Ga0207695_10025123 | 3300025913 | Bacteria | 6681 |
| 192 | Ga0207695_10351979 | 3300025913 | Bacteria | 1360 |
| 193 | Ga0207695_10667948 | 3300025913 | Bacteria | 920 |
| 194 | Ga0207671_10106482 | 3300025914 | Bacteria | 2129 |
| 195 | Ga0207671_10864365 | 3300025914 | Unclassified | 716 |
| 196 | Ga0207660_10002515 | 3300025917 | Bacteria | 12055 |
| 197 | Ga0207660_10244820 | 3300025917 | Unclassified | 1414 |
| 198 | Ga0207662_10001150 | 3300025918 | Bacteria | 12516 |
| 199 | Ga0207657_10005302 | 3300025919 | Bacteria | 13511 |
| 200 | Ga0207657_10589405 | 3300025919 | Unclassified | 868 |
| 201 | Ga0207649_10050830 | 3300025920 | Bacteria | 2565 |
| 202 | Ga0207652_10002423 | 3300025921 | Bacteria | 15744 |
| 203 | Ga0207652_10160327 | 3300025921 | Bacteria | 2016 |
| 204 | Ga0207652_11133503 | 3300025921 | Bacteria | 683 |
| 205 | Ga0207659_10041025 | 3300025926 | Bacteria | 3240 |
| 206 | Ga0207659_10092840 | 3300025926 | Bacteria | 2258 |
| 207 | Ga0207644_10051786 | 3300025931 | Bacteria | 2948 |
| 208 | Ga0207644_10214843 | 3300025931 | Unclassified | 1522 |
| 209 | Ga0207690_10027334 | 3300025932 | Bacteria | 3605 |
| 210 | Ga0207706_10004741 | 3300025933 | Bacteria | 12733 |
| 211 | Ga0207706_10010706 | 3300025933 | Bacteria | 8377 |
| 212 | Ga0207706_10052670 | 3300025933 | Bacteria | 3593 |
| 213 | Ga0207686_10356281 | 3300025934 | Unclassified | 1103 |
| 214 | Ga0207669_11838930 | 3300025937 | Bacteria | 517 |
| 215 | Ga0207704_10366015 | 3300025938 | Bacteria | 1127 |
| 216 | Ga0207691_10038966 | 3300025940 | Bacteria | 4397 |
| 217 | Ga0207691_10700753 | 3300025940 | Bacteria | 854 |
| 218 | Ga0207689_10227416 | 3300025942 | Bacteria | 1542 |
| 219 | Ga0207661_10003759 | 3300025944 | Bacteria | 10570 |
| 220 | Ga0207661_10032582 | 3300025944 | Bacteria | 4038 |
| 221 | Ga0207661_10639765 | 3300025944 | Bacteria | 977 |
| 222 | Ga0207679_10056359 | 3300025945 | Bacteria | 2901 |
| 223 | Ga0207667_10000143 | 3300025949 | Bacteria | 108717 |
| 224 | Ga0207667_10003830 | 3300025949 | Bacteria | 18496 |
| 225 | Ga0207667_10098282 | 3300025949 | Unclassified | 3021 |
| 226 | Ga0207667_10360523 | 3300025949 | Unclassified | 1482 |
| 227 | Ga0207651_10086250 | 3300025960 | Bacteria | 2281 |
| 228 | Ga0207651_10285283 | 3300025960 | Bacteria | 1366 |
| 229 | Ga0207651_10955181 | 3300025960 | Bacteria | 765 |
| 230 | Ga0207640_10133196 | 3300025981 | Unclassified | 1800 |
| 231 | Ga0207640_10841862 | 3300025981 | Bacteria | 797 |
| 232 | Ga0207658_10397352 | 3300025986 | Bacteria | 1211 |
| 233 | Ga0207658_10981370 | 3300025986 | Bacteria | 770 |
| 234 | Ga0207677_10435375 | 3300026023 | Bacteria | 1120 |
| 235 | Ga0207703_11249230 | 3300026035 | Bacteria | 714 |
| 236 | Ga0207639_10110023 | 3300026041 | Bacteria | 2243 |
| 237 | Ga0207639_10199169 | 3300026041 | Bacteria | 1716 |
| 238 | Ga0207639_10559293 | 3300026041 | Bacteria | 1051 |
| 239 | Ga0207678_10130862 | 3300026067 | Unclassified | 2140 |
| 240 | Ga0207702_10066982 | 3300026078 | Bacteria | 3080 |
| 241 | Ga0207702_10535535 | 3300026078 | Bacteria | 1144 |
| 242 | Ga0207641_10654910 | 3300026088 | Bacteria | 1032 |
| 243 | Ga0207648_10586047 | 3300026089 | Bacteria | 1027 |
| 244 | Ga0207648_10627779 | 3300026089 | Bacteria | 992 |
| 245 | Ga0207648_11362230 | 3300026089 | Bacteria | 667 |
| 246 | Ga0207676_10237192 | 3300026095 | Bacteria | 1634 |
| 247 | Ga0207676_11721902 | 3300026095 | Bacteria | 625 |
| 248 | Ga0207674_10909526 | 3300026116 | Bacteria | 848 |
| 249 | Ga0207674_12037047 | 3300026116 | Unclassified | 539 |
| 250 | Ga0207675_100319748 | 3300026118 | Unclassified | 1515 |
| 251 | Ga0207675_100332948 | 3300026118 | Bacteria | 1484 |
| 252 | Ga0207683_10031863 | 3300026121 | Bacteria | 4578 |
| 253 | Ga0207683_10141801 | 3300026121 | Bacteria | 2166 |
| 254 | Ga0207698_10393333 | 3300026142 | Unclassified | 1322 |
| 255 | Ga0209995_1046431 | 3300027471 | Bacteria | 735 |
| 256 | Ga0209974_10028154 | 3300027876 | Bacteria | 1860 |
| 257 | Ga0268265_11205062 | 3300028380 | Bacteria | 755 |
| 258 | Ga0268264_10124534 | 3300028381 | Unclassified | 2276 |
| 259 | Ga0268264_10742109 | 3300028381 | Bacteria | 978 |
| 260 | Ga0268264_10810277 | 3300028381 | Bacteria | 936 |
| 261 | Ga0307508_10131100 | 3300031616 | Bacteria | 2110 |
| 262 | Ga0307414_10348796 | 3300032004 | Bacteria | 1270 |
| 263 | Ga0307507_10294460 | 3300033179 | Bacteria | 1001 |
| 264 | Ga0373951_0210089 | 3300035091 | Bacteria | 571 |
| 265 | Ga0373932_0225819 | 3300035112 | Bacteria | 675 |
| 266 | Ga0373939_0272540 | 3300035114 | Bacteria | 666 |
| 267 | Ga0373943_0365084 | 3300035170 | Bacteria | 829 |
| 268 | Ga0439439_0105004 | 3300041406 | Bacteria | 780 |
| 269 | Ga0451793_0320429 | 3300041452 | Bacteria | 674 |
| 270 | Ga0451807_1540202 | 3300041486 | Bacteria | 518 |
| 271 | Ga0451853_0354213 | 3300041512 | Bacteria | 507 |
| 272 | Ga0451853_0374342 | 3300041512 | Bacteria | 537 |
| 273 | Ga0451853_3931169 | 3300041512 | Bacteria | 1389 |
| 274 | Ga0439445_0000786 | 3300042004 | Bacteria | 6674 |
| 275 | Ga0466969_0000406 | 3300044656 | Bacteria | 23757 |
| 276 | Ga0466966_0000028 | 3300044684 | Bacteria | 105667 |
| 277 | Ga0466964_0016622 | 3300044706 | Bacteria | 2811 |
| 278 | Ga0466971_0170650 | 3300044719 | Bacteria | 1021 |
| 279 | Ga0466971_0255042 | 3300044719 | Bacteria | 836 |
| 280 | Ga0466970_0333606 | 3300044765 | Bacteria | 859 |
| 281 | Ga0466970_0377846 | 3300044765 | Bacteria | 806 |
| 282 | Ga0466959_0000047 | 3300045049 | Bacteria | 86901 |
| 283 | Ga0495629_0453017 | 3300046459 | Bacteria | 869 |
| 284 | Ga0495608_0287783 | 3300046511 | Bacteria | 1019 |
| 285 | Ga0495668_0001618 | 3300046616 | Bacteria | 21078 |
| 286 | Ga0495611_0000119 | 3300046648 | Bacteria | 56310 |
| 287 | Ga0495674_0553470 | 3300047319 | Bacteria | 915 |
| 288 | Ga0496106_0913615 | 3300048909 | Bacteria | 693 |
| 289 | Ga0496113_1493417 | 3300048916 | Bacteria | 522 |
| 290 | Ga0496115_0067798 | 3300048918 | Bacteria | 2887 |
| 291 | Ga0501305_103986 | 3300049161 | Bacteria | 531 |
| 292 | Ga0501313_063692 | 3300049529 | Bacteria | 526 |
| 293 | Ga0501335_017314 | 3300049551 | Bacteria | 748 |
| 294 | Ga0501032_0669801 | 3300049569 | Bacteria | 658 |
| 295 | Ga0501034_0000043 | 3300049571 | Bacteria | 229049 |
| 296 | Ga0501034_0429885 | 3300049571 | Bacteria | 1240 |
| 297 | Ga0501034_0816106 | 3300049571 | Bacteria | 825 |
| 298 | Ga0501038_0666414 | 3300049574 | Unclassified | 782 |
| 299 | Ga0501047_0049311 | 3300049581 | Unclassified | 4066 |
| 300 | Ga0501067_0203533 | 3300049583 | Bacteria | 1102 |
| 301 | Ga0501068_0067490 | 3300049584 | Bacteria | 2180 |
| 302 | Ga0501069_0026804 | 3300049585 | Bacteria | 3157 |
| 303 | Ga0501070_0142392 | 3300049586 | Unclassified | 1979 |
| 304 | Ga0501073_0075538 | 3300049589 | Bacteria | 2345 |
| 305 | Ga0501198_111649 | 3300049649 | Bacteria | 566 |
| 306 | Ga0501223_042259 | 3300049663 | Bacteria | 885 |
| 307 | Ga0501243_057236 | 3300049675 | Unclassified | 716 |
| 308 | Ga0501253_171187 | 3300049683 | Unclassified | 559 |
| 309 | Ga0501079_0575054 | 3300049741 | Bacteria | 886 |
| 310 | Ga0501080_0196318 | 3300049742 | Unclassified | 1853 |
| 311 | Ga0501083_0799784 | 3300049744 | Bacteria | 613 |
| 312 | Ga0501044_0082555 | 3300049823 | Unclassified | 3252 |
| 313 | nmdc:mga0k408_360635_c1 | 3300050493 | Bacteria | 866 |
| 314 | nmdc:mga0k408_451724_c1 | 3300050493 | Bacteria | 763 |
| 315 | nmdc:mga0a205_608781_c1 | 3300050515 | Bacteria | 945 |
| 316 | Ga0500628_059815 | 3300053129 | Bacteria | 928 |
| 317 | Ga0500559_0030352 | 3300053136 | Bacteria | 2317 |
| 318 | Ga0500588_0064519 | 3300053146 | Bacteria | 1183 |
| 319 | Ga0500622_0000192 | 3300053156 | Bacteria | 64821 |
| 320 | Ga0500636_0110299 | 3300053177 | Bacteria | 1556 |
| 321 | Ga0501084_0019020 | 3300054114 | Bacteria | 5719 |
| 322 | Ga0501082_0070851 | 3300060353 | Unclassified | 3001 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009176 | Ga0105242_12562708 | Ga0105242_125627082 | 95 |
| 2 | 3300025934 | Ga0207686_10356281 | Ga0207686_103562812 | 95 |
| 3 | 3300005355 | Ga0070671_100339563 | Ga0070671_1003395632 | 105 |
| 4 | 3300005364 | Ga0070673_100655382 | Ga0070673_1006553822 | 105 |
| 5 | 3300005543 | Ga0070672_100312071 | Ga0070672_1003120713 | 105 |
| 6 | 3300014326 | Ga0157380_10789773 | Ga0157380_107897732 | 105 |
| 7 | 3300025931 | Ga0207644_10214843 | Ga0207644_102148433 | 105 |
| 8 | 3300025960 | Ga0207651_10955181 | Ga0207651_109551812 | 105 |
| 9 | 3300005367 | Ga0070667_101025513 | Ga0070667_1010255131 | 106 |
| 10 | 3300009174 | Ga0105241_11418760 | Ga0105241_114187602 | 106 |
| 11 | 3300013102 | Ga0157371_10038357 | Ga0157371_100383572 | 106 |
| 12 | 3300013105 | Ga0157369_10068422 | Ga0157369_100684224 | 106 |
| 13 | 3300025986 | Ga0207658_10981370 | Ga0207658_109813702 | 106 |
| 14 | 3300013307 | Ga0157372_12665953 | Ga0157372_126659532 | 107 |
| 15 | 3300013308 | Ga0157375_11441023 | Ga0157375_114410231 | 107 |
| 16 | 3300014968 | Ga0157379_10615919 | Ga0157379_106159191 | 107 |
| 17 | 3300025944 | Ga0207661_10639765 | Ga0207661_106397652 | 107 |
| 18 | 3300032004 | Ga0307414_10348796 | Ga0307414_103487962 | 107 |
| 19 | 3300005616 | Ga0068852_100972008 | Ga0068852_1009720082 | 108 |
| 20 | 3300005617 | Ga0068859_100249241 | Ga0068859_1002492412 | 108 |
| 21 | 3300005843 | Ga0068860_100313210 | Ga0068860_1003132103 | 108 |
| 22 | 3300006931 | Ga0097620_100249246 | Ga0097620_1002492462 | 108 |
| 23 | 3300013100 | Ga0157373_10059299 | Ga0157373_100592993 | 108 |
| 24 | 3300025933 | Ga0207706_10010706 | Ga0207706_100107067 | 108 |
| 25 | 3300027471 | Ga0209995_1046431 | Ga0209995_10464312 | 108 |
| 26 | 3300027876 | Ga0209974_10028154 | Ga0209974_100281543 | 108 |
| 27 | 3300028381 | Ga0268264_10742109 | Ga0268264_107421092 | 108 |
| 28 | 3300044765 | Ga0466970_0333606 | Ga0466970_0333606_251_577 | 108 |
| 29 | 3300049161 | Ga0501305_103986 | Ga0501305_103986_83_409 | 108 |
| 30 | 3300049529 | Ga0501313_063692 | Ga0501313_063692_78_404 | 108 |
| 31 | 3300049571 | Ga0501034_0816106 | Ga0501034_0816106_28_354 | 108 |
| 32 | 3300053136 | Ga0500559_0030352 | Ga0500559_0030352_1784_2110 | 108 |
| 33 | 3300005328 | Ga0070676_10241458 | Ga0070676_102414582 | 109 |
| 34 | 3300005330 | Ga0070690_100092900 | Ga0070690_1000929002 | 109 |
| 35 | 3300005333 | Ga0070677_10418286 | Ga0070677_104182862 | 109 |
| 36 | 3300005334 | Ga0068869_100033253 | Ga0068869_1000332532 | 109 |
| 37 | 3300005335 | Ga0070666_10070193 | Ga0070666_100701932 | 109 |
| 38 | 3300005337 | Ga0070682_100789353 | Ga0070682_1007893531 | 109 |
| 39 | 3300005338 | Ga0068868_100276780 | Ga0068868_1002767801 | 109 |
| 40 | 3300005343 | Ga0070687_100079673 | Ga0070687_1000796732 | 109 |
| 41 | 3300005344 | Ga0070661_100575691 | Ga0070661_1005756911 | 109 |
| 42 | 3300005353 | Ga0070669_100238344 | Ga0070669_1002383443 | 109 |
| 43 | 3300005354 | Ga0070675_100032314 | Ga0070675_1000323142 | 109 |
| 44 | 3300005355 | Ga0070671_100237332 | Ga0070671_1002373322 | 109 |
| 45 | 3300005356 | Ga0070674_100139334 | Ga0070674_1001393342 | 109 |
| 46 | 3300005364 | Ga0070673_100022607 | Ga0070673_1000226075 | 109 |
| 47 | 3300005367 | Ga0070667_100091760 | Ga0070667_1000917603 | 109 |
| 48 | 3300005456 | Ga0070678_100026602 | Ga0070678_1000266021 | 109 |
| 49 | 3300005457 | Ga0070662_100300849 | Ga0070662_1003008492 | 109 |
| 50 | 3300005459 | Ga0068867_100122959 | Ga0068867_1001229592 | 109 |
| 51 | 3300005543 | Ga0070672_100072835 | Ga0070672_1000728354 | 109 |
| 52 | 3300005564 | Ga0070664_100069660 | Ga0070664_1000696606 | 109 |
| 53 | 3300005615 | Ga0070702_100039750 | Ga0070702_1000397503 | 109 |
| 54 | 3300005616 | Ga0068852_100174975 | Ga0068852_1001749752 | 109 |
| 55 | 3300005617 | Ga0068859_100455625 | Ga0068859_1004556251 | 109 |
| 56 | 3300005618 | Ga0068864_100358851 | Ga0068864_1003588513 | 109 |
| 57 | 3300005841 | Ga0068863_100741191 | Ga0068863_1007411912 | 109 |
| 58 | 3300005842 | Ga0068858_100367111 | Ga0068858_1003671112 | 109 |
| 59 | 3300005843 | Ga0068860_100605532 | Ga0068860_1006055322 | 109 |
| 60 | 3300006175 | Ga0070712_100446472 | Ga0070712_1004464722 | 109 |
| 61 | 3300006358 | Ga0068871_100066687 | Ga0068871_1000666872 | 109 |
| 62 | 3300006358 | Ga0068871_101695662 | Ga0068871_1016956621 | 109 |
| 63 | 3300006881 | Ga0068865_100716825 | Ga0068865_1007168251 | 109 |
| 64 | 3300006931 | Ga0097620_100455642 | Ga0097620_1004556421 | 109 |
| 65 | 3300013102 | Ga0157371_10028621 | Ga0157371_100286216 | 109 |
| 66 | 3300013102 | Ga0157371_10125028 | Ga0157371_101250283 | 109 |
| 67 | 3300013297 | Ga0157378_10137199 | Ga0157378_101371993 | 109 |
| 68 | 3300013306 | Ga0163162_11008935 | Ga0163162_110089352 | 109 |
| 69 | 3300013307 | Ga0157372_10019994 | Ga0157372_100199944 | 109 |
| 70 | 3300013307 | Ga0157372_10914987 | Ga0157372_109149871 | 109 |
| 71 | 3300013308 | Ga0157375_10080649 | Ga0157375_100806493 | 109 |
| 72 | 3300014745 | Ga0157377_10012082 | Ga0157377_100120822 | 109 |
| 73 | 3300014968 | Ga0157379_10224489 | Ga0157379_102244892 | 109 |
| 74 | 3300014969 | Ga0157376_10799801 | Ga0157376_107998012 | 109 |
| 75 | 3300025893 | Ga0207682_10450855 | Ga0207682_104508551 | 109 |
| 76 | 3300025901 | Ga0207688_10017028 | Ga0207688_100170285 | 109 |
| 77 | 3300025903 | Ga0207680_11074363 | Ga0207680_110743631 | 109 |
| 78 | 3300025907 | Ga0207645_10109593 | Ga0207645_101095932 | 109 |
| 79 | 3300025918 | Ga0207662_10001150 | Ga0207662_100011509 | 109 |
| 80 | 3300025926 | Ga0207659_10092840 | Ga0207659_100928403 | 109 |
| 81 | 3300025931 | Ga0207644_10051786 | Ga0207644_100517862 | 109 |
| 82 | 3300025933 | Ga0207706_10052670 | Ga0207706_100526705 | 109 |
| 83 | 3300025937 | Ga0207669_11838930 | Ga0207669_118389301 | 109 |
| 84 | 3300025938 | Ga0207704_10366015 | Ga0207704_103660153 | 109 |
| 85 | 3300025940 | Ga0207691_10038966 | Ga0207691_100389664 | 109 |
| 86 | 3300025942 | Ga0207689_10227416 | Ga0207689_102274162 | 109 |
| 87 | 3300025960 | Ga0207651_10285283 | Ga0207651_102852831 | 109 |
| 88 | 3300025981 | Ga0207640_10841862 | Ga0207640_108418621 | 109 |
| 89 | 3300025986 | Ga0207658_10397352 | Ga0207658_103973522 | 109 |
| 90 | 3300026023 | Ga0207677_10435375 | Ga0207677_104353751 | 109 |
| 91 | 3300026035 | Ga0207703_11249230 | Ga0207703_112492301 | 109 |
| 92 | 3300026088 | Ga0207641_10654910 | Ga0207641_106549102 | 109 |
| 93 | 3300026089 | Ga0207648_11362230 | Ga0207648_113622301 | 109 |
| 94 | 3300026095 | Ga0207676_10237192 | Ga0207676_102371922 | 109 |
| 95 | 3300026116 | Ga0207674_12037047 | Ga0207674_120370472 | 109 |
| 96 | 3300026121 | Ga0207683_10031863 | Ga0207683_100318635 | 109 |
| 97 | 3300028381 | Ga0268264_10810277 | Ga0268264_108102772 | 109 |
| 98 | 3300035091 | Ga0373951_0210089 | Ga0373951_0210089_110_439 | 109 |
| 99 | 3300035170 | Ga0373943_0365084 | Ga0373943_0365084_20_352 | 109 |
| 100 | 3300046459 | Ga0495629_0453017 | Ga0495629_0453017_53_385 | 109 |
| 101 | 3300046511 | Ga0495608_0287783 | Ga0495608_0287783_104_436 | 109 |
| 102 | 3300047319 | Ga0495674_0553470 | Ga0495674_0553470_385_717 | 109 |
| 103 | iso_pu_bacteria | 2883068021 | 2883069328 | 109 |
| 104 | iso_pu_bacteria | 2914759650 | 2914762892 | 109 |
| 105 | 3300003320 | rootH2_10228236 | rootH2_102282363 | 110 |
| 106 | 3300003323 | rootH1_10213669 | rootH1_102136696 | 110 |
| 107 | 3300003354 | JGI25160J50197_1002034 | JGI25160J50197_10020342 | 110 |
| 108 | 3300005563 | Ga0068855_100005467 | Ga0068855_1000054677 | 110 |
| 109 | 3300005577 | Ga0068857_100034712 | Ga0068857_1000347123 | 110 |
| 110 | 3300005614 | Ga0068856_100057709 | Ga0068856_1000577096 | 110 |
| 111 | 3300005616 | Ga0068852_100687133 | Ga0068852_1006871332 | 110 |
| 112 | 3300009093 | Ga0105240_10277969 | Ga0105240_102779692 | 110 |
| 113 | 3300009174 | Ga0105241_10013626 | Ga0105241_100136266 | 110 |
| 114 | 3300009545 | Ga0105237_10071558 | Ga0105237_100715585 | 110 |
| 115 | 3300014326 | Ga0157380_12075863 | Ga0157380_120758631 | 110 |
| 116 | 3300025302 | Ga0207426_1000002 | Ga0207426_1000002955 | 110 |
| 117 | 3300025913 | Ga0207695_10351979 | Ga0207695_103519793 | 110 |
| 118 | 3300025914 | Ga0207671_10106482 | Ga0207671_101064822 | 110 |
| 119 | 3300025949 | Ga0207667_10003830 | Ga0207667_1000383011 | 110 |
| 120 | 3300026041 | Ga0207639_10559293 | Ga0207639_105592931 | 110 |
| 121 | 3300026078 | Ga0207702_10535535 | Ga0207702_105355352 | 110 |
| 122 | 3300026118 | Ga0207675_100332948 | Ga0207675_1003329483 | 110 |
| 123 | 3300041512 | Ga0451853_0354213 | Ga0451853_0354213_47_442 | 110 |
| 124 | 3300044656 | Ga0466969_0000406 | Ga0466969_0000406_1940_2272 | 110 |
| 125 | 3300044684 | Ga0466966_0000028 | Ga0466966_0000028_45325_45657 | 110 |
| 126 | 3300044706 | Ga0466964_0016622 | Ga0466964_0016622_1169_1501 | 110 |
| 127 | 3300044719 | Ga0466971_0255042 | Ga0466971_0255042_197_529 | 110 |
| 128 | 3300044765 | Ga0466970_0377846 | Ga0466970_0377846_376_708 | 110 |
| 129 | 3300045049 | Ga0466959_0000047 | Ga0466959_0000047_10677_11009 | 110 |
| 130 | 3300053156 | Ga0500622_0000192 | Ga0500622_0000192_46265_46606 | 110 |
| 131 | 3300003322 | rootL2_10262782 | rootL2_102627822 | 111 |
| 132 | 3300005337 | Ga0070682_100000060 | Ga0070682_10000006059 | 111 |
| 133 | 3300005339 | Ga0070660_100248926 | Ga0070660_1002489263 | 111 |
| 134 | 3300005339 | Ga0070660_100700403 | Ga0070660_1007004032 | 111 |
| 135 | 3300005341 | Ga0070691_10004393 | Ga0070691_100043934 | 111 |
| 136 | 3300005364 | Ga0070673_100023820 | Ga0070673_1000238205 | 111 |
| 137 | 3300005366 | Ga0070659_101434447 | Ga0070659_1014344471 | 111 |
| 138 | 3300005456 | Ga0070678_100192330 | Ga0070678_1001923302 | 111 |
| 139 | 3300005458 | Ga0070681_10223180 | Ga0070681_102231803 | 111 |
| 140 | 3300005458 | Ga0070681_10497101 | Ga0070681_104971012 | 111 |
| 141 | 3300005530 | Ga0070679_100170337 | Ga0070679_1001703372 | 111 |
| 142 | 3300005530 | Ga0070679_100426211 | Ga0070679_1004262112 | 111 |
| 143 | 3300005530 | Ga0070679_101889675 | Ga0070679_1018896751 | 111 |
| 144 | 3300005539 | Ga0068853_100213920 | Ga0068853_1002139203 | 111 |
| 145 | 3300005544 | Ga0070686_100143453 | Ga0070686_1001434533 | 111 |
| 146 | 3300005547 | Ga0070693_100022813 | Ga0070693_1000228134 | 111 |
| 147 | 3300005563 | Ga0068855_100053158 | Ga0068855_1000531585 | 111 |
| 148 | 3300005577 | Ga0068857_100735393 | Ga0068857_1007353932 | 111 |
| 149 | 3300005616 | Ga0068852_100109598 | Ga0068852_1001095983 | 111 |
| 150 | 3300005843 | Ga0068860_100003184 | Ga0068860_1000031842 | 111 |
| 151 | 3300005843 | Ga0068860_101287198 | Ga0068860_1012871982 | 111 |
| 152 | 3300005844 | Ga0068862_100910931 | Ga0068862_1009109312 | 111 |
| 153 | 3300009093 | Ga0105240_10003457 | Ga0105240_100034573 | 111 |
| 154 | 3300009174 | Ga0105241_10001522 | Ga0105241_100015222 | 111 |
| 155 | 3300009174 | Ga0105241_10692749 | Ga0105241_106927491 | 111 |
| 156 | 3300009545 | Ga0105237_10113197 | Ga0105237_101131972 | 111 |
| 157 | 3300009551 | Ga0105238_10900999 | Ga0105238_109009992 | 111 |
| 158 | 3300013100 | Ga0157373_10032333 | Ga0157373_100323333 | 111 |
| 159 | 3300013100 | Ga0157373_10172300 | Ga0157373_101723002 | 111 |
| 160 | 3300013102 | Ga0157371_10091575 | Ga0157371_100915753 | 111 |
| 161 | 3300013104 | Ga0157370_10069417 | Ga0157370_100694173 | 111 |
| 162 | 3300013104 | Ga0157370_10138848 | Ga0157370_101388483 | 111 |
| 163 | 3300013104 | Ga0157370_10504529 | Ga0157370_105045291 | 111 |
| 164 | 3300013105 | Ga0157369_10047516 | Ga0157369_100475163 | 111 |
| 165 | 3300013105 | Ga0157369_10309850 | Ga0157369_103098502 | 111 |
| 166 | 3300013296 | Ga0157374_10031775 | Ga0157374_100317753 | 111 |
| 167 | 3300013297 | Ga0157378_10010512 | Ga0157378_100105127 | 111 |
| 168 | 3300013306 | Ga0163162_10002043 | Ga0163162_100020437 | 111 |
| 169 | 3300013306 | Ga0163162_10110894 | Ga0163162_101108942 | 111 |
| 170 | 3300013306 | Ga0163162_13333167 | Ga0163162_133331672 | 111 |
| 171 | 3300013307 | Ga0157372_10279882 | Ga0157372_102798822 | 111 |
| 172 | 3300013307 | Ga0157372_10808050 | Ga0157372_108080502 | 111 |
| 173 | 3300014326 | Ga0157380_10361294 | Ga0157380_103612942 | 111 |
| 174 | 3300014745 | Ga0157377_10995729 | Ga0157377_109957291 | 111 |
| 175 | 3300014969 | Ga0157376_10706841 | Ga0157376_107068412 | 111 |
| 176 | 3300014969 | Ga0157376_11531823 | Ga0157376_115318231 | 111 |
| 177 | 3300025909 | Ga0207705_11426238 | Ga0207705_114262381 | 111 |
| 178 | 3300025911 | Ga0207654_10392274 | Ga0207654_103922742 | 111 |
| 179 | 3300025912 | Ga0207707_10000889 | Ga0207707_100008895 | 111 |
| 180 | 3300025913 | Ga0207695_10025123 | Ga0207695_100251233 | 111 |
| 181 | 3300025913 | Ga0207695_10667948 | Ga0207695_106679482 | 111 |
| 182 | 3300025914 | Ga0207671_10864365 | Ga0207671_108643651 | 111 |
| 183 | 3300025917 | Ga0207660_10002515 | Ga0207660_1000251511 | 111 |
| 184 | 3300025919 | Ga0207657_10589405 | Ga0207657_105894052 | 111 |
| 185 | 3300025920 | Ga0207649_10050830 | Ga0207649_100508303 | 111 |
| 186 | 3300025921 | Ga0207652_10002423 | Ga0207652_100024232 | 111 |
| 187 | 3300025921 | Ga0207652_11133503 | Ga0207652_111335032 | 111 |
| 188 | 3300025949 | Ga0207667_10098282 | Ga0207667_100982821 | 111 |
| 189 | 3300026041 | Ga0207639_10199169 | Ga0207639_101991692 | 111 |
| 190 | 3300026089 | Ga0207648_10627779 | Ga0207648_106277792 | 111 |
| 191 | 3300026121 | Ga0207683_10141801 | Ga0207683_101418012 | 111 |
| 192 | 3300028380 | Ga0268265_11205062 | Ga0268265_112050622 | 111 |
| 193 | 3300028381 | Ga0268264_10124534 | Ga0268264_101245342 | 111 |
| 194 | 3300031616 | Ga0307508_10131100 | Ga0307508_101311001 | 111 |
| 195 | 3300035114 | Ga0373939_0272540 | Ga0373939_0272540_304_639 | 111 |
| 196 | 3300041406 | Ga0439439_0105004 | Ga0439439_0105004_185_520 | 111 |
| 197 | 3300044719 | Ga0466971_0170650 | Ga0466971_0170650_580_915 | 111 |
| 198 | 3300046616 | Ga0495668_0001618 | Ga0495668_0001618_3457_3792 | 111 |
| 199 | 3300048909 | Ga0496106_0913615 | Ga0496106_0913615_107_448 | 111 |
| 200 | 3300048916 | Ga0496113_1493417 | Ga0496113_1493417_107_448 | 111 |
| 201 | 3300049569 | Ga0501032_0669801 | Ga0501032_0669801_84_419 | 111 |
| 202 | 3300049571 | Ga0501034_0000043 | Ga0501034_0000043_193931_194269 | 111 |
| 203 | 3300049571 | Ga0501034_0429885 | Ga0501034_0429885_236_571 | 111 |
| 204 | 3300049574 | Ga0501038_0666414 | Ga0501038_0666414_185_520 | 111 |
| 205 | 3300049581 | Ga0501047_0049311 | Ga0501047_0049311_670_1005 | 111 |
| 206 | 3300049583 | Ga0501067_0203533 | Ga0501067_0203533_532_867 | 111 |
| 207 | 3300049584 | Ga0501068_0067490 | Ga0501068_0067490_1815_2150 | 111 |
| 208 | 3300049585 | Ga0501069_0026804 | Ga0501069_0026804_336_671 | 111 |
| 209 | 3300049586 | Ga0501070_0142392 | Ga0501070_0142392_1069_1404 | 111 |
| 210 | 3300049589 | Ga0501073_0075538 | Ga0501073_0075538_1791_2126 | 111 |
| 211 | 3300049649 | Ga0501198_111649 | Ga0501198_111649_157_492 | 111 |
| 212 | 3300049663 | Ga0501223_042259 | Ga0501223_042259_473_808 | 111 |
| 213 | 3300049741 | Ga0501079_0575054 | Ga0501079_0575054_202_537 | 111 |
| 214 | 3300049742 | Ga0501080_0196318 | Ga0501080_0196318_881_1216 | 111 |
| 215 | 3300049744 | Ga0501083_0799784 | Ga0501083_0799784_223_558 | 111 |
| 216 | 3300049823 | Ga0501044_0082555 | Ga0501044_0082555_1363_1698 | 111 |
| 217 | 3300054114 | Ga0501084_0019020 | Ga0501084_0019020_249_584 | 111 |
| 218 | 3300060353 | Ga0501082_0070851 | Ga0501082_0070851_1908_2243 | 111 |
| 219 | 3300005543 | Ga0070672_102060497 | Ga0070672_1020604971 | 112 |
| 220 | 3300005564 | Ga0070664_100357193 | Ga0070664_1003571932 | 112 |
| 221 | 3300006163 | Ga0070715_10827158 | Ga0070715_108271581 | 112 |
| 222 | 3300009147 | Ga0114129_10012470 | Ga0114129_100124704 | 112 |
| 223 | 3300009545 | Ga0105237_10221345 | Ga0105237_102213453 | 112 |
| 224 | 3300010375 | Ga0105239_10654593 | Ga0105239_106545932 | 112 |
| 225 | 3300025911 | Ga0207654_11447374 | Ga0207654_114473741 | 112 |
| 226 | 3300035112 | Ga0373932_0225819 | Ga0373932_0225819_248_586 | 112 |
| 227 | 3300041452 | Ga0451793_0320429 | Ga0451793_0320429_102_443 | 112 |
| 228 | 3300041486 | Ga0451807_1540202 | Ga0451807_1540202_162_500 | 112 |
| 229 | 3300042004 | Ga0439445_0000786 | Ga0439445_0000786_5255_5611 | 112 |
| 230 | 3300053129 | Ga0500628_059815 | Ga0500628_059815_77_418 | 112 |
| 231 | 3300053177 | Ga0500636_0110299 | Ga0500636_0110299_1147_1485 | 112 |
| 232 | 3300003320 | rootH2_10110839 | rootH2_101108392 | 113 |
| 233 | 3300005329 | Ga0070683_100015154 | Ga0070683_1000151546 | 113 |
| 234 | 3300005341 | Ga0070691_10014565 | Ga0070691_100145651 | 113 |
| 235 | 3300005341 | Ga0070691_10086939 | Ga0070691_100869391 | 113 |
| 236 | 3300005535 | Ga0070684_100134028 | Ga0070684_1001340283 | 113 |
| 237 | 3300005563 | Ga0068855_100001225 | Ga0068855_10000122514 | 113 |
| 238 | 3300009093 | Ga0105240_10002434 | Ga0105240_1000243417 | 113 |
| 239 | 3300013100 | Ga0157373_10178290 | Ga0157373_101782902 | 113 |
| 240 | 3300013100 | Ga0157373_11229085 | Ga0157373_112290851 | 113 |
| 241 | 3300013104 | Ga0157370_10286097 | Ga0157370_102860972 | 113 |
| 242 | 3300013307 | Ga0157372_10104075 | Ga0157372_101040754 | 113 |
| 243 | 3300013307 | Ga0157372_10937443 | Ga0157372_109374431 | 113 |
| 244 | 3300025913 | Ga0207695_10000128 | Ga0207695_1000012825 | 113 |
| 245 | 3300025944 | Ga0207661_10032582 | Ga0207661_100325825 | 113 |
| 246 | 3300025949 | Ga0207667_10000143 | Ga0207667_1000014326 | 113 |
| 247 | 3300033179 | Ga0307507_10294460 | Ga0307507_102944601 | 113 |
| 248 | 3300041512 | Ga0451853_3931169 | Ga0451853_3931169_810_1151 | 113 |
| 249 | 3300046648 | Ga0495611_0000119 | Ga0495611_0000119_9313_9654 | 113 |
| 250 | 3300048918 | Ga0496115_0067798 | Ga0496115_0067798_2049_2390 | 113 |
| 251 | 3300050493 | nmdc:mga0k408_360635_c1 | nmdc:mga0k408_360635_c1_427_768 | 113 |
| 252 | 3300053146 | Ga0500588_0064519 | Ga0500588_0064519_656_1000 | 113 |
| 253 | 3300005564 | Ga0070664_100235868 | Ga0070664_1002358682 | 114 |
| 254 | 3300006237 | Ga0097621_100586926 | Ga0097621_1005869261 | 114 |
| 255 | 3300006852 | Ga0075433_10546628 | Ga0075433_105466282 | 114 |
| 256 | 3300009094 | Ga0111539_10841418 | Ga0111539_108414182 | 114 |
| 257 | 3300049683 | Ga0501253_171187 | Ga0501253_171187_197_541 | 114 |
| 258 | 3300050515 | nmdc:mga0a205_608781_c1 | nmdc:mga0a205_608781_c1_417_761 | 114 |
| 259 | 3300005337 | Ga0070682_100638240 | Ga0070682_1006382402 | 115 |
| 260 | 3300005455 | Ga0070663_100105223 | Ga0070663_1001052233 | 115 |
| 261 | 3300005539 | Ga0068853_101115281 | Ga0068853_1011152811 | 115 |
| 262 | 3300005543 | Ga0070672_101939375 | Ga0070672_1019393752 | 115 |
| 263 | 3300005577 | Ga0068857_101989482 | Ga0068857_1019894821 | 115 |
| 264 | 3300005985 | Ga0081539_10160816 | Ga0081539_101608161 | 115 |
| 265 | 3300026067 | Ga0207678_10130862 | Ga0207678_101308622 | 115 |
| 266 | 3300026089 | Ga0207648_10586047 | Ga0207648_105860471 | 115 |
| 267 | 3300041512 | Ga0451853_0374342 | Ga0451853_0374342_160_510 | 115 |
| 268 | 3300049551 | Ga0501335_017314 | Ga0501335_017314_371_721 | 115 |
| 269 | 3300049675 | Ga0501243_057236 | Ga0501243_057236_274_621 | 115 |
| 270 | 3300050493 | nmdc:mga0k408_451724_c1 | nmdc:mga0k408_451724_c1_259_615 | 115 |
| 271 | 3300005290 | Ga0065712_10136788 | Ga0065712_101367881 | 116 |
| 272 | 3300005329 | Ga0070683_100018061 | Ga0070683_1000180614 | 116 |
| 273 | 3300005330 | Ga0070690_100021661 | Ga0070690_1000216614 | 116 |
| 274 | 3300005335 | Ga0070666_10151960 | Ga0070666_101519603 | 116 |
| 275 | 3300005336 | Ga0070680_100201220 | Ga0070680_1002012202 | 116 |
| 276 | 3300005337 | Ga0070682_100003140 | Ga0070682_1000031406 | 116 |
| 277 | 3300005339 | Ga0070660_100034437 | Ga0070660_1000344373 | 116 |
| 278 | 3300005344 | Ga0070661_100027595 | Ga0070661_1000275955 | 116 |
| 279 | 3300005354 | Ga0070675_100051092 | Ga0070675_1000510925 | 116 |
| 280 | 3300005366 | Ga0070659_100027007 | Ga0070659_1000270074 | 116 |
| 281 | 3300005457 | Ga0070662_100071565 | Ga0070662_1000715653 | 116 |
| 282 | 3300005458 | Ga0070681_10182971 | Ga0070681_101829712 | 116 |
| 283 | 3300005530 | Ga0070679_100121319 | Ga0070679_1001213192 | 116 |
| 284 | 3300005535 | Ga0070684_100011105 | Ga0070684_1000111053 | 116 |
| 285 | 3300005539 | Ga0068853_100129148 | Ga0068853_1001291482 | 116 |
| 286 | 3300005543 | Ga0070672_100889369 | Ga0070672_1008893692 | 116 |
| 287 | 3300005547 | Ga0070693_100273587 | Ga0070693_1002735871 | 116 |
| 288 | 3300005548 | Ga0070665_101389531 | Ga0070665_1013895312 | 116 |
| 289 | 3300005549 | Ga0070704_101257327 | Ga0070704_1012573271 | 116 |
| 290 | 3300005563 | Ga0068855_100748020 | Ga0068855_1007480202 | 116 |
| 291 | 3300005564 | Ga0070664_100261408 | Ga0070664_1002614081 | 116 |
| 292 | 3300005578 | Ga0068854_100086495 | Ga0068854_1000864953 | 116 |
| 293 | 3300005614 | Ga0068856_100081874 | Ga0068856_1000818743 | 116 |
| 294 | 3300005618 | Ga0068864_100593238 | Ga0068864_1005932382 | 116 |
| 295 | 3300005834 | Ga0068851_10061828 | Ga0068851_100618282 | 116 |
| 296 | 3300006237 | Ga0097621_100027317 | Ga0097621_1000273174 | 116 |
| 297 | 3300006358 | Ga0068871_100017790 | Ga0068871_1000177905 | 116 |
| 298 | 3300025321 | Ga0207656_10042835 | Ga0207656_100428353 | 116 |
| 299 | 3300025903 | Ga0207680_10066145 | Ga0207680_100661452 | 116 |
| 300 | 3300025907 | Ga0207645_10760230 | Ga0207645_107602301 | 116 |
| 301 | 3300025909 | Ga0207705_10093666 | Ga0207705_100936661 | 116 |
| 302 | 3300025912 | Ga0207707_10161652 | Ga0207707_101616523 | 116 |
| 303 | 3300025917 | Ga0207660_10244820 | Ga0207660_102448202 | 116 |
| 304 | 3300025919 | Ga0207657_10005302 | Ga0207657_100053023 | 116 |
| 305 | 3300025921 | Ga0207652_10160327 | Ga0207652_101603273 | 116 |
| 306 | 3300025926 | Ga0207659_10041025 | Ga0207659_100410252 | 116 |
| 307 | 3300025932 | Ga0207690_10027334 | Ga0207690_100273342 | 116 |
| 308 | 3300025933 | Ga0207706_10004741 | Ga0207706_100047412 | 116 |
| 309 | 3300025940 | Ga0207691_10700753 | Ga0207691_107007532 | 116 |
| 310 | 3300025944 | Ga0207661_10003759 | Ga0207661_100037598 | 116 |
| 311 | 3300025945 | Ga0207679_10056359 | Ga0207679_100563593 | 116 |
| 312 | 3300025949 | Ga0207667_10360523 | Ga0207667_103605231 | 116 |
| 313 | 3300025960 | Ga0207651_10086250 | Ga0207651_100862503 | 116 |
| 314 | 3300025981 | Ga0207640_10133196 | Ga0207640_101331961 | 116 |
| 315 | 3300026041 | Ga0207639_10110023 | Ga0207639_101100233 | 116 |
| 316 | 3300026078 | Ga0207702_10066982 | Ga0207702_100669823 | 116 |
| 317 | 3300026095 | Ga0207676_11721902 | Ga0207676_117219022 | 116 |
| 318 | 3300026116 | Ga0207674_10909526 | Ga0207674_109095261 | 116 |
| 319 | 3300026118 | Ga0207675_100319748 | Ga0207675_1003197481 | 116 |
| 320 | 3300026142 | Ga0207698_10393333 | Ga0207698_103933332 | 116 |
| 321 | 3300013104 | Ga0157370_10293791 | Ga0157370_102937913 | 117 |
| 322 | 3300013307 | Ga0157372_10459304 | Ga0157372_104593042 | 117 |
| 323 | 3300003203 | JGI25406J46586_10008154 | JGI25406J46586_100081542 | 118 |
| 324 | 3300005985 | Ga0081539_10000037 | Ga0081539_10000037129 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar