F407563

General Info

Members Datasets Scaffolds Average Seq Length
324 186 322 112

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0000043|Ga0501034_0000043_193931_194269
Length 112
Sequence MQLLSIFLMMDPQGKGSSTSTLIMMGLMVLVFWLFMIRPQAKKAKQQKNFINELQKGDKVVTIAGIHGTVNKVEDNTIMLETSPGSYIKIEKSAISMEWTSNLNKKAEEPKK

Samples

Sample ID Description Type Environment
1 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
2 2914759650 Rhizosphaericola mali Isolate Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
136 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
140 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
171 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
172 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
173 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
184 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 0.93
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0
Rhizoplane 1.54
Rhizosphere 92.9
Stem 0
Stem Tuber 0
Unclassified 2.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10008154 3300003203 Bacteria 4757
2 rootH2_10110839 3300003320 Bacteria 2751
3 rootH2_10228236 3300003320 Bacteria 3949
4 rootL2_10262782 3300003322 Bacteria 3002
5 rootH1_10213669 3300003323 Bacteria 4646
6 JGI25160J50197_1002034 3300003354 Bacteria 9644
7 Ga0065712_10136788 3300005290 Unclassified 1489
8 Ga0070676_10241458 3300005328 Unclassified 1202
9 Ga0070683_100015154 3300005329 Bacteria 6767
10 Ga0070683_100018061 3300005329 Bacteria 6240
11 Ga0070690_100021661 3300005330 Bacteria 3926
12 Ga0070690_100092900 3300005330 Bacteria 1990
13 Ga0070677_10418286 3300005333 Bacteria 710
14 Ga0068869_100033253 3300005334 Bacteria 3640
15 Ga0070666_10070193 3300005335 Bacteria 2383
16 Ga0070666_10151960 3300005335 Unclassified 1615
17 Ga0070680_100201220 3300005336 Bacteria 1680
18 Ga0070682_100000060 3300005337 Bacteria 105136
19 Ga0070682_100003140 3300005337 Bacteria 9151
20 Ga0070682_100638240 3300005337 Unclassified 846
21 Ga0070682_100789353 3300005337 Bacteria 770
22 Ga0068868_100276780 3300005338 Bacteria 1419
23 Ga0070660_100034437 3300005339 Bacteria 3826
24 Ga0070660_100248926 3300005339 Bacteria 1449
25 Ga0070660_100700403 3300005339 Unclassified 849
26 Ga0070691_10004393 3300005341 Bacteria 6405
27 Ga0070691_10014565 3300005341 Unclassified 3609
28 Ga0070691_10086939 3300005341 Bacteria 1537
29 Ga0070687_100079673 3300005343 Bacteria 1783
30 Ga0070661_100027595 3300005344 Bacteria 4089
31 Ga0070661_100575691 3300005344 Bacteria 908
32 Ga0070669_100238344 3300005353 Bacteria 1444
33 Ga0070675_100032314 3300005354 Bacteria 4235
34 Ga0070675_100051092 3300005354 Bacteria 3396
35 Ga0070671_100237332 3300005355 Bacteria 1548
36 Ga0070671_100339563 3300005355 Bacteria 1281
37 Ga0070674_100139334 3300005356 Bacteria 1819
38 Ga0070673_100022607 3300005364 Bacteria 4580
39 Ga0070673_100023820 3300005364 Bacteria 4478
40 Ga0070673_100655382 3300005364 Bacteria 961
41 Ga0070659_100027007 3300005366 Bacteria 4420
42 Ga0070659_101434447 3300005366 Unclassified 614
43 Ga0070667_100091760 3300005367 Bacteria 2612
44 Ga0070667_101025513 3300005367 Bacteria 770
45 Ga0070663_100105223 3300005455 Unclassified 2112
46 Ga0070678_100026602 3300005456 Bacteria 3914
47 Ga0070678_100192330 3300005456 Bacteria 1678
48 Ga0070662_100071565 3300005457 Bacteria 2557
49 Ga0070662_100300849 3300005457 Bacteria 1303
50 Ga0070681_10182971 3300005458 Bacteria 2017
51 Ga0070681_10223180 3300005458 Bacteria 1799
52 Ga0070681_10497101 3300005458 Unclassified 1133
53 Ga0068867_100122959 3300005459 Bacteria 2008
54 Ga0070679_100121319 3300005530 Bacteria 2599
55 Ga0070679_100170337 3300005530 Bacteria 2150
56 Ga0070679_100426211 3300005530 Bacteria 1272
57 Ga0070679_101889675 3300005530 Bacteria 546
58 Ga0070684_100011105 3300005535 Bacteria 7166
59 Ga0070684_100134028 3300005535 Bacteria 2236
60 Ga0068853_100129148 3300005539 Bacteria 2260
61 Ga0068853_100213920 3300005539 Bacteria 1758
62 Ga0068853_101115281 3300005539 Unclassified 761
63 Ga0070672_100072835 3300005543 Bacteria 2736
64 Ga0070672_100312071 3300005543 Bacteria 1335
65 Ga0070672_100889369 3300005543 Bacteria 786
66 Ga0070672_101939375 3300005543 Bacteria 530
67 Ga0070672_102060497 3300005543 Bacteria 514
68 Ga0070686_100143453 3300005544 Bacteria 1665
69 Ga0070693_100022813 3300005547 Unclassified 3335
70 Ga0070693_100273587 3300005547 Unclassified 1128
71 Ga0070665_101389531 3300005548 Bacteria 711
72 Ga0070704_101257327 3300005549 Bacteria 676
73 Ga0068855_100001225 3300005563 Bacteria 31850
74 Ga0068855_100005467 3300005563 Bacteria 15499
75 Ga0068855_100053158 3300005563 Unclassified 4766
76 Ga0068855_100748020 3300005563 Bacteria 1043
77 Ga0070664_100069660 3300005564 Bacteria 3010
78 Ga0070664_100235868 3300005564 Bacteria 1641
79 Ga0070664_100261408 3300005564 Unclassified 1557
80 Ga0070664_100357193 3300005564 Bacteria 1330
81 Ga0068857_100034712 3300005577 Bacteria 4461
82 Ga0068857_100735393 3300005577 Bacteria 939
83 Ga0068857_101989482 3300005577 Bacteria 570
84 Ga0068854_100086495 3300005578 Bacteria 2324
85 Ga0068856_100057709 3300005614 Bacteria 3833
86 Ga0068856_100081874 3300005614 Bacteria 3203
87 Ga0070702_100039750 3300005615 Bacteria 2627
88 Ga0068852_100109598 3300005616 Bacteria 2508
89 Ga0068852_100174975 3300005616 Bacteria 2015
90 Ga0068852_100687133 3300005616 Bacteria 1033
91 Ga0068852_100972008 3300005616 Unclassified 867
92 Ga0068859_100249241 3300005617 Bacteria 1866
93 Ga0068859_100455625 3300005617 Bacteria 1375
94 Ga0068864_100358851 3300005618 Bacteria 1377
95 Ga0068864_100593238 3300005618 Bacteria 1074
96 Ga0068851_10061828 3300005834 Bacteria 1920
97 Ga0068863_100741191 3300005841 Bacteria 978
98 Ga0068858_100367111 3300005842 Bacteria 1380
99 Ga0068860_100003184 3300005843 Bacteria 16934
100 Ga0068860_100313210 3300005843 Bacteria 1539
101 Ga0068860_100605532 3300005843 Bacteria 1101
102 Ga0068860_101287198 3300005843 Bacteria 752
103 Ga0068862_100910931 3300005844 Bacteria 865
104 Ga0081539_10000037 3300005985 Bacteria 296160
105 Ga0081539_10160816 3300005985 Bacteria 1070
106 Ga0070715_10827158 3300006163 Bacteria 564
107 Ga0070712_100446472 3300006175 Bacteria 1076
108 Ga0097621_100027317 3300006237 Bacteria 4486
109 Ga0097621_100586926 3300006237 Bacteria 1017
110 Ga0068871_100017790 3300006358 Bacteria 5388
111 Ga0068871_100066687 3300006358 Bacteria 2951
112 Ga0068871_101695662 3300006358 Bacteria 599
113 Ga0075433_10546628 3300006852 Bacteria 1018
114 Ga0068865_100716825 3300006881 Bacteria 856
115 Ga0097620_100249246 3300006931 Bacteria 1866
116 Ga0097620_100455642 3300006931 Bacteria 1375
117 Ga0105240_10002434 3300009093 Bacteria 29930
118 Ga0105240_10003457 3300009093 Bacteria 24509
119 Ga0105240_10277969 3300009093 Bacteria 1925
120 Ga0111539_10841418 3300009094 Bacteria 1068
121 Ga0114129_10012470 3300009147 Bacteria 12100
122 Ga0105241_10001522 3300009174 Bacteria 17775
123 Ga0105241_10013626 3300009174 Bacteria 5957
124 Ga0105241_10692749 3300009174 Bacteria 929
125 Ga0105241_11418760 3300009174 Bacteria 665
126 Ga0105242_12562708 3300009176 Unclassified 559
127 Ga0105237_10071558 3300009545 Bacteria 3462
128 Ga0105237_10113197 3300009545 Unclassified 2706
129 Ga0105237_10221345 3300009545 Bacteria 1893
130 Ga0105238_10900999 3300009551 Unclassified 903
131 Ga0105239_10654593 3300010375 Bacteria 1200
132 Ga0157373_10032333 3300013100 Bacteria 3766
133 Ga0157373_10059299 3300013100 Bacteria 2712
134 Ga0157373_10172300 3300013100 Unclassified 1523
135 Ga0157373_10178290 3300013100 Bacteria 1496
136 Ga0157373_11229085 3300013100 Bacteria 565
137 Ga0157371_10028621 3300013102 Bacteria 4033
138 Ga0157371_10038357 3300013102 Bacteria 3428
139 Ga0157371_10091575 3300013102 Bacteria 2154
140 Ga0157371_10125028 3300013102 Bacteria 1829
141 Ga0157370_10069417 3300013104 Bacteria 3328
142 Ga0157370_10138848 3300013104 Bacteria 2264
143 Ga0157370_10286097 3300013104 Bacteria 1523
144 Ga0157370_10293791 3300013104 Bacteria 1501
145 Ga0157370_10504529 3300013104 Bacteria 1111
146 Ga0157369_10047516 3300013105 Bacteria 4659
147 Ga0157369_10068422 3300013105 Bacteria 3815
148 Ga0157369_10309850 3300013105 Bacteria 1642
149 Ga0157374_10031775 3300013296 Bacteria 4802
150 Ga0157378_10010512 3300013297 Bacteria 8087
151 Ga0157378_10137199 3300013297 Bacteria 2268
152 Ga0163162_10002043 3300013306 Bacteria 18983
153 Ga0163162_10110894 3300013306 Bacteria 2841
154 Ga0163162_11008935 3300013306 Bacteria 941
155 Ga0163162_13333167 3300013306 Bacteria 514
156 Ga0157372_10019994 3300013307 Bacteria 7218
157 Ga0157372_10104075 3300013307 Unclassified 3244
158 Ga0157372_10279882 3300013307 Bacteria 1940
159 Ga0157372_10459304 3300013307 Bacteria 1484
160 Ga0157372_10808050 3300013307 Bacteria 1089
161 Ga0157372_10914987 3300013307 Bacteria 1017
162 Ga0157372_10937443 3300013307 Bacteria 1004
163 Ga0157372_12665953 3300013307 Bacteria 573
164 Ga0157375_10080649 3300013308 Bacteria 3293
165 Ga0157375_11441023 3300013308 Bacteria 812
166 Ga0157380_10361294 3300014326 Bacteria 1363
167 Ga0157380_10789773 3300014326 Bacteria 965
168 Ga0157380_12075863 3300014326 Unclassified 631
169 Ga0157377_10012082 3300014745 Bacteria 4331
170 Ga0157377_10995729 3300014745 Bacteria 634
171 Ga0157379_10224489 3300014968 Bacteria 1702
172 Ga0157379_10615919 3300014968 Unclassified 1014
173 Ga0157376_10706841 3300014969 Unclassified 1013
174 Ga0157376_10799801 3300014969 Bacteria 955
175 Ga0157376_11531823 3300014969 Bacteria 700
176 Ga0207426_1000002 3300025302 Bacteria 1249660
177 Ga0207656_10042835 3300025321 Bacteria 1928
178 Ga0207682_10450855 3300025893 Bacteria 609
179 Ga0207688_10017028 3300025901 Bacteria 3950
180 Ga0207680_10066145 3300025903 Bacteria 2222
181 Ga0207680_11074363 3300025903 Bacteria 576
182 Ga0207645_10109593 3300025907 Bacteria 1786
183 Ga0207645_10760230 3300025907 Bacteria 659
184 Ga0207705_10093666 3300025909 Unclassified 2202
185 Ga0207705_11426238 3300025909 Unclassified 526
186 Ga0207654_10392274 3300025911 Unclassified 964
187 Ga0207654_11447374 3300025911 Bacteria 501
188 Ga0207707_10000889 3300025912 Bacteria 29199
189 Ga0207707_10161652 3300025912 Bacteria 1958
190 Ga0207695_10000128 3300025913 Bacteria 226098
191 Ga0207695_10025123 3300025913 Bacteria 6681
192 Ga0207695_10351979 3300025913 Bacteria 1360
193 Ga0207695_10667948 3300025913 Bacteria 920
194 Ga0207671_10106482 3300025914 Bacteria 2129
195 Ga0207671_10864365 3300025914 Unclassified 716
196 Ga0207660_10002515 3300025917 Bacteria 12055
197 Ga0207660_10244820 3300025917 Unclassified 1414
198 Ga0207662_10001150 3300025918 Bacteria 12516
199 Ga0207657_10005302 3300025919 Bacteria 13511
200 Ga0207657_10589405 3300025919 Unclassified 868
201 Ga0207649_10050830 3300025920 Bacteria 2565
202 Ga0207652_10002423 3300025921 Bacteria 15744
203 Ga0207652_10160327 3300025921 Bacteria 2016
204 Ga0207652_11133503 3300025921 Bacteria 683
205 Ga0207659_10041025 3300025926 Bacteria 3240
206 Ga0207659_10092840 3300025926 Bacteria 2258
207 Ga0207644_10051786 3300025931 Bacteria 2948
208 Ga0207644_10214843 3300025931 Unclassified 1522
209 Ga0207690_10027334 3300025932 Bacteria 3605
210 Ga0207706_10004741 3300025933 Bacteria 12733
211 Ga0207706_10010706 3300025933 Bacteria 8377
212 Ga0207706_10052670 3300025933 Bacteria 3593
213 Ga0207686_10356281 3300025934 Unclassified 1103
214 Ga0207669_11838930 3300025937 Bacteria 517
215 Ga0207704_10366015 3300025938 Bacteria 1127
216 Ga0207691_10038966 3300025940 Bacteria 4397
217 Ga0207691_10700753 3300025940 Bacteria 854
218 Ga0207689_10227416 3300025942 Bacteria 1542
219 Ga0207661_10003759 3300025944 Bacteria 10570
220 Ga0207661_10032582 3300025944 Bacteria 4038
221 Ga0207661_10639765 3300025944 Bacteria 977
222 Ga0207679_10056359 3300025945 Bacteria 2901
223 Ga0207667_10000143 3300025949 Bacteria 108717
224 Ga0207667_10003830 3300025949 Bacteria 18496
225 Ga0207667_10098282 3300025949 Unclassified 3021
226 Ga0207667_10360523 3300025949 Unclassified 1482
227 Ga0207651_10086250 3300025960 Bacteria 2281
228 Ga0207651_10285283 3300025960 Bacteria 1366
229 Ga0207651_10955181 3300025960 Bacteria 765
230 Ga0207640_10133196 3300025981 Unclassified 1800
231 Ga0207640_10841862 3300025981 Bacteria 797
232 Ga0207658_10397352 3300025986 Bacteria 1211
233 Ga0207658_10981370 3300025986 Bacteria 770
234 Ga0207677_10435375 3300026023 Bacteria 1120
235 Ga0207703_11249230 3300026035 Bacteria 714
236 Ga0207639_10110023 3300026041 Bacteria 2243
237 Ga0207639_10199169 3300026041 Bacteria 1716
238 Ga0207639_10559293 3300026041 Bacteria 1051
239 Ga0207678_10130862 3300026067 Unclassified 2140
240 Ga0207702_10066982 3300026078 Bacteria 3080
241 Ga0207702_10535535 3300026078 Bacteria 1144
242 Ga0207641_10654910 3300026088 Bacteria 1032
243 Ga0207648_10586047 3300026089 Bacteria 1027
244 Ga0207648_10627779 3300026089 Bacteria 992
245 Ga0207648_11362230 3300026089 Bacteria 667
246 Ga0207676_10237192 3300026095 Bacteria 1634
247 Ga0207676_11721902 3300026095 Bacteria 625
248 Ga0207674_10909526 3300026116 Bacteria 848
249 Ga0207674_12037047 3300026116 Unclassified 539
250 Ga0207675_100319748 3300026118 Unclassified 1515
251 Ga0207675_100332948 3300026118 Bacteria 1484
252 Ga0207683_10031863 3300026121 Bacteria 4578
253 Ga0207683_10141801 3300026121 Bacteria 2166
254 Ga0207698_10393333 3300026142 Unclassified 1322
255 Ga0209995_1046431 3300027471 Bacteria 735
256 Ga0209974_10028154 3300027876 Bacteria 1860
257 Ga0268265_11205062 3300028380 Bacteria 755
258 Ga0268264_10124534 3300028381 Unclassified 2276
259 Ga0268264_10742109 3300028381 Bacteria 978
260 Ga0268264_10810277 3300028381 Bacteria 936
261 Ga0307508_10131100 3300031616 Bacteria 2110
262 Ga0307414_10348796 3300032004 Bacteria 1270
263 Ga0307507_10294460 3300033179 Bacteria 1001
264 Ga0373951_0210089 3300035091 Bacteria 571
265 Ga0373932_0225819 3300035112 Bacteria 675
266 Ga0373939_0272540 3300035114 Bacteria 666
267 Ga0373943_0365084 3300035170 Bacteria 829
268 Ga0439439_0105004 3300041406 Bacteria 780
269 Ga0451793_0320429 3300041452 Bacteria 674
270 Ga0451807_1540202 3300041486 Bacteria 518
271 Ga0451853_0354213 3300041512 Bacteria 507
272 Ga0451853_0374342 3300041512 Bacteria 537
273 Ga0451853_3931169 3300041512 Bacteria 1389
274 Ga0439445_0000786 3300042004 Bacteria 6674
275 Ga0466969_0000406 3300044656 Bacteria 23757
276 Ga0466966_0000028 3300044684 Bacteria 105667
277 Ga0466964_0016622 3300044706 Bacteria 2811
278 Ga0466971_0170650 3300044719 Bacteria 1021
279 Ga0466971_0255042 3300044719 Bacteria 836
280 Ga0466970_0333606 3300044765 Bacteria 859
281 Ga0466970_0377846 3300044765 Bacteria 806
282 Ga0466959_0000047 3300045049 Bacteria 86901
283 Ga0495629_0453017 3300046459 Bacteria 869
284 Ga0495608_0287783 3300046511 Bacteria 1019
285 Ga0495668_0001618 3300046616 Bacteria 21078
286 Ga0495611_0000119 3300046648 Bacteria 56310
287 Ga0495674_0553470 3300047319 Bacteria 915
288 Ga0496106_0913615 3300048909 Bacteria 693
289 Ga0496113_1493417 3300048916 Bacteria 522
290 Ga0496115_0067798 3300048918 Bacteria 2887
291 Ga0501305_103986 3300049161 Bacteria 531
292 Ga0501313_063692 3300049529 Bacteria 526
293 Ga0501335_017314 3300049551 Bacteria 748
294 Ga0501032_0669801 3300049569 Bacteria 658
295 Ga0501034_0000043 3300049571 Bacteria 229049
296 Ga0501034_0429885 3300049571 Bacteria 1240
297 Ga0501034_0816106 3300049571 Bacteria 825
298 Ga0501038_0666414 3300049574 Unclassified 782
299 Ga0501047_0049311 3300049581 Unclassified 4066
300 Ga0501067_0203533 3300049583 Bacteria 1102
301 Ga0501068_0067490 3300049584 Bacteria 2180
302 Ga0501069_0026804 3300049585 Bacteria 3157
303 Ga0501070_0142392 3300049586 Unclassified 1979
304 Ga0501073_0075538 3300049589 Bacteria 2345
305 Ga0501198_111649 3300049649 Bacteria 566
306 Ga0501223_042259 3300049663 Bacteria 885
307 Ga0501243_057236 3300049675 Unclassified 716
308 Ga0501253_171187 3300049683 Unclassified 559
309 Ga0501079_0575054 3300049741 Bacteria 886
310 Ga0501080_0196318 3300049742 Unclassified 1853
311 Ga0501083_0799784 3300049744 Bacteria 613
312 Ga0501044_0082555 3300049823 Unclassified 3252
313 nmdc:mga0k408_360635_c1 3300050493 Bacteria 866
314 nmdc:mga0k408_451724_c1 3300050493 Bacteria 763
315 nmdc:mga0a205_608781_c1 3300050515 Bacteria 945
316 Ga0500628_059815 3300053129 Bacteria 928
317 Ga0500559_0030352 3300053136 Bacteria 2317
318 Ga0500588_0064519 3300053146 Bacteria 1183
319 Ga0500622_0000192 3300053156 Bacteria 64821
320 Ga0500636_0110299 3300053177 Bacteria 1556
321 Ga0501084_0019020 3300054114 Bacteria 5719
322 Ga0501082_0070851 3300060353 Unclassified 3001

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_12562708 Ga0105242_125627082 95
2 3300025934 Ga0207686_10356281 Ga0207686_103562812 95
3 3300005355 Ga0070671_100339563 Ga0070671_1003395632 105
4 3300005364 Ga0070673_100655382 Ga0070673_1006553822 105
5 3300005543 Ga0070672_100312071 Ga0070672_1003120713 105
6 3300014326 Ga0157380_10789773 Ga0157380_107897732 105
7 3300025931 Ga0207644_10214843 Ga0207644_102148433 105
8 3300025960 Ga0207651_10955181 Ga0207651_109551812 105
9 3300005367 Ga0070667_101025513 Ga0070667_1010255131 106
10 3300009174 Ga0105241_11418760 Ga0105241_114187602 106
11 3300013102 Ga0157371_10038357 Ga0157371_100383572 106
12 3300013105 Ga0157369_10068422 Ga0157369_100684224 106
13 3300025986 Ga0207658_10981370 Ga0207658_109813702 106
14 3300013307 Ga0157372_12665953 Ga0157372_126659532 107
15 3300013308 Ga0157375_11441023 Ga0157375_114410231 107
16 3300014968 Ga0157379_10615919 Ga0157379_106159191 107
17 3300025944 Ga0207661_10639765 Ga0207661_106397652 107
18 3300032004 Ga0307414_10348796 Ga0307414_103487962 107
19 3300005616 Ga0068852_100972008 Ga0068852_1009720082 108
20 3300005617 Ga0068859_100249241 Ga0068859_1002492412 108
21 3300005843 Ga0068860_100313210 Ga0068860_1003132103 108
22 3300006931 Ga0097620_100249246 Ga0097620_1002492462 108
23 3300013100 Ga0157373_10059299 Ga0157373_100592993 108
24 3300025933 Ga0207706_10010706 Ga0207706_100107067 108
25 3300027471 Ga0209995_1046431 Ga0209995_10464312 108
26 3300027876 Ga0209974_10028154 Ga0209974_100281543 108
27 3300028381 Ga0268264_10742109 Ga0268264_107421092 108
28 3300044765 Ga0466970_0333606 Ga0466970_0333606_251_577 108
29 3300049161 Ga0501305_103986 Ga0501305_103986_83_409 108
30 3300049529 Ga0501313_063692 Ga0501313_063692_78_404 108
31 3300049571 Ga0501034_0816106 Ga0501034_0816106_28_354 108
32 3300053136 Ga0500559_0030352 Ga0500559_0030352_1784_2110 108
33 3300005328 Ga0070676_10241458 Ga0070676_102414582 109
34 3300005330 Ga0070690_100092900 Ga0070690_1000929002 109
35 3300005333 Ga0070677_10418286 Ga0070677_104182862 109
36 3300005334 Ga0068869_100033253 Ga0068869_1000332532 109
37 3300005335 Ga0070666_10070193 Ga0070666_100701932 109
38 3300005337 Ga0070682_100789353 Ga0070682_1007893531 109
39 3300005338 Ga0068868_100276780 Ga0068868_1002767801 109
40 3300005343 Ga0070687_100079673 Ga0070687_1000796732 109
41 3300005344 Ga0070661_100575691 Ga0070661_1005756911 109
42 3300005353 Ga0070669_100238344 Ga0070669_1002383443 109
43 3300005354 Ga0070675_100032314 Ga0070675_1000323142 109
44 3300005355 Ga0070671_100237332 Ga0070671_1002373322 109
45 3300005356 Ga0070674_100139334 Ga0070674_1001393342 109
46 3300005364 Ga0070673_100022607 Ga0070673_1000226075 109
47 3300005367 Ga0070667_100091760 Ga0070667_1000917603 109
48 3300005456 Ga0070678_100026602 Ga0070678_1000266021 109
49 3300005457 Ga0070662_100300849 Ga0070662_1003008492 109
50 3300005459 Ga0068867_100122959 Ga0068867_1001229592 109
51 3300005543 Ga0070672_100072835 Ga0070672_1000728354 109
52 3300005564 Ga0070664_100069660 Ga0070664_1000696606 109
53 3300005615 Ga0070702_100039750 Ga0070702_1000397503 109
54 3300005616 Ga0068852_100174975 Ga0068852_1001749752 109
55 3300005617 Ga0068859_100455625 Ga0068859_1004556251 109
56 3300005618 Ga0068864_100358851 Ga0068864_1003588513 109
57 3300005841 Ga0068863_100741191 Ga0068863_1007411912 109
58 3300005842 Ga0068858_100367111 Ga0068858_1003671112 109
59 3300005843 Ga0068860_100605532 Ga0068860_1006055322 109
60 3300006175 Ga0070712_100446472 Ga0070712_1004464722 109
61 3300006358 Ga0068871_100066687 Ga0068871_1000666872 109
62 3300006358 Ga0068871_101695662 Ga0068871_1016956621 109
63 3300006881 Ga0068865_100716825 Ga0068865_1007168251 109
64 3300006931 Ga0097620_100455642 Ga0097620_1004556421 109
65 3300013102 Ga0157371_10028621 Ga0157371_100286216 109
66 3300013102 Ga0157371_10125028 Ga0157371_101250283 109
67 3300013297 Ga0157378_10137199 Ga0157378_101371993 109
68 3300013306 Ga0163162_11008935 Ga0163162_110089352 109
69 3300013307 Ga0157372_10019994 Ga0157372_100199944 109
70 3300013307 Ga0157372_10914987 Ga0157372_109149871 109
71 3300013308 Ga0157375_10080649 Ga0157375_100806493 109
72 3300014745 Ga0157377_10012082 Ga0157377_100120822 109
73 3300014968 Ga0157379_10224489 Ga0157379_102244892 109
74 3300014969 Ga0157376_10799801 Ga0157376_107998012 109
75 3300025893 Ga0207682_10450855 Ga0207682_104508551 109
76 3300025901 Ga0207688_10017028 Ga0207688_100170285 109
77 3300025903 Ga0207680_11074363 Ga0207680_110743631 109
78 3300025907 Ga0207645_10109593 Ga0207645_101095932 109
79 3300025918 Ga0207662_10001150 Ga0207662_100011509 109
80 3300025926 Ga0207659_10092840 Ga0207659_100928403 109
81 3300025931 Ga0207644_10051786 Ga0207644_100517862 109
82 3300025933 Ga0207706_10052670 Ga0207706_100526705 109
83 3300025937 Ga0207669_11838930 Ga0207669_118389301 109
84 3300025938 Ga0207704_10366015 Ga0207704_103660153 109
85 3300025940 Ga0207691_10038966 Ga0207691_100389664 109
86 3300025942 Ga0207689_10227416 Ga0207689_102274162 109
87 3300025960 Ga0207651_10285283 Ga0207651_102852831 109
88 3300025981 Ga0207640_10841862 Ga0207640_108418621 109
89 3300025986 Ga0207658_10397352 Ga0207658_103973522 109
90 3300026023 Ga0207677_10435375 Ga0207677_104353751 109
91 3300026035 Ga0207703_11249230 Ga0207703_112492301 109
92 3300026088 Ga0207641_10654910 Ga0207641_106549102 109
93 3300026089 Ga0207648_11362230 Ga0207648_113622301 109
94 3300026095 Ga0207676_10237192 Ga0207676_102371922 109
95 3300026116 Ga0207674_12037047 Ga0207674_120370472 109
96 3300026121 Ga0207683_10031863 Ga0207683_100318635 109
97 3300028381 Ga0268264_10810277 Ga0268264_108102772 109
98 3300035091 Ga0373951_0210089 Ga0373951_0210089_110_439 109
99 3300035170 Ga0373943_0365084 Ga0373943_0365084_20_352 109
100 3300046459 Ga0495629_0453017 Ga0495629_0453017_53_385 109
101 3300046511 Ga0495608_0287783 Ga0495608_0287783_104_436 109
102 3300047319 Ga0495674_0553470 Ga0495674_0553470_385_717 109
103 iso_pu_bacteria 2883068021 2883069328 109
104 iso_pu_bacteria 2914759650 2914762892 109
105 3300003320 rootH2_10228236 rootH2_102282363 110
106 3300003323 rootH1_10213669 rootH1_102136696 110
107 3300003354 JGI25160J50197_1002034 JGI25160J50197_10020342 110
108 3300005563 Ga0068855_100005467 Ga0068855_1000054677 110
109 3300005577 Ga0068857_100034712 Ga0068857_1000347123 110
110 3300005614 Ga0068856_100057709 Ga0068856_1000577096 110
111 3300005616 Ga0068852_100687133 Ga0068852_1006871332 110
112 3300009093 Ga0105240_10277969 Ga0105240_102779692 110
113 3300009174 Ga0105241_10013626 Ga0105241_100136266 110
114 3300009545 Ga0105237_10071558 Ga0105237_100715585 110
115 3300014326 Ga0157380_12075863 Ga0157380_120758631 110
116 3300025302 Ga0207426_1000002 Ga0207426_1000002955 110
117 3300025913 Ga0207695_10351979 Ga0207695_103519793 110
118 3300025914 Ga0207671_10106482 Ga0207671_101064822 110
119 3300025949 Ga0207667_10003830 Ga0207667_1000383011 110
120 3300026041 Ga0207639_10559293 Ga0207639_105592931 110
121 3300026078 Ga0207702_10535535 Ga0207702_105355352 110
122 3300026118 Ga0207675_100332948 Ga0207675_1003329483 110
123 3300041512 Ga0451853_0354213 Ga0451853_0354213_47_442 110
124 3300044656 Ga0466969_0000406 Ga0466969_0000406_1940_2272 110
125 3300044684 Ga0466966_0000028 Ga0466966_0000028_45325_45657 110
126 3300044706 Ga0466964_0016622 Ga0466964_0016622_1169_1501 110
127 3300044719 Ga0466971_0255042 Ga0466971_0255042_197_529 110
128 3300044765 Ga0466970_0377846 Ga0466970_0377846_376_708 110
129 3300045049 Ga0466959_0000047 Ga0466959_0000047_10677_11009 110
130 3300053156 Ga0500622_0000192 Ga0500622_0000192_46265_46606 110
131 3300003322 rootL2_10262782 rootL2_102627822 111
132 3300005337 Ga0070682_100000060 Ga0070682_10000006059 111
133 3300005339 Ga0070660_100248926 Ga0070660_1002489263 111
134 3300005339 Ga0070660_100700403 Ga0070660_1007004032 111
135 3300005341 Ga0070691_10004393 Ga0070691_100043934 111
136 3300005364 Ga0070673_100023820 Ga0070673_1000238205 111
137 3300005366 Ga0070659_101434447 Ga0070659_1014344471 111
138 3300005456 Ga0070678_100192330 Ga0070678_1001923302 111
139 3300005458 Ga0070681_10223180 Ga0070681_102231803 111
140 3300005458 Ga0070681_10497101 Ga0070681_104971012 111
141 3300005530 Ga0070679_100170337 Ga0070679_1001703372 111
142 3300005530 Ga0070679_100426211 Ga0070679_1004262112 111
143 3300005530 Ga0070679_101889675 Ga0070679_1018896751 111
144 3300005539 Ga0068853_100213920 Ga0068853_1002139203 111
145 3300005544 Ga0070686_100143453 Ga0070686_1001434533 111
146 3300005547 Ga0070693_100022813 Ga0070693_1000228134 111
147 3300005563 Ga0068855_100053158 Ga0068855_1000531585 111
148 3300005577 Ga0068857_100735393 Ga0068857_1007353932 111
149 3300005616 Ga0068852_100109598 Ga0068852_1001095983 111
150 3300005843 Ga0068860_100003184 Ga0068860_1000031842 111
151 3300005843 Ga0068860_101287198 Ga0068860_1012871982 111
152 3300005844 Ga0068862_100910931 Ga0068862_1009109312 111
153 3300009093 Ga0105240_10003457 Ga0105240_100034573 111
154 3300009174 Ga0105241_10001522 Ga0105241_100015222 111
155 3300009174 Ga0105241_10692749 Ga0105241_106927491 111
156 3300009545 Ga0105237_10113197 Ga0105237_101131972 111
157 3300009551 Ga0105238_10900999 Ga0105238_109009992 111
158 3300013100 Ga0157373_10032333 Ga0157373_100323333 111
159 3300013100 Ga0157373_10172300 Ga0157373_101723002 111
160 3300013102 Ga0157371_10091575 Ga0157371_100915753 111
161 3300013104 Ga0157370_10069417 Ga0157370_100694173 111
162 3300013104 Ga0157370_10138848 Ga0157370_101388483 111
163 3300013104 Ga0157370_10504529 Ga0157370_105045291 111
164 3300013105 Ga0157369_10047516 Ga0157369_100475163 111
165 3300013105 Ga0157369_10309850 Ga0157369_103098502 111
166 3300013296 Ga0157374_10031775 Ga0157374_100317753 111
167 3300013297 Ga0157378_10010512 Ga0157378_100105127 111
168 3300013306 Ga0163162_10002043 Ga0163162_100020437 111
169 3300013306 Ga0163162_10110894 Ga0163162_101108942 111
170 3300013306 Ga0163162_13333167 Ga0163162_133331672 111
171 3300013307 Ga0157372_10279882 Ga0157372_102798822 111
172 3300013307 Ga0157372_10808050 Ga0157372_108080502 111
173 3300014326 Ga0157380_10361294 Ga0157380_103612942 111
174 3300014745 Ga0157377_10995729 Ga0157377_109957291 111
175 3300014969 Ga0157376_10706841 Ga0157376_107068412 111
176 3300014969 Ga0157376_11531823 Ga0157376_115318231 111
177 3300025909 Ga0207705_11426238 Ga0207705_114262381 111
178 3300025911 Ga0207654_10392274 Ga0207654_103922742 111
179 3300025912 Ga0207707_10000889 Ga0207707_100008895 111
180 3300025913 Ga0207695_10025123 Ga0207695_100251233 111
181 3300025913 Ga0207695_10667948 Ga0207695_106679482 111
182 3300025914 Ga0207671_10864365 Ga0207671_108643651 111
183 3300025917 Ga0207660_10002515 Ga0207660_1000251511 111
184 3300025919 Ga0207657_10589405 Ga0207657_105894052 111
185 3300025920 Ga0207649_10050830 Ga0207649_100508303 111
186 3300025921 Ga0207652_10002423 Ga0207652_100024232 111
187 3300025921 Ga0207652_11133503 Ga0207652_111335032 111
188 3300025949 Ga0207667_10098282 Ga0207667_100982821 111
189 3300026041 Ga0207639_10199169 Ga0207639_101991692 111
190 3300026089 Ga0207648_10627779 Ga0207648_106277792 111
191 3300026121 Ga0207683_10141801 Ga0207683_101418012 111
192 3300028380 Ga0268265_11205062 Ga0268265_112050622 111
193 3300028381 Ga0268264_10124534 Ga0268264_101245342 111
194 3300031616 Ga0307508_10131100 Ga0307508_101311001 111
195 3300035114 Ga0373939_0272540 Ga0373939_0272540_304_639 111
196 3300041406 Ga0439439_0105004 Ga0439439_0105004_185_520 111
197 3300044719 Ga0466971_0170650 Ga0466971_0170650_580_915 111
198 3300046616 Ga0495668_0001618 Ga0495668_0001618_3457_3792 111
199 3300048909 Ga0496106_0913615 Ga0496106_0913615_107_448 111
200 3300048916 Ga0496113_1493417 Ga0496113_1493417_107_448 111
201 3300049569 Ga0501032_0669801 Ga0501032_0669801_84_419 111
202 3300049571 Ga0501034_0000043 Ga0501034_0000043_193931_194269 111
203 3300049571 Ga0501034_0429885 Ga0501034_0429885_236_571 111
204 3300049574 Ga0501038_0666414 Ga0501038_0666414_185_520 111
205 3300049581 Ga0501047_0049311 Ga0501047_0049311_670_1005 111
206 3300049583 Ga0501067_0203533 Ga0501067_0203533_532_867 111
207 3300049584 Ga0501068_0067490 Ga0501068_0067490_1815_2150 111
208 3300049585 Ga0501069_0026804 Ga0501069_0026804_336_671 111
209 3300049586 Ga0501070_0142392 Ga0501070_0142392_1069_1404 111
210 3300049589 Ga0501073_0075538 Ga0501073_0075538_1791_2126 111
211 3300049649 Ga0501198_111649 Ga0501198_111649_157_492 111
212 3300049663 Ga0501223_042259 Ga0501223_042259_473_808 111
213 3300049741 Ga0501079_0575054 Ga0501079_0575054_202_537 111
214 3300049742 Ga0501080_0196318 Ga0501080_0196318_881_1216 111
215 3300049744 Ga0501083_0799784 Ga0501083_0799784_223_558 111
216 3300049823 Ga0501044_0082555 Ga0501044_0082555_1363_1698 111
217 3300054114 Ga0501084_0019020 Ga0501084_0019020_249_584 111
218 3300060353 Ga0501082_0070851 Ga0501082_0070851_1908_2243 111
219 3300005543 Ga0070672_102060497 Ga0070672_1020604971 112
220 3300005564 Ga0070664_100357193 Ga0070664_1003571932 112
221 3300006163 Ga0070715_10827158 Ga0070715_108271581 112
222 3300009147 Ga0114129_10012470 Ga0114129_100124704 112
223 3300009545 Ga0105237_10221345 Ga0105237_102213453 112
224 3300010375 Ga0105239_10654593 Ga0105239_106545932 112
225 3300025911 Ga0207654_11447374 Ga0207654_114473741 112
226 3300035112 Ga0373932_0225819 Ga0373932_0225819_248_586 112
227 3300041452 Ga0451793_0320429 Ga0451793_0320429_102_443 112
228 3300041486 Ga0451807_1540202 Ga0451807_1540202_162_500 112
229 3300042004 Ga0439445_0000786 Ga0439445_0000786_5255_5611 112
230 3300053129 Ga0500628_059815 Ga0500628_059815_77_418 112
231 3300053177 Ga0500636_0110299 Ga0500636_0110299_1147_1485 112
232 3300003320 rootH2_10110839 rootH2_101108392 113
233 3300005329 Ga0070683_100015154 Ga0070683_1000151546 113
234 3300005341 Ga0070691_10014565 Ga0070691_100145651 113
235 3300005341 Ga0070691_10086939 Ga0070691_100869391 113
236 3300005535 Ga0070684_100134028 Ga0070684_1001340283 113
237 3300005563 Ga0068855_100001225 Ga0068855_10000122514 113
238 3300009093 Ga0105240_10002434 Ga0105240_1000243417 113
239 3300013100 Ga0157373_10178290 Ga0157373_101782902 113
240 3300013100 Ga0157373_11229085 Ga0157373_112290851 113
241 3300013104 Ga0157370_10286097 Ga0157370_102860972 113
242 3300013307 Ga0157372_10104075 Ga0157372_101040754 113
243 3300013307 Ga0157372_10937443 Ga0157372_109374431 113
244 3300025913 Ga0207695_10000128 Ga0207695_1000012825 113
245 3300025944 Ga0207661_10032582 Ga0207661_100325825 113
246 3300025949 Ga0207667_10000143 Ga0207667_1000014326 113
247 3300033179 Ga0307507_10294460 Ga0307507_102944601 113
248 3300041512 Ga0451853_3931169 Ga0451853_3931169_810_1151 113
249 3300046648 Ga0495611_0000119 Ga0495611_0000119_9313_9654 113
250 3300048918 Ga0496115_0067798 Ga0496115_0067798_2049_2390 113
251 3300050493 nmdc:mga0k408_360635_c1 nmdc:mga0k408_360635_c1_427_768 113
252 3300053146 Ga0500588_0064519 Ga0500588_0064519_656_1000 113
253 3300005564 Ga0070664_100235868 Ga0070664_1002358682 114
254 3300006237 Ga0097621_100586926 Ga0097621_1005869261 114
255 3300006852 Ga0075433_10546628 Ga0075433_105466282 114
256 3300009094 Ga0111539_10841418 Ga0111539_108414182 114
257 3300049683 Ga0501253_171187 Ga0501253_171187_197_541 114
258 3300050515 nmdc:mga0a205_608781_c1 nmdc:mga0a205_608781_c1_417_761 114
259 3300005337 Ga0070682_100638240 Ga0070682_1006382402 115
260 3300005455 Ga0070663_100105223 Ga0070663_1001052233 115
261 3300005539 Ga0068853_101115281 Ga0068853_1011152811 115
262 3300005543 Ga0070672_101939375 Ga0070672_1019393752 115
263 3300005577 Ga0068857_101989482 Ga0068857_1019894821 115
264 3300005985 Ga0081539_10160816 Ga0081539_101608161 115
265 3300026067 Ga0207678_10130862 Ga0207678_101308622 115
266 3300026089 Ga0207648_10586047 Ga0207648_105860471 115
267 3300041512 Ga0451853_0374342 Ga0451853_0374342_160_510 115
268 3300049551 Ga0501335_017314 Ga0501335_017314_371_721 115
269 3300049675 Ga0501243_057236 Ga0501243_057236_274_621 115
270 3300050493 nmdc:mga0k408_451724_c1 nmdc:mga0k408_451724_c1_259_615 115
271 3300005290 Ga0065712_10136788 Ga0065712_101367881 116
272 3300005329 Ga0070683_100018061 Ga0070683_1000180614 116
273 3300005330 Ga0070690_100021661 Ga0070690_1000216614 116
274 3300005335 Ga0070666_10151960 Ga0070666_101519603 116
275 3300005336 Ga0070680_100201220 Ga0070680_1002012202 116
276 3300005337 Ga0070682_100003140 Ga0070682_1000031406 116
277 3300005339 Ga0070660_100034437 Ga0070660_1000344373 116
278 3300005344 Ga0070661_100027595 Ga0070661_1000275955 116
279 3300005354 Ga0070675_100051092 Ga0070675_1000510925 116
280 3300005366 Ga0070659_100027007 Ga0070659_1000270074 116
281 3300005457 Ga0070662_100071565 Ga0070662_1000715653 116
282 3300005458 Ga0070681_10182971 Ga0070681_101829712 116
283 3300005530 Ga0070679_100121319 Ga0070679_1001213192 116
284 3300005535 Ga0070684_100011105 Ga0070684_1000111053 116
285 3300005539 Ga0068853_100129148 Ga0068853_1001291482 116
286 3300005543 Ga0070672_100889369 Ga0070672_1008893692 116
287 3300005547 Ga0070693_100273587 Ga0070693_1002735871 116
288 3300005548 Ga0070665_101389531 Ga0070665_1013895312 116
289 3300005549 Ga0070704_101257327 Ga0070704_1012573271 116
290 3300005563 Ga0068855_100748020 Ga0068855_1007480202 116
291 3300005564 Ga0070664_100261408 Ga0070664_1002614081 116
292 3300005578 Ga0068854_100086495 Ga0068854_1000864953 116
293 3300005614 Ga0068856_100081874 Ga0068856_1000818743 116
294 3300005618 Ga0068864_100593238 Ga0068864_1005932382 116
295 3300005834 Ga0068851_10061828 Ga0068851_100618282 116
296 3300006237 Ga0097621_100027317 Ga0097621_1000273174 116
297 3300006358 Ga0068871_100017790 Ga0068871_1000177905 116
298 3300025321 Ga0207656_10042835 Ga0207656_100428353 116
299 3300025903 Ga0207680_10066145 Ga0207680_100661452 116
300 3300025907 Ga0207645_10760230 Ga0207645_107602301 116
301 3300025909 Ga0207705_10093666 Ga0207705_100936661 116
302 3300025912 Ga0207707_10161652 Ga0207707_101616523 116
303 3300025917 Ga0207660_10244820 Ga0207660_102448202 116
304 3300025919 Ga0207657_10005302 Ga0207657_100053023 116
305 3300025921 Ga0207652_10160327 Ga0207652_101603273 116
306 3300025926 Ga0207659_10041025 Ga0207659_100410252 116
307 3300025932 Ga0207690_10027334 Ga0207690_100273342 116
308 3300025933 Ga0207706_10004741 Ga0207706_100047412 116
309 3300025940 Ga0207691_10700753 Ga0207691_107007532 116
310 3300025944 Ga0207661_10003759 Ga0207661_100037598 116
311 3300025945 Ga0207679_10056359 Ga0207679_100563593 116
312 3300025949 Ga0207667_10360523 Ga0207667_103605231 116
313 3300025960 Ga0207651_10086250 Ga0207651_100862503 116
314 3300025981 Ga0207640_10133196 Ga0207640_101331961 116
315 3300026041 Ga0207639_10110023 Ga0207639_101100233 116
316 3300026078 Ga0207702_10066982 Ga0207702_100669823 116
317 3300026095 Ga0207676_11721902 Ga0207676_117219022 116
318 3300026116 Ga0207674_10909526 Ga0207674_109095261 116
319 3300026118 Ga0207675_100319748 Ga0207675_1003197481 116
320 3300026142 Ga0207698_10393333 Ga0207698_103933332 116
321 3300013104 Ga0157370_10293791 Ga0157370_102937913 117
322 3300013307 Ga0157372_10459304 Ga0157372_104593042 117
323 3300003203 JGI25406J46586_10008154 JGI25406J46586_100081542 118
324 3300005985 Ga0081539_10000037 Ga0081539_10000037129 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02699

YajC

Preprotein translocase subunit

20

97

0.96

Feature Viewer

pLDDT pTM Quality
74.08 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map