F407404

General Info

Members Datasets Scaffolds Average Seq Length
324 172 324 107

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_11508207|Ga0207652_115082072
Length 124
Sequence MSVVSVYVVFANEEEAERIGRQVVEERLAACVNLLGPIRSIYRWQGAVQQADEVAAIFKTTQAQADLLITRVAGLHSYDVPCIAVWPIDKLLADYADWVEANVGYTLTRMNRVSARPVLLIHRG

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
138 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
142 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
143 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
144 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
145 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
169 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
170 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
171 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
172 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 2.47
Rhizosphere 93.83
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_397288 2162886011 Bacteria 861
2 MBSR1b_contig_3879354 2162886012 Bacteria 1254
3 JGI24738J21930_10026137 3300002075 Bacteria 1198
4 Ga0065715_10540644 3300005293 Bacteria 728
5 Ga0070658_11099839 3300005327 Bacteria 691
6 Ga0070676_10289494 3300005328 Bacteria 1106
7 Ga0070670_100019583 3300005331 Bacteria 5809
8 Ga0070670_100131218 3300005331 Bacteria 2163
9 Ga0070670_100132082 3300005331 Bacteria 2156
10 Ga0070670_100303239 3300005331 Bacteria 1397
11 Ga0070677_10003930 3300005333 Bacteria 4822
12 Ga0070666_11128694 3300005335 Bacteria 583
13 Ga0070680_100281490 3300005336 Bacteria 1409
14 Ga0070682_100283941 3300005337 Bacteria 1208
15 Ga0068868_100172399 3300005338 Bacteria 1791
16 Ga0068868_100674429 3300005338 Bacteria 922
17 Ga0070660_100019247 3300005339 Bacteria 4999
18 Ga0070660_100437300 3300005339 Bacteria 1084
19 Ga0070660_100528016 3300005339 Bacteria 983
20 Ga0070660_100566363 3300005339 Bacteria 948
21 Ga0070660_100658008 3300005339 Bacteria 877
22 Ga0070687_100532097 3300005343 Bacteria 796
23 Ga0070661_100133446 3300005344 Bacteria 1866
24 Ga0070661_100714912 3300005344 Bacteria 817
25 Ga0070668_100000143 3300005347 Bacteria 45647
26 Ga0070668_100029064 3300005347 Bacteria 4197
27 Ga0070668_100038924 3300005347 Bacteria 3637
28 Ga0070669_100034877 3300005353 Bacteria 3643
29 Ga0070669_100544715 3300005353 Bacteria 967
30 Ga0070675_100003256 3300005354 Bacteria 12303
31 Ga0070675_100540729 3300005354 Bacteria 1053
32 Ga0070671_100000103 3300005355 Bacteria 54391
33 Ga0070671_100596212 3300005355 Bacteria 955
34 Ga0070671_100714973 3300005355 Bacteria 869
35 Ga0070674_100296164 3300005356 Bacteria 1288
36 Ga0070673_100155097 3300005364 Bacteria 1943
37 Ga0070673_100174110 3300005364 Bacteria 1838
38 Ga0070673_100598649 3300005364 Bacteria 1005
39 Ga0070673_101016034 3300005364 Bacteria 772
40 Ga0070688_101793840 3300005365 Unclassified 503
41 Ga0070659_100031096 3300005366 Bacteria 4134
42 Ga0070659_100059354 3300005366 Bacteria 3020
43 Ga0070659_100069436 3300005366 Bacteria 2797
44 Ga0070659_100646744 3300005366 Unclassified 911
45 Ga0070659_100869419 3300005366 Bacteria 787
46 Ga0070659_101874494 3300005366 Bacteria 537
47 Ga0070667_100010013 3300005367 Bacteria 7855
48 Ga0070667_100384064 3300005367 Bacteria 1276
49 Ga0070714_100010037 3300005435 Bacteria 7471
50 Ga0070705_100229611 3300005440 Bacteria 1290
51 Ga0070694_100053342 3300005444 Bacteria 2736
52 Ga0070663_100684677 3300005455 Bacteria 870
53 Ga0070663_101507567 3300005455 Bacteria 598
54 Ga0070662_100003652 3300005457 Bacteria 9607
55 Ga0070662_100051566 3300005457 Bacteria 2972
56 Ga0070662_100070787 3300005457 Unclassified 2570
57 Ga0070662_100501101 3300005457 Bacteria 1013
58 Ga0068867_100691642 3300005459 Bacteria 899
59 Ga0068867_100939382 3300005459 Bacteria 780
60 Ga0070706_100245171 3300005467 Bacteria 1673
61 Ga0070679_101358654 3300005530 Bacteria 656
62 Ga0068853_100027584 3300005539 Bacteria 4771
63 Ga0068853_100670356 3300005539 Bacteria 988
64 Ga0070672_100074520 3300005543 Bacteria 2707
65 Ga0070672_100514944 3300005543 Bacteria 1036
66 Ga0070672_100890529 3300005543 Bacteria 786
67 Ga0070695_100055567 3300005545 Bacteria 2552
68 Ga0070696_100010028 3300005546 Bacteria 6337
69 Ga0070696_100200754 3300005546 Bacteria 1489
70 Ga0070693_100210179 3300005547 Bacteria 1269
71 Ga0070665_100402219 3300005548 Bacteria 1377
72 Ga0070665_100432214 3300005548 Bacteria 1326
73 Ga0070665_100442950 3300005548 Bacteria 1308
74 Ga0070665_100944558 3300005548 Bacteria 875
75 Ga0070665_102129440 3300005548 Bacteria 565
76 Ga0068855_100456270 3300005563 Bacteria 1394
77 Ga0068855_101004269 3300005563 Bacteria 876
78 Ga0070664_100189610 3300005564 Bacteria 1831
79 Ga0070664_100372988 3300005564 Bacteria 1301
80 Ga0070664_100442756 3300005564 Bacteria 1192
81 Ga0070664_102170436 3300005564 Unclassified 527
82 Ga0068857_100135466 3300005577 Bacteria 2224
83 Ga0068854_100120532 3300005578 Bacteria 1991
84 Ga0068854_101841892 3300005578 Bacteria 555
85 Ga0068856_100695342 3300005614 Bacteria 1037
86 Ga0068856_102096290 3300005614 Archaea 575
87 Ga0070702_100196330 3300005615 Bacteria 1332
88 Ga0068852_100155692 3300005616 Bacteria 2129
89 Ga0068859_101127273 3300005617 Bacteria 863
90 Ga0068864_100108413 3300005618 Bacteria 2472
91 Ga0068864_100119795 3300005618 Bacteria 2352
92 Ga0068851_10048938 3300005834 Bacteria 2143
93 Ga0068863_100000017 3300005841 Bacteria 207950
94 Ga0068863_101870863 3300005841 Bacteria 610
95 Ga0068860_100096354 3300005843 Bacteria 2820
96 Ga0068862_100662422 3300005844 Bacteria 1008
97 Ga0075427_10118343 3300006194 Bacteria 503
98 Ga0097621_100536776 3300006237 Bacteria 1063
99 Ga0075370_10585492 3300006353 Bacteria 676
100 Ga0068871_100362142 3300006358 Bacteria 1285
101 Ga0075428_100067786 3300006844 Bacteria 3905
102 Ga0097620_101127467 3300006931 Bacteria 863
103 Ga0111539_10030040 3300009094 Bacteria 6612
104 Ga0111539_12853614 3300009094 Bacteria 559
105 Ga0114129_10473673 3300009147 Bacteria 1639
106 Ga0105243_10666986 3300009148 Bacteria 1010
107 Ga0105248_11198934 3300009177 Bacteria 858
108 Ga0105249_10078026 3300009553 Bacteria 3072
109 Ga0105249_11529001 3300009553 Bacteria 740
110 Ga0105246_10503948 3300011119 Unclassified 1029
111 Ga0157373_10172736 3300013100 Bacteria 1521
112 Ga0157373_10394509 3300013100 Bacteria 991
113 Ga0157371_10274772 3300013102 Bacteria 1216
114 Ga0157371_10612021 3300013102 Bacteria 811
115 Ga0157369_10008490 3300013105 Bacteria 11778
116 Ga0157374_10396418 3300013296 Bacteria 1376
117 Ga0157378_10065243 3300013297 Bacteria 3259
118 Ga0157375_10625807 3300013308 Bacteria 1234
119 Ga0157380_10026973 3300014326 Bacteria 4365
120 Ga0157380_11439019 3300014326 Archaea 741
121 Ga0213876_10487757 3300021384 Unclassified 656
122 Ga0213875_10001046 3300021388 Bacteria 19467
123 Ga0207697_10019409 3300025315 Bacteria 2784
124 Ga0207682_10002276 3300025893 Bacteria 8655
125 Ga0207688_10030113 3300025901 Bacteria 2992
126 Ga0207647_10046602 3300025904 Bacteria 2701
127 Ga0207647_10071354 3300025904 Bacteria 2095
128 Ga0207645_10096617 3300025907 Bacteria 1903
129 Ga0207705_10062113 3300025909 Bacteria 2698
130 Ga0207684_10171279 3300025910 Bacteria 1872
131 Ga0207660_10220065 3300025917 Bacteria 1490
132 Ga0207657_10066573 3300025919 Bacteria 3066
133 Ga0207657_10355395 3300025919 Bacteria 1155
134 Ga0207657_10355396 3300025919 Bacteria 1155
135 Ga0207657_10398604 3300025919 Bacteria 1082
136 Ga0207649_10495613 3300025920 Bacteria 928
137 Ga0207652_11508207 3300025921 Bacteria 576
138 Ga0207681_10016051 3300025923 Bacteria 4677
139 Ga0207681_10114180 3300025923 Bacteria 1970
140 Ga0207681_10745908 3300025923 Bacteria 816
141 Ga0207681_11334889 3300025923 Bacteria 602
142 Ga0207650_10016305 3300025925 Bacteria 5191
143 Ga0207650_10049351 3300025925 Bacteria 3107
144 Ga0207650_10091547 3300025925 Bacteria 2324
145 Ga0207650_10122234 3300025925 Bacteria 2028
146 Ga0207659_10017358 3300025926 Bacteria 4701
147 Ga0207659_10582453 3300025926 Bacteria 953
148 Ga0207659_11176583 3300025926 Bacteria 659
149 Ga0207664_10048259 3300025929 Bacteria 3348
150 Ga0207644_10000161 3300025931 Bacteria 48684
151 Ga0207644_10446459 3300025931 Bacteria 1062
152 Ga0207690_10019881 3300025932 Bacteria 4140
153 Ga0207690_10081602 3300025932 Bacteria 2260
154 Ga0207690_10142955 3300025932 Bacteria 1765
155 Ga0207690_10828880 3300025932 Bacteria 765
156 Ga0207690_11085001 3300025932 Bacteria 667
157 Ga0207706_10004099 3300025933 Bacteria 13771
158 Ga0207706_10048755 3300025933 Bacteria 3745
159 Ga0207706_10085921 3300025933 Bacteria 2766
160 Ga0207706_10763112 3300025933 Bacteria 823
161 Ga0207709_10319455 3300025935 Bacteria 1161
162 Ga0207669_10153578 3300025937 Bacteria 1616
163 Ga0207704_10246395 3300025938 Bacteria 1338
164 Ga0207691_10019116 3300025940 Bacteria 6486
165 Ga0207691_10474379 3300025940 Bacteria 1064
166 Ga0207711_10639268 3300025941 Bacteria 993
167 Ga0207679_10068380 3300025945 Bacteria 2668
168 Ga0207679_10328463 3300025945 Bacteria 1326
169 Ga0207679_10426729 3300025945 Bacteria 1171
170 Ga0207679_11945115 3300025945 Unclassified 536
171 Ga0207667_10308854 3300025949 Bacteria 1615
172 Ga0207651_10057554 3300025960 Bacteria 2682
173 Ga0207651_10232250 3300025960 Bacteria 1498
174 Ga0207651_10371301 3300025960 Bacteria 1210
175 Ga0207712_10239981 3300025961 Bacteria 1459
176 Ga0207668_10000113 3300025972 Bacteria 57453
177 Ga0207668_10008105 3300025972 Bacteria 6254
178 Ga0207668_11945349 3300025972 Bacteria 530
179 Ga0207640_10266234 3300025981 Bacteria 1338
180 Ga0207640_11660324 3300025981 Bacteria 576
181 Ga0207658_10017011 3300025986 Bacteria 5006
182 Ga0207658_10443457 3300025986 Bacteria 1148
183 Ga0207658_10500120 3300025986 Bacteria 1083
184 Ga0207677_10401621 3300026023 Bacteria 1162
185 Ga0207639_10558110 3300026041 Bacteria 1052
186 Ga0207641_10000036 3300026088 Bacteria 213165
187 Ga0207641_11714924 3300026088 Bacteria 630
188 Ga0207648_11166692 3300026089 Bacteria 723
189 Ga0207676_10174172 3300026095 Bacteria 1878
190 Ga0207674_10062182 3300026116 Bacteria 3771
191 Ga0207675_100303528 3300026118 Bacteria 1555
192 Ga0207683_10033963 3300026121 Bacteria 4432
193 Ga0207683_10712933 3300026121 Bacteria 930
194 Ga0207683_11299883 3300026121 Bacteria 673
195 Ga0207698_10483886 3300026142 Bacteria 1201
196 Ga0210002_1067667 3300027617 Bacteria 628
197 Ga0209974_10089508 3300027876 Bacteria 1066
198 Ga0268266_10005701 3300028379 Bacteria 11546
199 Ga0268266_10037677 3300028379 Bacteria 4118
200 Ga0268266_10779182 3300028379 Bacteria 923
201 Ga0268264_10033985 3300028381 Bacteria 4192
202 Ga0307513_10252146 3300031456 Bacteria 1561
203 Ga0307513_10507125 3300031456 Bacteria 923
204 Ga0307408_100780584 3300031548 Bacteria 865
205 Ga0307405_10065577 3300031731 Bacteria 2312
206 Ga0307405_11033282 3300031731 Bacteria 703
207 Ga0307405_11196306 3300031731 Bacteria 657
208 Ga0307413_10147756 3300031824 Bacteria 1634
209 Ga0307413_10396666 3300031824 Bacteria 1080
210 Ga0307413_10409475 3300031824 Bacteria 1065
211 Ga0307413_10483331 3300031824 Bacteria 990
212 Ga0307410_10079307 3300031852 Bacteria 2300
213 Ga0307410_10083923 3300031852 Bacteria 2244
214 Ga0307410_10248514 3300031852 Bacteria 1382
215 Ga0307410_10302756 3300031852 Bacteria 1262
216 Ga0307410_10479840 3300031852 Bacteria 1020
217 Ga0307410_10851766 3300031852 Bacteria 778
218 Ga0307410_11718190 3300031852 Bacteria 556
219 Ga0307410_11764404 3300031852 Unclassified 549
220 Ga0307406_10072153 3300031901 Bacteria 2265
221 Ga0307406_10273757 3300031901 Bacteria 1284
222 Ga0307406_11229061 3300031901 Bacteria 651
223 Ga0307407_10020691 3300031903 Bacteria 3376
224 Ga0307407_10077944 3300031903 Bacteria 1995
225 Ga0307407_10421535 3300031903 Bacteria 962
226 Ga0307412_10293185 3300031911 Bacteria 1282
227 Ga0307412_10827924 3300031911 Unclassified 806
228 Ga0307412_11699244 3300031911 Bacteria 578
229 Ga0307412_12245322 3300031911 Bacteria 508
230 Ga0307409_100009907 3300031995 Bacteria 5884
231 Ga0307409_100089885 3300031995 Bacteria 2512
232 Ga0307409_100093109 3300031995 Bacteria 2475
233 Ga0307409_100121991 3300031995 Bacteria 2209
234 Ga0307409_100207832 3300031995 Bacteria 1757
235 Ga0307409_100277726 3300031995 Bacteria 1546
236 Ga0307409_100420078 3300031995 Bacteria 1282
237 Ga0307409_100606581 3300031995 Bacteria 1082
238 Ga0307409_100606711 3300031995 Bacteria 1082
239 Ga0307409_100754334 3300031995 Bacteria 977
240 Ga0307416_100058035 3300032002 Bacteria 3135
241 Ga0307416_100089983 3300032002 Bacteria 2630
242 Ga0307416_100481476 3300032002 Bacteria 1301
243 Ga0307416_101253629 3300032002 Bacteria 847
244 Ga0307416_101419523 3300032002 Bacteria 800
245 Ga0307416_102408901 3300032002 Bacteria 626
246 Ga0307416_102631717 3300032002 Bacteria 600
247 Ga0307414_10027363 3300032004 Bacteria 3684
248 Ga0307414_10035905 3300032004 Bacteria 3303
249 Ga0307414_10284374 3300032004 Bacteria 1391
250 Ga0307414_11384760 3300032004 Bacteria 653
251 Ga0307411_10042880 3300032005 Bacteria 2891
252 Ga0307411_10146809 3300032005 Bacteria 1747
253 Ga0307411_10175215 3300032005 Bacteria 1622
254 Ga0307411_10233414 3300032005 Bacteria 1435
255 Ga0307411_10258806 3300032005 Bacteria 1373
256 Ga0307411_10263822 3300032005 Bacteria 1361
257 Ga0307411_10322939 3300032005 Bacteria 1247
258 Ga0307411_10358422 3300032005 Bacteria 1191
259 Ga0307411_10569412 3300032005 Bacteria 969
260 Ga0307415_100031545 3300032126 Bacteria 3415
261 Ga0307415_100110740 3300032126 Bacteria 2037
262 Ga0307415_100286370 3300032126 Unclassified 1358
263 Ga0307415_100368481 3300032126 Bacteria 1215
264 Ga0307415_100549018 3300032126 Bacteria 1019
265 Ga0307415_101334802 3300032126 Unclassified 680
266 Ga0307415_101509809 3300032126 Bacteria 643
267 Ga0307415_102309097 3300032126 Bacteria 528
268 Ga0395899_0096555 3300037312 Unclassified 2137
269 Ga0395899_0102221 3300037312 Unclassified 2068
270 Ga0395900_0032873 3300037418 Bacteria 5336
271 Ga0395900_0099151 3300037418 Bacteria 2993
272 Ga0395900_0942143 3300037418 Bacteria 785
273 Ga0395905_0282785 3300037471 Bacteria 1545
274 Ga0395905_0794082 3300037471 Unclassified 849
275 Ga0395905_1159641 3300037471 Bacteria 676
276 Ga0395905_1795151 3300037471 Bacteria 519
277 Ga0436364_0986946 3300037853 Bacteria 208509
278 Ga0395901_0340308 3300038443 Bacteria 1550
279 Ga0395901_0424866 3300038443 Unclassified 1362
280 Ga0395901_0664938 3300038443 Bacteria 1043
281 Ga0436365_1287693 3300039437 Unclassified 633
282 Ga0439439_0108145 3300041406 Bacteria 769
283 Ga0451807_0286400 3300041486 Bacteria 814
284 Ga0439431_0205470 3300041997 Bacteria 575
285 Ga0439437_010337 3300042000 Unclassified 1061
286 Ga0439449_0020818 3300042007 Bacteria 2457
287 Ga0439462_0071465 3300042015 Bacteria 943
288 Ga0450912_004912 3300042116 Bacteria 1009
289 Ga0450914_009590 3300042118 Bacteria 920
290 Ga0450914_016513 3300042118 Bacteria 783
291 Ga0450920_017592 3300042122 Bacteria 1368
292 Ga0450905_008215 3300042142 Bacteria 1427
293 Ga0450889_000888 3300042144 Bacteria 3212
294 Ga0466969_0076622 3300044656 Bacteria 1601
295 Ga0466966_0621284 3300044684 Bacteria 651
296 Ga0466961_0048848 3300044693 Bacteria 2705
297 Ga0466964_0014440 3300044706 Unclassified 3004
298 Ga0466959_0262279 3300045049 Unclassified 1189
299 Ga0466967_0501505 3300045976 Bacteria 1191
300 Ga0466967_1202794 3300045976 Bacteria 755
301 Ga0466967_2178248 3300045976 Bacteria 550
302 Ga0495663_0054107 3300046525 Bacteria 1249
303 Ga0495669_0024767 3300046684 Bacteria 2614
304 Ga0495669_0212806 3300046684 Bacteria 925
305 Ga0495677_0036354 3300047445 Bacteria 1799
306 Ga0495677_0126712 3300047445 Bacteria 976
307 Ga0496102_0595067 3300048905 Bacteria 1029
308 Ga0496103_0486956 3300048906 Bacteria 790
309 Ga0496105_1399251 3300048908 Bacteria 507
310 Ga0496108_0363207 3300048911 Bacteria 1264
311 Ga0496109_0099006 3300048912 Bacteria 2704
312 Ga0496110_0093960 3300048913 Bacteria 2685
313 Ga0496112_0220703 3300048915 Bacteria 1852
314 Ga0501036_1215269 3300049572 Bacteria 614
315 Ga0501048_0960059 3300049582 Bacteria 615
316 Ga0501071_0768283 3300049587 Bacteria 743
317 nmdc:mga07m45_743454_c1 3300050496 Bacteria 563
318 nmdc:mga05p37_492913_c1 3300050507 Bacteria 1408
319 nmdc:mga08y16_50996_c1 3300050511 Bacteria 4329
320 Ga0500592_000161 3300053116 Bacteria 13501
321 Ga0500658_0064022 3300053134 Bacteria 1537
322 Ga0500604_0143431 3300053151 Bacteria 808
323 Ga0500627_0000092 3300053158 Bacteria 30073
324 Ga0590071_032265 3300059421 Bacteria 1250

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005615 Ga0070702_100196330 Ga0070702_1001963302 103
2 3300009553 Ga0105249_11529001 Ga0105249_115290011 103
3 3300011119 Ga0105246_10503948 Ga0105246_105039482 103
4 3300021388 Ga0213875_10001046 Ga0213875_100010467 103
5 3300026118 Ga0207675_100303528 Ga0207675_1003035282 103
6 3300037853 Ga0436364_0986946 Ga0436364_0986946_177374_177688 103
7 3300002075 JGI24738J21930_10026137 JGI24738J21930_100261372 104
8 3300005327 Ga0070658_11099839 Ga0070658_110998392 104
9 3300005331 Ga0070670_100131218 Ga0070670_1001312181 104
10 3300005331 Ga0070670_100132082 Ga0070670_1001320822 104
11 3300005336 Ga0070680_100281490 Ga0070680_1002814902 104
12 3300005337 Ga0070682_100283941 Ga0070682_1002839412 104
13 3300005339 Ga0070660_100019247 Ga0070660_1000192475 104
14 3300005339 Ga0070660_100437300 Ga0070660_1004373002 104
15 3300005339 Ga0070660_100528016 Ga0070660_1005280161 104
16 3300005339 Ga0070660_100566363 Ga0070660_1005663632 104
17 3300005339 Ga0070660_100658008 Ga0070660_1006580082 104
18 3300005344 Ga0070661_100714912 Ga0070661_1007149121 104
19 3300005355 Ga0070671_100596212 Ga0070671_1005962122 104
20 3300005364 Ga0070673_100155097 Ga0070673_1001550972 104
21 3300005365 Ga0070688_101793840 Ga0070688_1017938401 104
22 3300005366 Ga0070659_100031096 Ga0070659_1000310964 104
23 3300005366 Ga0070659_100059354 Ga0070659_1000593546 104
24 3300005366 Ga0070659_100646744 Ga0070659_1006467441 104
25 3300005366 Ga0070659_100869419 Ga0070659_1008694192 104
26 3300005367 Ga0070667_100010013 Ga0070667_1000100132 104
27 3300005435 Ga0070714_100010037 Ga0070714_1000100375 104
28 3300005440 Ga0070705_100229611 Ga0070705_1002296113 104
29 3300005444 Ga0070694_100053342 Ga0070694_1000533421 104
30 3300005455 Ga0070663_101507567 Ga0070663_1015075671 104
31 3300005457 Ga0070662_100051566 Ga0070662_1000515662 104
32 3300005457 Ga0070662_100070787 Ga0070662_1000707872 104
33 3300005467 Ga0070706_100245171 Ga0070706_1002451713 104
34 3300005530 Ga0070679_101358654 Ga0070679_1013586542 104
35 3300005539 Ga0068853_100027584 Ga0068853_1000275845 104
36 3300005539 Ga0068853_100670356 Ga0068853_1006703562 104
37 3300005543 Ga0070672_100514944 Ga0070672_1005149442 104
38 3300005545 Ga0070695_100055567 Ga0070695_1000555675 104
39 3300005546 Ga0070696_100010028 Ga0070696_1000100286 104
40 3300005546 Ga0070696_100200754 Ga0070696_1002007541 104
41 3300005547 Ga0070693_100210179 Ga0070693_1002101791 104
42 3300005548 Ga0070665_100402219 Ga0070665_1004022192 104
43 3300005548 Ga0070665_100432214 Ga0070665_1004322143 104
44 3300005548 Ga0070665_100442950 Ga0070665_1004429502 104
45 3300005563 Ga0068855_100456270 Ga0068855_1004562702 104
46 3300005563 Ga0068855_101004269 Ga0068855_1010042692 104
47 3300005564 Ga0070664_100372988 Ga0070664_1003729882 104
48 3300005564 Ga0070664_102170436 Ga0070664_1021704362 104
49 3300005578 Ga0068854_100120532 Ga0068854_1001205323 104
50 3300005578 Ga0068854_101841892 Ga0068854_1018418921 104
51 3300005614 Ga0068856_100695342 Ga0068856_1006953422 104
52 3300005616 Ga0068852_100155692 Ga0068852_1001556922 104
53 3300005834 Ga0068851_10048938 Ga0068851_100489382 104
54 3300006237 Ga0097621_100536776 Ga0097621_1005367762 104
55 3300009094 Ga0111539_10030040 Ga0111539_100300405 104
56 3300009177 Ga0105248_11198934 Ga0105248_111989341 104
57 3300013100 Ga0157373_10172736 Ga0157373_101727363 104
58 3300013105 Ga0157369_10008490 Ga0157369_100084909 104
59 3300021384 Ga0213876_10487757 Ga0213876_104877572 104
60 3300025904 Ga0207647_10071354 Ga0207647_100713542 104
61 3300025909 Ga0207705_10062113 Ga0207705_100621132 104
62 3300025910 Ga0207684_10171279 Ga0207684_101712793 104
63 3300025917 Ga0207660_10220065 Ga0207660_102200652 104
64 3300025919 Ga0207657_10066573 Ga0207657_100665732 104
65 3300025919 Ga0207657_10398604 Ga0207657_103986043 104
66 3300025920 Ga0207649_10495613 Ga0207649_104956132 104
67 3300025923 Ga0207681_10114180 Ga0207681_101141802 104
68 3300025925 Ga0207650_10091547 Ga0207650_100915475 104
69 3300025929 Ga0207664_10048259 Ga0207664_100482595 104
70 3300025932 Ga0207690_10019881 Ga0207690_100198813 104
71 3300025932 Ga0207690_10081602 Ga0207690_100816022 104
72 3300025932 Ga0207690_11085001 Ga0207690_110850012 104
73 3300025933 Ga0207706_10048755 Ga0207706_100487553 104
74 3300025933 Ga0207706_10085921 Ga0207706_100859213 104
75 3300025941 Ga0207711_10639268 Ga0207711_106392681 104
76 3300025945 Ga0207679_10328463 Ga0207679_103284632 104
77 3300025945 Ga0207679_11945115 Ga0207679_119451152 104
78 3300025949 Ga0207667_10308854 Ga0207667_103088542 104
79 3300025960 Ga0207651_10057554 Ga0207651_100575542 104
80 3300025972 Ga0207668_11945349 Ga0207668_119453491 104
81 3300025981 Ga0207640_10266234 Ga0207640_102662343 104
82 3300025981 Ga0207640_11660324 Ga0207640_116603242 104
83 3300025986 Ga0207658_10017011 Ga0207658_100170117 104
84 3300026041 Ga0207639_10558110 Ga0207639_105581102 104
85 3300026121 Ga0207683_11299883 Ga0207683_112998832 104
86 3300026142 Ga0207698_10483886 Ga0207698_104838862 104
87 3300028379 Ga0268266_10005701 Ga0268266_1000570115 104
88 3300028379 Ga0268266_10779182 Ga0268266_107791822 104
89 3300031456 Ga0307513_10252146 Ga0307513_102521462 104
90 3300031456 Ga0307513_10507125 Ga0307513_105071252 104
91 3300031824 Ga0307413_10409475 Ga0307413_104094752 104
92 3300031852 Ga0307410_10083923 Ga0307410_100839235 104
93 3300031852 Ga0307410_10851766 Ga0307410_108517661 104
94 3300031901 Ga0307406_10072153 Ga0307406_100721532 104
95 3300031901 Ga0307406_10273757 Ga0307406_102737572 104
96 3300031903 Ga0307407_10020691 Ga0307407_100206913 104
97 3300031911 Ga0307412_10293185 Ga0307412_102931852 104
98 3300031911 Ga0307412_10827924 Ga0307412_108279241 104
99 3300031911 Ga0307412_11699244 Ga0307412_116992442 104
100 3300031995 Ga0307409_100009907 Ga0307409_1000099072 104
101 3300031995 Ga0307409_100093109 Ga0307409_1000931094 104
102 3300031995 Ga0307409_100121991 Ga0307409_1001219912 104
103 3300031995 Ga0307409_100207832 Ga0307409_1002078322 104
104 3300031995 Ga0307409_100277726 Ga0307409_1002777263 104
105 3300031995 Ga0307409_100420078 Ga0307409_1004200783 104
106 3300031995 Ga0307409_100606581 Ga0307409_1006065812 104
107 3300032002 Ga0307416_100058035 Ga0307416_1000580356 104
108 3300032002 Ga0307416_100481476 Ga0307416_1004814762 104
109 3300032002 Ga0307416_101419523 Ga0307416_1014195232 104
110 3300032002 Ga0307416_102631717 Ga0307416_1026317172 104
111 3300032004 Ga0307414_10027363 Ga0307414_100273632 104
112 3300032004 Ga0307414_10035905 Ga0307414_100359054 104
113 3300032005 Ga0307411_10042880 Ga0307411_100428802 104
114 3300032005 Ga0307411_10263822 Ga0307411_102638222 104
115 3300032005 Ga0307411_10569412 Ga0307411_105694122 104
116 3300032126 Ga0307415_100031545 Ga0307415_1000315455 104
117 3300032126 Ga0307415_100110740 Ga0307415_1001107404 104
118 3300032126 Ga0307415_100286370 Ga0307415_1002863703 104
119 3300032126 Ga0307415_100368481 Ga0307415_1003684812 104
120 3300032126 Ga0307415_100549018 Ga0307415_1005490182 104
121 3300032126 Ga0307415_102309097 Ga0307415_1023090971 104
122 3300037312 Ga0395899_0096555 Ga0395899_0096555_59_373 104
123 3300037312 Ga0395899_0102221 Ga0395899_0102221_1455_1769 104
124 3300037418 Ga0395900_0032873 Ga0395900_0032873_387_701 104
125 3300037418 Ga0395900_0099151 Ga0395900_0099151_2301_2615 104
126 3300037418 Ga0395900_0942143 Ga0395900_0942143_402_716 104
127 3300037471 Ga0395905_0282785 Ga0395905_0282785_636_950 104
128 3300037471 Ga0395905_0794082 Ga0395905_0794082_407_721 104
129 3300037471 Ga0395905_1159641 Ga0395905_1159641_91_405 104
130 3300037471 Ga0395905_1795151 Ga0395905_1795151_52_366 104
131 3300038443 Ga0395901_0340308 Ga0395901_0340308_981_1295 104
132 3300038443 Ga0395901_0424866 Ga0395901_0424866_183_497 104
133 3300038443 Ga0395901_0664938 Ga0395901_0664938_37_351 104
134 3300039437 Ga0436365_1287693 Ga0436365_1287693_97_411 104
135 3300042000 Ga0439437_010337 Ga0439437_010337_35_349 104
136 3300042015 Ga0439462_0071465 Ga0439462_0071465_26_340 104
137 3300042118 Ga0450914_016513 Ga0450914_016513_178_492 104
138 3300042142 Ga0450905_008215 Ga0450905_008215_827_1141 104
139 3300042144 Ga0450889_000888 Ga0450889_000888_991_1305 104
140 3300044656 Ga0466969_0076622 Ga0466969_0076622_635_949 104
141 3300044684 Ga0466966_0621284 Ga0466966_0621284_291_605 104
142 3300044693 Ga0466961_0048848 Ga0466961_0048848_573_887 104
143 3300044706 Ga0466964_0014440 Ga0466964_0014440_2666_2980 104
144 3300045049 Ga0466959_0262279 Ga0466959_0262279_157_471 104
145 3300045976 Ga0466967_0501505 Ga0466967_0501505_247_561 104
146 3300045976 Ga0466967_1202794 Ga0466967_1202794_159_473 104
147 3300045976 Ga0466967_2178248 Ga0466967_2178248_14_328 104
148 3300046525 Ga0495663_0054107 Ga0495663_0054107_351_665 104
149 3300046684 Ga0495669_0024767 Ga0495669_0024767_327_641 104
150 3300046684 Ga0495669_0212806 Ga0495669_0212806_230_544 104
151 3300047445 Ga0495677_0036354 Ga0495677_0036354_1047_1361 104
152 3300047445 Ga0495677_0126712 Ga0495677_0126712_157_471 104
153 3300048915 Ga0496112_0220703 Ga0496112_0220703_1326_1640 104
154 3300050511 nmdc:mga08y16_50996_c1 nmdc:mga08y16_50996_c1_2557_2871 104
155 3300005347 Ga0070668_100000143 Ga0070668_10000014348 105
156 3300005355 Ga0070671_100000103 Ga0070671_10000010331 105
157 3300005367 Ga0070667_100384064 Ga0070667_1003840642 105
158 3300005548 Ga0070665_100944558 Ga0070665_1009445582 105
159 3300005617 Ga0068859_101127273 Ga0068859_1011272731 105
160 3300005841 Ga0068863_100000017 Ga0068863_100000017163 105
161 3300005843 Ga0068860_100096354 Ga0068860_1000963543 105
162 3300006931 Ga0097620_101127467 Ga0097620_1011274671 105
163 3300009553 Ga0105249_10078026 Ga0105249_100780262 105
164 3300025925 Ga0207650_10049351 Ga0207650_100493515 105
165 3300025931 Ga0207644_10000161 Ga0207644_1000016123 105
166 3300025961 Ga0207712_10239981 Ga0207712_102399812 105
167 3300025972 Ga0207668_10000113 Ga0207668_1000011370 105
168 3300025986 Ga0207658_10443457 Ga0207658_104434571 105
169 3300026088 Ga0207641_10000036 Ga0207641_10000036161 105
170 3300028379 Ga0268266_10037677 Ga0268266_100376772 105
171 3300028381 Ga0268264_10033985 Ga0268264_100339855 105
172 3300031852 Ga0307410_10479840 Ga0307410_104798402 105
173 3300053116 Ga0500592_000161 Ga0500592_000161_4253_4573 105
174 3300053134 Ga0500658_0064022 Ga0500658_0064022_141_461 105
175 3300053151 Ga0500604_0143431 Ga0500604_0143431_383_703 105
176 3300053158 Ga0500627_0000092 Ga0500627_0000092_3617_3937 105
177 3300032126 Ga0307415_101334802 Ga0307415_1013348022 107
178 3300005293 Ga0065715_10540644 Ga0065715_105406442 108
179 3300005328 Ga0070676_10289494 Ga0070676_102894941 108
180 3300005335 Ga0070666_11128694 Ga0070666_111286941 108
181 3300005338 Ga0068868_100172399 Ga0068868_1001723993 108
182 3300005338 Ga0068868_100674429 Ga0068868_1006744292 108
183 3300005343 Ga0070687_100532097 Ga0070687_1005320972 108
184 3300005344 Ga0070661_100133446 Ga0070661_1001334463 108
185 3300005355 Ga0070671_100714973 Ga0070671_1007149732 108
186 3300005364 Ga0070673_100174110 Ga0070673_1001741101 108
187 3300005364 Ga0070673_101016034 Ga0070673_1010160342 108
188 3300005366 Ga0070659_101874494 Ga0070659_1018744942 108
189 3300005459 Ga0068867_100939382 Ga0068867_1009393821 108
190 3300005543 Ga0070672_100074520 Ga0070672_1000745203 108
191 3300005614 Ga0068856_102096290 Ga0068856_1020962902 108
192 3300005618 Ga0068864_100108413 Ga0068864_1001084133 108
193 3300006194 Ga0075427_10118343 Ga0075427_101183431 108
194 3300006358 Ga0068871_100362142 Ga0068871_1003621423 108
195 3300006844 Ga0075428_100067786 Ga0075428_1000677863 108
196 3300009094 Ga0111539_12853614 Ga0111539_128536141 108
197 3300009147 Ga0114129_10473673 Ga0114129_104736734 108
198 3300013100 Ga0157373_10394509 Ga0157373_103945092 108
199 3300013102 Ga0157371_10274772 Ga0157371_102747722 108
200 3300013296 Ga0157374_10396418 Ga0157374_103964182 108
201 3300013297 Ga0157378_10065243 Ga0157378_100652432 108
202 3300013308 Ga0157375_10625807 Ga0157375_106258071 108
203 3300014326 Ga0157380_11439019 Ga0157380_114390192 108
204 3300025315 Ga0207697_10019409 Ga0207697_100194093 108
205 3300025904 Ga0207647_10046602 Ga0207647_100466024 108
206 3300025919 Ga0207657_10355395 Ga0207657_103553951 108
207 3300025919 Ga0207657_10355396 Ga0207657_103553961 108
208 3300025926 Ga0207659_11176583 Ga0207659_111765832 108
209 3300025931 Ga0207644_10446459 Ga0207644_104464593 108
210 3300025932 Ga0207690_10828880 Ga0207690_108288802 108
211 3300025938 Ga0207704_10246395 Ga0207704_102463953 108
212 3300025940 Ga0207691_10019116 Ga0207691_100191169 108
213 3300025960 Ga0207651_10232250 Ga0207651_102322501 108
214 3300025986 Ga0207658_10500120 Ga0207658_105001202 108
215 3300026023 Ga0207677_10401621 Ga0207677_104016212 108
216 3300026089 Ga0207648_11166692 Ga0207648_111666921 108
217 3300026121 Ga0207683_10033963 Ga0207683_100339634 108
218 3300048906 Ga0496103_0486956 Ga0496103_0486956_142_468 108
219 3300050507 nmdc:mga05p37_492913_c1 nmdc:mga05p37_492913_c1_936_1262 108
220 2162886011 MRS1b_contig_397288 MRS1b_0409.00001630 109
221 2162886012 MBSR1b_contig_3879354 MBSR1b_0221.00002510 109
222 3300005331 Ga0070670_100019583 Ga0070670_1000195832 109
223 3300005331 Ga0070670_100303239 Ga0070670_1003032392 109
224 3300005333 Ga0070677_10003930 Ga0070677_100039303 109
225 3300005347 Ga0070668_100029064 Ga0070668_1000290642 109
226 3300005347 Ga0070668_100038924 Ga0070668_1000389246 109
227 3300005353 Ga0070669_100034877 Ga0070669_1000348772 109
228 3300005353 Ga0070669_100544715 Ga0070669_1005447152 109
229 3300005354 Ga0070675_100003256 Ga0070675_10000325611 109
230 3300005354 Ga0070675_100540729 Ga0070675_1005407292 109
231 3300005356 Ga0070674_100296164 Ga0070674_1002961642 109
232 3300005364 Ga0070673_100598649 Ga0070673_1005986491 109
233 3300005366 Ga0070659_100069436 Ga0070659_1000694363 109
234 3300005455 Ga0070663_100684677 Ga0070663_1006846772 109
235 3300005457 Ga0070662_100003652 Ga0070662_10000365213 109
236 3300005457 Ga0070662_100501101 Ga0070662_1005011012 109
237 3300005459 Ga0068867_100691642 Ga0068867_1006916422 109
238 3300005543 Ga0070672_100890529 Ga0070672_1008905292 109
239 3300005548 Ga0070665_102129440 Ga0070665_1021294401 109
240 3300005564 Ga0070664_100189610 Ga0070664_1001896103 109
241 3300005564 Ga0070664_100442756 Ga0070664_1004427562 109
242 3300005577 Ga0068857_100135466 Ga0068857_1001354662 109
243 3300005618 Ga0068864_100119795 Ga0068864_1001197954 109
244 3300005841 Ga0068863_101870863 Ga0068863_1018708631 109
245 3300005844 Ga0068862_100662422 Ga0068862_1006624222 109
246 3300006353 Ga0075370_10585492 Ga0075370_105854922 109
247 3300009148 Ga0105243_10666986 Ga0105243_106669862 109
248 3300013102 Ga0157371_10612021 Ga0157371_106120212 109
249 3300014326 Ga0157380_10026973 Ga0157380_100269733 109
250 3300025893 Ga0207682_10002276 Ga0207682_100022767 109
251 3300025901 Ga0207688_10030113 Ga0207688_100301133 109
252 3300025907 Ga0207645_10096617 Ga0207645_100966172 109
253 3300025921 Ga0207652_11508207 Ga0207652_115082072 109
254 3300025923 Ga0207681_10016051 Ga0207681_100160512 109
255 3300025923 Ga0207681_10745908 Ga0207681_107459082 109
256 3300025923 Ga0207681_11334889 Ga0207681_113348892 109
257 3300025925 Ga0207650_10016305 Ga0207650_100163053 109
258 3300025925 Ga0207650_10122234 Ga0207650_101222342 109
259 3300025926 Ga0207659_10017358 Ga0207659_100173586 109
260 3300025926 Ga0207659_10582453 Ga0207659_105824532 109
261 3300025932 Ga0207690_10142955 Ga0207690_101429552 109
262 3300025933 Ga0207706_10004099 Ga0207706_100040993 109
263 3300025933 Ga0207706_10763112 Ga0207706_107631122 109
264 3300025935 Ga0207709_10319455 Ga0207709_103194552 109
265 3300025937 Ga0207669_10153578 Ga0207669_101535782 109
266 3300025940 Ga0207691_10474379 Ga0207691_104743792 109
267 3300025945 Ga0207679_10068380 Ga0207679_100683802 109
268 3300025945 Ga0207679_10426729 Ga0207679_104267292 109
269 3300025960 Ga0207651_10371301 Ga0207651_103713011 109
270 3300025972 Ga0207668_10008105 Ga0207668_100081057 109
271 3300026088 Ga0207641_11714924 Ga0207641_117149242 109
272 3300026095 Ga0207676_10174172 Ga0207676_101741722 109
273 3300026116 Ga0207674_10062182 Ga0207674_100621824 109
274 3300026121 Ga0207683_10712933 Ga0207683_107129332 109
275 3300027617 Ga0210002_1067667 Ga0210002_10676672 109
276 3300027876 Ga0209974_10089508 Ga0209974_100895081 109
277 3300031548 Ga0307408_100780584 Ga0307408_1007805842 109
278 3300031731 Ga0307405_10065577 Ga0307405_100655772 109
279 3300031731 Ga0307405_11033282 Ga0307405_110332822 109
280 3300031731 Ga0307405_11196306 Ga0307405_111963062 109
281 3300031824 Ga0307413_10147756 Ga0307413_101477562 109
282 3300031824 Ga0307413_10396666 Ga0307413_103966662 109
283 3300031824 Ga0307413_10483331 Ga0307413_104833312 109
284 3300031852 Ga0307410_10079307 Ga0307410_100793072 109
285 3300031852 Ga0307410_10248514 Ga0307410_102485142 109
286 3300031852 Ga0307410_10302756 Ga0307410_103027562 109
287 3300031852 Ga0307410_11718190 Ga0307410_117181902 109
288 3300031852 Ga0307410_11764404 Ga0307410_117644041 109
289 3300031901 Ga0307406_11229061 Ga0307406_112290612 109
290 3300031903 Ga0307407_10077944 Ga0307407_100779442 109
291 3300031903 Ga0307407_10421535 Ga0307407_104215352 109
292 3300031911 Ga0307412_12245322 Ga0307412_122453222 109
293 3300031995 Ga0307409_100089885 Ga0307409_1000898852 109
294 3300031995 Ga0307409_100606711 Ga0307409_1006067112 109
295 3300031995 Ga0307409_100754334 Ga0307409_1007543342 109
296 3300032002 Ga0307416_100089983 Ga0307416_1000899834 109
297 3300032002 Ga0307416_101253629 Ga0307416_1012536292 109
298 3300032002 Ga0307416_102408901 Ga0307416_1024089012 109
299 3300032004 Ga0307414_10284374 Ga0307414_102843742 109
300 3300032004 Ga0307414_11384760 Ga0307414_113847602 109
301 3300032005 Ga0307411_10146809 Ga0307411_101468092 109
302 3300032005 Ga0307411_10175215 Ga0307411_101752152 109
303 3300032005 Ga0307411_10233414 Ga0307411_102334142 109
304 3300032005 Ga0307411_10258806 Ga0307411_102588061 109
305 3300032005 Ga0307411_10322939 Ga0307411_103229392 109
306 3300032005 Ga0307411_10358422 Ga0307411_103584222 109
307 3300032126 Ga0307415_101509809 Ga0307415_1015098092 109
308 3300041406 Ga0439439_0108145 Ga0439439_0108145_57_386 109
309 3300041486 Ga0451807_0286400 Ga0451807_0286400_48_377 109
310 3300041997 Ga0439431_0205470 Ga0439431_0205470_190_519 109
311 3300042007 Ga0439449_0020818 Ga0439449_0020818_799_1128 109
312 3300042116 Ga0450912_004912 Ga0450912_004912_166_495 109
313 3300042118 Ga0450914_009590 Ga0450914_009590_333_662 109
314 3300042122 Ga0450920_017592 Ga0450920_017592_237_566 109
315 3300048905 Ga0496102_0595067 Ga0496102_0595067_609_938 109
316 3300048908 Ga0496105_1399251 Ga0496105_1399251_115_444 109
317 3300048911 Ga0496108_0363207 Ga0496108_0363207_608_937 109
318 3300048912 Ga0496109_0099006 Ga0496109_0099006_270_599 109
319 3300048913 Ga0496110_0093960 Ga0496110_0093960_1782_2111 109
320 3300049572 Ga0501036_1215269 Ga0501036_1215269_232_561 109
321 3300049582 Ga0501048_0960059 Ga0501048_0960059_70_399 109
322 3300049587 Ga0501071_0768283 Ga0501071_0768283_118_447 109
323 3300050496 nmdc:mga07m45_743454_c1 nmdc:mga07m45_743454_c1_103_432 109
324 3300059421 Ga0590071_032265 Ga0590071_032265_316_645 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03091

CutA1

CutA1 divalent ion tolerance protein

4

102

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ah6-assembly2.cif.gz_F remarkable improvement of the heat stability of cuta1 from e.coli by rational protein designing 0.9749 1 103
4y6i-assembly1.cif.gz_B crystal structure of e.coli cuta1 e61v/c16a/c39a/c79a mutation 0.9717 1 102
1p1l-assembly1.cif.gz_A structure of the periplasmic divalent cation tolerance protein cuta from archaeoglobus fulgidus 0.9716 3 104
3aa8-assembly1.cif.gz_C crystal structure analysis of the mutant cuta1 (s11v/e61v) from e. coli 0.9705 3 103
4y65-assembly1.cif.gz_A crystal structure of e.coli cuta1 c16a/c39a/c79a mutation 0.9698 1 104
ID Description Score Start End Superfamily
af_P69488_1_112_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9735 1 104 3.30.70.120
af_Q7T3C3_31_149_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9719 2 105 3.30.70.120
1p1lA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9716 3 104 3.30.70.120
af_Q8I4T9_34_158_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9647 3 105 3.30.70.120
3ahpA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9645 3 102 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A841FVZ1-F1-model_v4 deleted 0.9938 3 102
AF-A0A520YIJ8-F1-model_v4 Divalent-cation tolerance protein CutA 0.9878 1 105 GO:0005507
GO:0010038
AF-A0A7C7DPV7-F1-model_v4 Divalent-cation tolerance protein CutA 0.9867 9 102 GO:0005507
GO:0010038
AF-A0A351SL13-F1-model_v4 Divalent-cation tolerance protein CutA 0.9844 2 104 GO:0005507
GO:0010038
AF-A0A3B1BCF7-F1-model_v4 Periplasmic divalent cation tolerance protein cutA 0.9827 2 105 GO:0005507
GO:0010038

Feature Viewer

pLDDT pTM Quality
94.7 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map