F407404
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 324 | 172 | 324 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300025921|Ga0207652_11508207|Ga0207652_115082072 |
| Length | 124 |
| Sequence | MSVVSVYVVFANEEEAERIGRQVVEERLAACVNLLGPIRSIYRWQGAVQQADEVAAIFKTTQAQADLLITRVAGLHSYDVPCIAVWPIDKLLADYADWVEANVGYTLTRMNRVSARPVLLIHRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 72 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 73 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 117 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 118 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 120 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 125 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 126 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 127 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 128 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 136 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 137 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 138 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 139 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 140 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 141 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 142 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 143 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 144 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 145 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 146 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 147 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 148 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 149 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 150 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 151 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 152 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 156 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 157 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 158 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 161 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 162 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 166 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 169 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 170 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 171 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 172 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.85 |
| Nodule | 0 |
| Rhizoplane | 2.47 |
| Rhizosphere | 93.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_397288 | 2162886011 | Bacteria | 861 |
| 2 | MBSR1b_contig_3879354 | 2162886012 | Bacteria | 1254 |
| 3 | JGI24738J21930_10026137 | 3300002075 | Bacteria | 1198 |
| 4 | Ga0065715_10540644 | 3300005293 | Bacteria | 728 |
| 5 | Ga0070658_11099839 | 3300005327 | Bacteria | 691 |
| 6 | Ga0070676_10289494 | 3300005328 | Bacteria | 1106 |
| 7 | Ga0070670_100019583 | 3300005331 | Bacteria | 5809 |
| 8 | Ga0070670_100131218 | 3300005331 | Bacteria | 2163 |
| 9 | Ga0070670_100132082 | 3300005331 | Bacteria | 2156 |
| 10 | Ga0070670_100303239 | 3300005331 | Bacteria | 1397 |
| 11 | Ga0070677_10003930 | 3300005333 | Bacteria | 4822 |
| 12 | Ga0070666_11128694 | 3300005335 | Bacteria | 583 |
| 13 | Ga0070680_100281490 | 3300005336 | Bacteria | 1409 |
| 14 | Ga0070682_100283941 | 3300005337 | Bacteria | 1208 |
| 15 | Ga0068868_100172399 | 3300005338 | Bacteria | 1791 |
| 16 | Ga0068868_100674429 | 3300005338 | Bacteria | 922 |
| 17 | Ga0070660_100019247 | 3300005339 | Bacteria | 4999 |
| 18 | Ga0070660_100437300 | 3300005339 | Bacteria | 1084 |
| 19 | Ga0070660_100528016 | 3300005339 | Bacteria | 983 |
| 20 | Ga0070660_100566363 | 3300005339 | Bacteria | 948 |
| 21 | Ga0070660_100658008 | 3300005339 | Bacteria | 877 |
| 22 | Ga0070687_100532097 | 3300005343 | Bacteria | 796 |
| 23 | Ga0070661_100133446 | 3300005344 | Bacteria | 1866 |
| 24 | Ga0070661_100714912 | 3300005344 | Bacteria | 817 |
| 25 | Ga0070668_100000143 | 3300005347 | Bacteria | 45647 |
| 26 | Ga0070668_100029064 | 3300005347 | Bacteria | 4197 |
| 27 | Ga0070668_100038924 | 3300005347 | Bacteria | 3637 |
| 28 | Ga0070669_100034877 | 3300005353 | Bacteria | 3643 |
| 29 | Ga0070669_100544715 | 3300005353 | Bacteria | 967 |
| 30 | Ga0070675_100003256 | 3300005354 | Bacteria | 12303 |
| 31 | Ga0070675_100540729 | 3300005354 | Bacteria | 1053 |
| 32 | Ga0070671_100000103 | 3300005355 | Bacteria | 54391 |
| 33 | Ga0070671_100596212 | 3300005355 | Bacteria | 955 |
| 34 | Ga0070671_100714973 | 3300005355 | Bacteria | 869 |
| 35 | Ga0070674_100296164 | 3300005356 | Bacteria | 1288 |
| 36 | Ga0070673_100155097 | 3300005364 | Bacteria | 1943 |
| 37 | Ga0070673_100174110 | 3300005364 | Bacteria | 1838 |
| 38 | Ga0070673_100598649 | 3300005364 | Bacteria | 1005 |
| 39 | Ga0070673_101016034 | 3300005364 | Bacteria | 772 |
| 40 | Ga0070688_101793840 | 3300005365 | Unclassified | 503 |
| 41 | Ga0070659_100031096 | 3300005366 | Bacteria | 4134 |
| 42 | Ga0070659_100059354 | 3300005366 | Bacteria | 3020 |
| 43 | Ga0070659_100069436 | 3300005366 | Bacteria | 2797 |
| 44 | Ga0070659_100646744 | 3300005366 | Unclassified | 911 |
| 45 | Ga0070659_100869419 | 3300005366 | Bacteria | 787 |
| 46 | Ga0070659_101874494 | 3300005366 | Bacteria | 537 |
| 47 | Ga0070667_100010013 | 3300005367 | Bacteria | 7855 |
| 48 | Ga0070667_100384064 | 3300005367 | Bacteria | 1276 |
| 49 | Ga0070714_100010037 | 3300005435 | Bacteria | 7471 |
| 50 | Ga0070705_100229611 | 3300005440 | Bacteria | 1290 |
| 51 | Ga0070694_100053342 | 3300005444 | Bacteria | 2736 |
| 52 | Ga0070663_100684677 | 3300005455 | Bacteria | 870 |
| 53 | Ga0070663_101507567 | 3300005455 | Bacteria | 598 |
| 54 | Ga0070662_100003652 | 3300005457 | Bacteria | 9607 |
| 55 | Ga0070662_100051566 | 3300005457 | Bacteria | 2972 |
| 56 | Ga0070662_100070787 | 3300005457 | Unclassified | 2570 |
| 57 | Ga0070662_100501101 | 3300005457 | Bacteria | 1013 |
| 58 | Ga0068867_100691642 | 3300005459 | Bacteria | 899 |
| 59 | Ga0068867_100939382 | 3300005459 | Bacteria | 780 |
| 60 | Ga0070706_100245171 | 3300005467 | Bacteria | 1673 |
| 61 | Ga0070679_101358654 | 3300005530 | Bacteria | 656 |
| 62 | Ga0068853_100027584 | 3300005539 | Bacteria | 4771 |
| 63 | Ga0068853_100670356 | 3300005539 | Bacteria | 988 |
| 64 | Ga0070672_100074520 | 3300005543 | Bacteria | 2707 |
| 65 | Ga0070672_100514944 | 3300005543 | Bacteria | 1036 |
| 66 | Ga0070672_100890529 | 3300005543 | Bacteria | 786 |
| 67 | Ga0070695_100055567 | 3300005545 | Bacteria | 2552 |
| 68 | Ga0070696_100010028 | 3300005546 | Bacteria | 6337 |
| 69 | Ga0070696_100200754 | 3300005546 | Bacteria | 1489 |
| 70 | Ga0070693_100210179 | 3300005547 | Bacteria | 1269 |
| 71 | Ga0070665_100402219 | 3300005548 | Bacteria | 1377 |
| 72 | Ga0070665_100432214 | 3300005548 | Bacteria | 1326 |
| 73 | Ga0070665_100442950 | 3300005548 | Bacteria | 1308 |
| 74 | Ga0070665_100944558 | 3300005548 | Bacteria | 875 |
| 75 | Ga0070665_102129440 | 3300005548 | Bacteria | 565 |
| 76 | Ga0068855_100456270 | 3300005563 | Bacteria | 1394 |
| 77 | Ga0068855_101004269 | 3300005563 | Bacteria | 876 |
| 78 | Ga0070664_100189610 | 3300005564 | Bacteria | 1831 |
| 79 | Ga0070664_100372988 | 3300005564 | Bacteria | 1301 |
| 80 | Ga0070664_100442756 | 3300005564 | Bacteria | 1192 |
| 81 | Ga0070664_102170436 | 3300005564 | Unclassified | 527 |
| 82 | Ga0068857_100135466 | 3300005577 | Bacteria | 2224 |
| 83 | Ga0068854_100120532 | 3300005578 | Bacteria | 1991 |
| 84 | Ga0068854_101841892 | 3300005578 | Bacteria | 555 |
| 85 | Ga0068856_100695342 | 3300005614 | Bacteria | 1037 |
| 86 | Ga0068856_102096290 | 3300005614 | Archaea | 575 |
| 87 | Ga0070702_100196330 | 3300005615 | Bacteria | 1332 |
| 88 | Ga0068852_100155692 | 3300005616 | Bacteria | 2129 |
| 89 | Ga0068859_101127273 | 3300005617 | Bacteria | 863 |
| 90 | Ga0068864_100108413 | 3300005618 | Bacteria | 2472 |
| 91 | Ga0068864_100119795 | 3300005618 | Bacteria | 2352 |
| 92 | Ga0068851_10048938 | 3300005834 | Bacteria | 2143 |
| 93 | Ga0068863_100000017 | 3300005841 | Bacteria | 207950 |
| 94 | Ga0068863_101870863 | 3300005841 | Bacteria | 610 |
| 95 | Ga0068860_100096354 | 3300005843 | Bacteria | 2820 |
| 96 | Ga0068862_100662422 | 3300005844 | Bacteria | 1008 |
| 97 | Ga0075427_10118343 | 3300006194 | Bacteria | 503 |
| 98 | Ga0097621_100536776 | 3300006237 | Bacteria | 1063 |
| 99 | Ga0075370_10585492 | 3300006353 | Bacteria | 676 |
| 100 | Ga0068871_100362142 | 3300006358 | Bacteria | 1285 |
| 101 | Ga0075428_100067786 | 3300006844 | Bacteria | 3905 |
| 102 | Ga0097620_101127467 | 3300006931 | Bacteria | 863 |
| 103 | Ga0111539_10030040 | 3300009094 | Bacteria | 6612 |
| 104 | Ga0111539_12853614 | 3300009094 | Bacteria | 559 |
| 105 | Ga0114129_10473673 | 3300009147 | Bacteria | 1639 |
| 106 | Ga0105243_10666986 | 3300009148 | Bacteria | 1010 |
| 107 | Ga0105248_11198934 | 3300009177 | Bacteria | 858 |
| 108 | Ga0105249_10078026 | 3300009553 | Bacteria | 3072 |
| 109 | Ga0105249_11529001 | 3300009553 | Bacteria | 740 |
| 110 | Ga0105246_10503948 | 3300011119 | Unclassified | 1029 |
| 111 | Ga0157373_10172736 | 3300013100 | Bacteria | 1521 |
| 112 | Ga0157373_10394509 | 3300013100 | Bacteria | 991 |
| 113 | Ga0157371_10274772 | 3300013102 | Bacteria | 1216 |
| 114 | Ga0157371_10612021 | 3300013102 | Bacteria | 811 |
| 115 | Ga0157369_10008490 | 3300013105 | Bacteria | 11778 |
| 116 | Ga0157374_10396418 | 3300013296 | Bacteria | 1376 |
| 117 | Ga0157378_10065243 | 3300013297 | Bacteria | 3259 |
| 118 | Ga0157375_10625807 | 3300013308 | Bacteria | 1234 |
| 119 | Ga0157380_10026973 | 3300014326 | Bacteria | 4365 |
| 120 | Ga0157380_11439019 | 3300014326 | Archaea | 741 |
| 121 | Ga0213876_10487757 | 3300021384 | Unclassified | 656 |
| 122 | Ga0213875_10001046 | 3300021388 | Bacteria | 19467 |
| 123 | Ga0207697_10019409 | 3300025315 | Bacteria | 2784 |
| 124 | Ga0207682_10002276 | 3300025893 | Bacteria | 8655 |
| 125 | Ga0207688_10030113 | 3300025901 | Bacteria | 2992 |
| 126 | Ga0207647_10046602 | 3300025904 | Bacteria | 2701 |
| 127 | Ga0207647_10071354 | 3300025904 | Bacteria | 2095 |
| 128 | Ga0207645_10096617 | 3300025907 | Bacteria | 1903 |
| 129 | Ga0207705_10062113 | 3300025909 | Bacteria | 2698 |
| 130 | Ga0207684_10171279 | 3300025910 | Bacteria | 1872 |
| 131 | Ga0207660_10220065 | 3300025917 | Bacteria | 1490 |
| 132 | Ga0207657_10066573 | 3300025919 | Bacteria | 3066 |
| 133 | Ga0207657_10355395 | 3300025919 | Bacteria | 1155 |
| 134 | Ga0207657_10355396 | 3300025919 | Bacteria | 1155 |
| 135 | Ga0207657_10398604 | 3300025919 | Bacteria | 1082 |
| 136 | Ga0207649_10495613 | 3300025920 | Bacteria | 928 |
| 137 | Ga0207652_11508207 | 3300025921 | Bacteria | 576 |
| 138 | Ga0207681_10016051 | 3300025923 | Bacteria | 4677 |
| 139 | Ga0207681_10114180 | 3300025923 | Bacteria | 1970 |
| 140 | Ga0207681_10745908 | 3300025923 | Bacteria | 816 |
| 141 | Ga0207681_11334889 | 3300025923 | Bacteria | 602 |
| 142 | Ga0207650_10016305 | 3300025925 | Bacteria | 5191 |
| 143 | Ga0207650_10049351 | 3300025925 | Bacteria | 3107 |
| 144 | Ga0207650_10091547 | 3300025925 | Bacteria | 2324 |
| 145 | Ga0207650_10122234 | 3300025925 | Bacteria | 2028 |
| 146 | Ga0207659_10017358 | 3300025926 | Bacteria | 4701 |
| 147 | Ga0207659_10582453 | 3300025926 | Bacteria | 953 |
| 148 | Ga0207659_11176583 | 3300025926 | Bacteria | 659 |
| 149 | Ga0207664_10048259 | 3300025929 | Bacteria | 3348 |
| 150 | Ga0207644_10000161 | 3300025931 | Bacteria | 48684 |
| 151 | Ga0207644_10446459 | 3300025931 | Bacteria | 1062 |
| 152 | Ga0207690_10019881 | 3300025932 | Bacteria | 4140 |
| 153 | Ga0207690_10081602 | 3300025932 | Bacteria | 2260 |
| 154 | Ga0207690_10142955 | 3300025932 | Bacteria | 1765 |
| 155 | Ga0207690_10828880 | 3300025932 | Bacteria | 765 |
| 156 | Ga0207690_11085001 | 3300025932 | Bacteria | 667 |
| 157 | Ga0207706_10004099 | 3300025933 | Bacteria | 13771 |
| 158 | Ga0207706_10048755 | 3300025933 | Bacteria | 3745 |
| 159 | Ga0207706_10085921 | 3300025933 | Bacteria | 2766 |
| 160 | Ga0207706_10763112 | 3300025933 | Bacteria | 823 |
| 161 | Ga0207709_10319455 | 3300025935 | Bacteria | 1161 |
| 162 | Ga0207669_10153578 | 3300025937 | Bacteria | 1616 |
| 163 | Ga0207704_10246395 | 3300025938 | Bacteria | 1338 |
| 164 | Ga0207691_10019116 | 3300025940 | Bacteria | 6486 |
| 165 | Ga0207691_10474379 | 3300025940 | Bacteria | 1064 |
| 166 | Ga0207711_10639268 | 3300025941 | Bacteria | 993 |
| 167 | Ga0207679_10068380 | 3300025945 | Bacteria | 2668 |
| 168 | Ga0207679_10328463 | 3300025945 | Bacteria | 1326 |
| 169 | Ga0207679_10426729 | 3300025945 | Bacteria | 1171 |
| 170 | Ga0207679_11945115 | 3300025945 | Unclassified | 536 |
| 171 | Ga0207667_10308854 | 3300025949 | Bacteria | 1615 |
| 172 | Ga0207651_10057554 | 3300025960 | Bacteria | 2682 |
| 173 | Ga0207651_10232250 | 3300025960 | Bacteria | 1498 |
| 174 | Ga0207651_10371301 | 3300025960 | Bacteria | 1210 |
| 175 | Ga0207712_10239981 | 3300025961 | Bacteria | 1459 |
| 176 | Ga0207668_10000113 | 3300025972 | Bacteria | 57453 |
| 177 | Ga0207668_10008105 | 3300025972 | Bacteria | 6254 |
| 178 | Ga0207668_11945349 | 3300025972 | Bacteria | 530 |
| 179 | Ga0207640_10266234 | 3300025981 | Bacteria | 1338 |
| 180 | Ga0207640_11660324 | 3300025981 | Bacteria | 576 |
| 181 | Ga0207658_10017011 | 3300025986 | Bacteria | 5006 |
| 182 | Ga0207658_10443457 | 3300025986 | Bacteria | 1148 |
| 183 | Ga0207658_10500120 | 3300025986 | Bacteria | 1083 |
| 184 | Ga0207677_10401621 | 3300026023 | Bacteria | 1162 |
| 185 | Ga0207639_10558110 | 3300026041 | Bacteria | 1052 |
| 186 | Ga0207641_10000036 | 3300026088 | Bacteria | 213165 |
| 187 | Ga0207641_11714924 | 3300026088 | Bacteria | 630 |
| 188 | Ga0207648_11166692 | 3300026089 | Bacteria | 723 |
| 189 | Ga0207676_10174172 | 3300026095 | Bacteria | 1878 |
| 190 | Ga0207674_10062182 | 3300026116 | Bacteria | 3771 |
| 191 | Ga0207675_100303528 | 3300026118 | Bacteria | 1555 |
| 192 | Ga0207683_10033963 | 3300026121 | Bacteria | 4432 |
| 193 | Ga0207683_10712933 | 3300026121 | Bacteria | 930 |
| 194 | Ga0207683_11299883 | 3300026121 | Bacteria | 673 |
| 195 | Ga0207698_10483886 | 3300026142 | Bacteria | 1201 |
| 196 | Ga0210002_1067667 | 3300027617 | Bacteria | 628 |
| 197 | Ga0209974_10089508 | 3300027876 | Bacteria | 1066 |
| 198 | Ga0268266_10005701 | 3300028379 | Bacteria | 11546 |
| 199 | Ga0268266_10037677 | 3300028379 | Bacteria | 4118 |
| 200 | Ga0268266_10779182 | 3300028379 | Bacteria | 923 |
| 201 | Ga0268264_10033985 | 3300028381 | Bacteria | 4192 |
| 202 | Ga0307513_10252146 | 3300031456 | Bacteria | 1561 |
| 203 | Ga0307513_10507125 | 3300031456 | Bacteria | 923 |
| 204 | Ga0307408_100780584 | 3300031548 | Bacteria | 865 |
| 205 | Ga0307405_10065577 | 3300031731 | Bacteria | 2312 |
| 206 | Ga0307405_11033282 | 3300031731 | Bacteria | 703 |
| 207 | Ga0307405_11196306 | 3300031731 | Bacteria | 657 |
| 208 | Ga0307413_10147756 | 3300031824 | Bacteria | 1634 |
| 209 | Ga0307413_10396666 | 3300031824 | Bacteria | 1080 |
| 210 | Ga0307413_10409475 | 3300031824 | Bacteria | 1065 |
| 211 | Ga0307413_10483331 | 3300031824 | Bacteria | 990 |
| 212 | Ga0307410_10079307 | 3300031852 | Bacteria | 2300 |
| 213 | Ga0307410_10083923 | 3300031852 | Bacteria | 2244 |
| 214 | Ga0307410_10248514 | 3300031852 | Bacteria | 1382 |
| 215 | Ga0307410_10302756 | 3300031852 | Bacteria | 1262 |
| 216 | Ga0307410_10479840 | 3300031852 | Bacteria | 1020 |
| 217 | Ga0307410_10851766 | 3300031852 | Bacteria | 778 |
| 218 | Ga0307410_11718190 | 3300031852 | Bacteria | 556 |
| 219 | Ga0307410_11764404 | 3300031852 | Unclassified | 549 |
| 220 | Ga0307406_10072153 | 3300031901 | Bacteria | 2265 |
| 221 | Ga0307406_10273757 | 3300031901 | Bacteria | 1284 |
| 222 | Ga0307406_11229061 | 3300031901 | Bacteria | 651 |
| 223 | Ga0307407_10020691 | 3300031903 | Bacteria | 3376 |
| 224 | Ga0307407_10077944 | 3300031903 | Bacteria | 1995 |
| 225 | Ga0307407_10421535 | 3300031903 | Bacteria | 962 |
| 226 | Ga0307412_10293185 | 3300031911 | Bacteria | 1282 |
| 227 | Ga0307412_10827924 | 3300031911 | Unclassified | 806 |
| 228 | Ga0307412_11699244 | 3300031911 | Bacteria | 578 |
| 229 | Ga0307412_12245322 | 3300031911 | Bacteria | 508 |
| 230 | Ga0307409_100009907 | 3300031995 | Bacteria | 5884 |
| 231 | Ga0307409_100089885 | 3300031995 | Bacteria | 2512 |
| 232 | Ga0307409_100093109 | 3300031995 | Bacteria | 2475 |
| 233 | Ga0307409_100121991 | 3300031995 | Bacteria | 2209 |
| 234 | Ga0307409_100207832 | 3300031995 | Bacteria | 1757 |
| 235 | Ga0307409_100277726 | 3300031995 | Bacteria | 1546 |
| 236 | Ga0307409_100420078 | 3300031995 | Bacteria | 1282 |
| 237 | Ga0307409_100606581 | 3300031995 | Bacteria | 1082 |
| 238 | Ga0307409_100606711 | 3300031995 | Bacteria | 1082 |
| 239 | Ga0307409_100754334 | 3300031995 | Bacteria | 977 |
| 240 | Ga0307416_100058035 | 3300032002 | Bacteria | 3135 |
| 241 | Ga0307416_100089983 | 3300032002 | Bacteria | 2630 |
| 242 | Ga0307416_100481476 | 3300032002 | Bacteria | 1301 |
| 243 | Ga0307416_101253629 | 3300032002 | Bacteria | 847 |
| 244 | Ga0307416_101419523 | 3300032002 | Bacteria | 800 |
| 245 | Ga0307416_102408901 | 3300032002 | Bacteria | 626 |
| 246 | Ga0307416_102631717 | 3300032002 | Bacteria | 600 |
| 247 | Ga0307414_10027363 | 3300032004 | Bacteria | 3684 |
| 248 | Ga0307414_10035905 | 3300032004 | Bacteria | 3303 |
| 249 | Ga0307414_10284374 | 3300032004 | Bacteria | 1391 |
| 250 | Ga0307414_11384760 | 3300032004 | Bacteria | 653 |
| 251 | Ga0307411_10042880 | 3300032005 | Bacteria | 2891 |
| 252 | Ga0307411_10146809 | 3300032005 | Bacteria | 1747 |
| 253 | Ga0307411_10175215 | 3300032005 | Bacteria | 1622 |
| 254 | Ga0307411_10233414 | 3300032005 | Bacteria | 1435 |
| 255 | Ga0307411_10258806 | 3300032005 | Bacteria | 1373 |
| 256 | Ga0307411_10263822 | 3300032005 | Bacteria | 1361 |
| 257 | Ga0307411_10322939 | 3300032005 | Bacteria | 1247 |
| 258 | Ga0307411_10358422 | 3300032005 | Bacteria | 1191 |
| 259 | Ga0307411_10569412 | 3300032005 | Bacteria | 969 |
| 260 | Ga0307415_100031545 | 3300032126 | Bacteria | 3415 |
| 261 | Ga0307415_100110740 | 3300032126 | Bacteria | 2037 |
| 262 | Ga0307415_100286370 | 3300032126 | Unclassified | 1358 |
| 263 | Ga0307415_100368481 | 3300032126 | Bacteria | 1215 |
| 264 | Ga0307415_100549018 | 3300032126 | Bacteria | 1019 |
| 265 | Ga0307415_101334802 | 3300032126 | Unclassified | 680 |
| 266 | Ga0307415_101509809 | 3300032126 | Bacteria | 643 |
| 267 | Ga0307415_102309097 | 3300032126 | Bacteria | 528 |
| 268 | Ga0395899_0096555 | 3300037312 | Unclassified | 2137 |
| 269 | Ga0395899_0102221 | 3300037312 | Unclassified | 2068 |
| 270 | Ga0395900_0032873 | 3300037418 | Bacteria | 5336 |
| 271 | Ga0395900_0099151 | 3300037418 | Bacteria | 2993 |
| 272 | Ga0395900_0942143 | 3300037418 | Bacteria | 785 |
| 273 | Ga0395905_0282785 | 3300037471 | Bacteria | 1545 |
| 274 | Ga0395905_0794082 | 3300037471 | Unclassified | 849 |
| 275 | Ga0395905_1159641 | 3300037471 | Bacteria | 676 |
| 276 | Ga0395905_1795151 | 3300037471 | Bacteria | 519 |
| 277 | Ga0436364_0986946 | 3300037853 | Bacteria | 208509 |
| 278 | Ga0395901_0340308 | 3300038443 | Bacteria | 1550 |
| 279 | Ga0395901_0424866 | 3300038443 | Unclassified | 1362 |
| 280 | Ga0395901_0664938 | 3300038443 | Bacteria | 1043 |
| 281 | Ga0436365_1287693 | 3300039437 | Unclassified | 633 |
| 282 | Ga0439439_0108145 | 3300041406 | Bacteria | 769 |
| 283 | Ga0451807_0286400 | 3300041486 | Bacteria | 814 |
| 284 | Ga0439431_0205470 | 3300041997 | Bacteria | 575 |
| 285 | Ga0439437_010337 | 3300042000 | Unclassified | 1061 |
| 286 | Ga0439449_0020818 | 3300042007 | Bacteria | 2457 |
| 287 | Ga0439462_0071465 | 3300042015 | Bacteria | 943 |
| 288 | Ga0450912_004912 | 3300042116 | Bacteria | 1009 |
| 289 | Ga0450914_009590 | 3300042118 | Bacteria | 920 |
| 290 | Ga0450914_016513 | 3300042118 | Bacteria | 783 |
| 291 | Ga0450920_017592 | 3300042122 | Bacteria | 1368 |
| 292 | Ga0450905_008215 | 3300042142 | Bacteria | 1427 |
| 293 | Ga0450889_000888 | 3300042144 | Bacteria | 3212 |
| 294 | Ga0466969_0076622 | 3300044656 | Bacteria | 1601 |
| 295 | Ga0466966_0621284 | 3300044684 | Bacteria | 651 |
| 296 | Ga0466961_0048848 | 3300044693 | Bacteria | 2705 |
| 297 | Ga0466964_0014440 | 3300044706 | Unclassified | 3004 |
| 298 | Ga0466959_0262279 | 3300045049 | Unclassified | 1189 |
| 299 | Ga0466967_0501505 | 3300045976 | Bacteria | 1191 |
| 300 | Ga0466967_1202794 | 3300045976 | Bacteria | 755 |
| 301 | Ga0466967_2178248 | 3300045976 | Bacteria | 550 |
| 302 | Ga0495663_0054107 | 3300046525 | Bacteria | 1249 |
| 303 | Ga0495669_0024767 | 3300046684 | Bacteria | 2614 |
| 304 | Ga0495669_0212806 | 3300046684 | Bacteria | 925 |
| 305 | Ga0495677_0036354 | 3300047445 | Bacteria | 1799 |
| 306 | Ga0495677_0126712 | 3300047445 | Bacteria | 976 |
| 307 | Ga0496102_0595067 | 3300048905 | Bacteria | 1029 |
| 308 | Ga0496103_0486956 | 3300048906 | Bacteria | 790 |
| 309 | Ga0496105_1399251 | 3300048908 | Bacteria | 507 |
| 310 | Ga0496108_0363207 | 3300048911 | Bacteria | 1264 |
| 311 | Ga0496109_0099006 | 3300048912 | Bacteria | 2704 |
| 312 | Ga0496110_0093960 | 3300048913 | Bacteria | 2685 |
| 313 | Ga0496112_0220703 | 3300048915 | Bacteria | 1852 |
| 314 | Ga0501036_1215269 | 3300049572 | Bacteria | 614 |
| 315 | Ga0501048_0960059 | 3300049582 | Bacteria | 615 |
| 316 | Ga0501071_0768283 | 3300049587 | Bacteria | 743 |
| 317 | nmdc:mga07m45_743454_c1 | 3300050496 | Bacteria | 563 |
| 318 | nmdc:mga05p37_492913_c1 | 3300050507 | Bacteria | 1408 |
| 319 | nmdc:mga08y16_50996_c1 | 3300050511 | Bacteria | 4329 |
| 320 | Ga0500592_000161 | 3300053116 | Bacteria | 13501 |
| 321 | Ga0500658_0064022 | 3300053134 | Bacteria | 1537 |
| 322 | Ga0500604_0143431 | 3300053151 | Bacteria | 808 |
| 323 | Ga0500627_0000092 | 3300053158 | Bacteria | 30073 |
| 324 | Ga0590071_032265 | 3300059421 | Bacteria | 1250 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005615 | Ga0070702_100196330 | Ga0070702_1001963302 | 103 |
| 2 | 3300009553 | Ga0105249_11529001 | Ga0105249_115290011 | 103 |
| 3 | 3300011119 | Ga0105246_10503948 | Ga0105246_105039482 | 103 |
| 4 | 3300021388 | Ga0213875_10001046 | Ga0213875_100010467 | 103 |
| 5 | 3300026118 | Ga0207675_100303528 | Ga0207675_1003035282 | 103 |
| 6 | 3300037853 | Ga0436364_0986946 | Ga0436364_0986946_177374_177688 | 103 |
| 7 | 3300002075 | JGI24738J21930_10026137 | JGI24738J21930_100261372 | 104 |
| 8 | 3300005327 | Ga0070658_11099839 | Ga0070658_110998392 | 104 |
| 9 | 3300005331 | Ga0070670_100131218 | Ga0070670_1001312181 | 104 |
| 10 | 3300005331 | Ga0070670_100132082 | Ga0070670_1001320822 | 104 |
| 11 | 3300005336 | Ga0070680_100281490 | Ga0070680_1002814902 | 104 |
| 12 | 3300005337 | Ga0070682_100283941 | Ga0070682_1002839412 | 104 |
| 13 | 3300005339 | Ga0070660_100019247 | Ga0070660_1000192475 | 104 |
| 14 | 3300005339 | Ga0070660_100437300 | Ga0070660_1004373002 | 104 |
| 15 | 3300005339 | Ga0070660_100528016 | Ga0070660_1005280161 | 104 |
| 16 | 3300005339 | Ga0070660_100566363 | Ga0070660_1005663632 | 104 |
| 17 | 3300005339 | Ga0070660_100658008 | Ga0070660_1006580082 | 104 |
| 18 | 3300005344 | Ga0070661_100714912 | Ga0070661_1007149121 | 104 |
| 19 | 3300005355 | Ga0070671_100596212 | Ga0070671_1005962122 | 104 |
| 20 | 3300005364 | Ga0070673_100155097 | Ga0070673_1001550972 | 104 |
| 21 | 3300005365 | Ga0070688_101793840 | Ga0070688_1017938401 | 104 |
| 22 | 3300005366 | Ga0070659_100031096 | Ga0070659_1000310964 | 104 |
| 23 | 3300005366 | Ga0070659_100059354 | Ga0070659_1000593546 | 104 |
| 24 | 3300005366 | Ga0070659_100646744 | Ga0070659_1006467441 | 104 |
| 25 | 3300005366 | Ga0070659_100869419 | Ga0070659_1008694192 | 104 |
| 26 | 3300005367 | Ga0070667_100010013 | Ga0070667_1000100132 | 104 |
| 27 | 3300005435 | Ga0070714_100010037 | Ga0070714_1000100375 | 104 |
| 28 | 3300005440 | Ga0070705_100229611 | Ga0070705_1002296113 | 104 |
| 29 | 3300005444 | Ga0070694_100053342 | Ga0070694_1000533421 | 104 |
| 30 | 3300005455 | Ga0070663_101507567 | Ga0070663_1015075671 | 104 |
| 31 | 3300005457 | Ga0070662_100051566 | Ga0070662_1000515662 | 104 |
| 32 | 3300005457 | Ga0070662_100070787 | Ga0070662_1000707872 | 104 |
| 33 | 3300005467 | Ga0070706_100245171 | Ga0070706_1002451713 | 104 |
| 34 | 3300005530 | Ga0070679_101358654 | Ga0070679_1013586542 | 104 |
| 35 | 3300005539 | Ga0068853_100027584 | Ga0068853_1000275845 | 104 |
| 36 | 3300005539 | Ga0068853_100670356 | Ga0068853_1006703562 | 104 |
| 37 | 3300005543 | Ga0070672_100514944 | Ga0070672_1005149442 | 104 |
| 38 | 3300005545 | Ga0070695_100055567 | Ga0070695_1000555675 | 104 |
| 39 | 3300005546 | Ga0070696_100010028 | Ga0070696_1000100286 | 104 |
| 40 | 3300005546 | Ga0070696_100200754 | Ga0070696_1002007541 | 104 |
| 41 | 3300005547 | Ga0070693_100210179 | Ga0070693_1002101791 | 104 |
| 42 | 3300005548 | Ga0070665_100402219 | Ga0070665_1004022192 | 104 |
| 43 | 3300005548 | Ga0070665_100432214 | Ga0070665_1004322143 | 104 |
| 44 | 3300005548 | Ga0070665_100442950 | Ga0070665_1004429502 | 104 |
| 45 | 3300005563 | Ga0068855_100456270 | Ga0068855_1004562702 | 104 |
| 46 | 3300005563 | Ga0068855_101004269 | Ga0068855_1010042692 | 104 |
| 47 | 3300005564 | Ga0070664_100372988 | Ga0070664_1003729882 | 104 |
| 48 | 3300005564 | Ga0070664_102170436 | Ga0070664_1021704362 | 104 |
| 49 | 3300005578 | Ga0068854_100120532 | Ga0068854_1001205323 | 104 |
| 50 | 3300005578 | Ga0068854_101841892 | Ga0068854_1018418921 | 104 |
| 51 | 3300005614 | Ga0068856_100695342 | Ga0068856_1006953422 | 104 |
| 52 | 3300005616 | Ga0068852_100155692 | Ga0068852_1001556922 | 104 |
| 53 | 3300005834 | Ga0068851_10048938 | Ga0068851_100489382 | 104 |
| 54 | 3300006237 | Ga0097621_100536776 | Ga0097621_1005367762 | 104 |
| 55 | 3300009094 | Ga0111539_10030040 | Ga0111539_100300405 | 104 |
| 56 | 3300009177 | Ga0105248_11198934 | Ga0105248_111989341 | 104 |
| 57 | 3300013100 | Ga0157373_10172736 | Ga0157373_101727363 | 104 |
| 58 | 3300013105 | Ga0157369_10008490 | Ga0157369_100084909 | 104 |
| 59 | 3300021384 | Ga0213876_10487757 | Ga0213876_104877572 | 104 |
| 60 | 3300025904 | Ga0207647_10071354 | Ga0207647_100713542 | 104 |
| 61 | 3300025909 | Ga0207705_10062113 | Ga0207705_100621132 | 104 |
| 62 | 3300025910 | Ga0207684_10171279 | Ga0207684_101712793 | 104 |
| 63 | 3300025917 | Ga0207660_10220065 | Ga0207660_102200652 | 104 |
| 64 | 3300025919 | Ga0207657_10066573 | Ga0207657_100665732 | 104 |
| 65 | 3300025919 | Ga0207657_10398604 | Ga0207657_103986043 | 104 |
| 66 | 3300025920 | Ga0207649_10495613 | Ga0207649_104956132 | 104 |
| 67 | 3300025923 | Ga0207681_10114180 | Ga0207681_101141802 | 104 |
| 68 | 3300025925 | Ga0207650_10091547 | Ga0207650_100915475 | 104 |
| 69 | 3300025929 | Ga0207664_10048259 | Ga0207664_100482595 | 104 |
| 70 | 3300025932 | Ga0207690_10019881 | Ga0207690_100198813 | 104 |
| 71 | 3300025932 | Ga0207690_10081602 | Ga0207690_100816022 | 104 |
| 72 | 3300025932 | Ga0207690_11085001 | Ga0207690_110850012 | 104 |
| 73 | 3300025933 | Ga0207706_10048755 | Ga0207706_100487553 | 104 |
| 74 | 3300025933 | Ga0207706_10085921 | Ga0207706_100859213 | 104 |
| 75 | 3300025941 | Ga0207711_10639268 | Ga0207711_106392681 | 104 |
| 76 | 3300025945 | Ga0207679_10328463 | Ga0207679_103284632 | 104 |
| 77 | 3300025945 | Ga0207679_11945115 | Ga0207679_119451152 | 104 |
| 78 | 3300025949 | Ga0207667_10308854 | Ga0207667_103088542 | 104 |
| 79 | 3300025960 | Ga0207651_10057554 | Ga0207651_100575542 | 104 |
| 80 | 3300025972 | Ga0207668_11945349 | Ga0207668_119453491 | 104 |
| 81 | 3300025981 | Ga0207640_10266234 | Ga0207640_102662343 | 104 |
| 82 | 3300025981 | Ga0207640_11660324 | Ga0207640_116603242 | 104 |
| 83 | 3300025986 | Ga0207658_10017011 | Ga0207658_100170117 | 104 |
| 84 | 3300026041 | Ga0207639_10558110 | Ga0207639_105581102 | 104 |
| 85 | 3300026121 | Ga0207683_11299883 | Ga0207683_112998832 | 104 |
| 86 | 3300026142 | Ga0207698_10483886 | Ga0207698_104838862 | 104 |
| 87 | 3300028379 | Ga0268266_10005701 | Ga0268266_1000570115 | 104 |
| 88 | 3300028379 | Ga0268266_10779182 | Ga0268266_107791822 | 104 |
| 89 | 3300031456 | Ga0307513_10252146 | Ga0307513_102521462 | 104 |
| 90 | 3300031456 | Ga0307513_10507125 | Ga0307513_105071252 | 104 |
| 91 | 3300031824 | Ga0307413_10409475 | Ga0307413_104094752 | 104 |
| 92 | 3300031852 | Ga0307410_10083923 | Ga0307410_100839235 | 104 |
| 93 | 3300031852 | Ga0307410_10851766 | Ga0307410_108517661 | 104 |
| 94 | 3300031901 | Ga0307406_10072153 | Ga0307406_100721532 | 104 |
| 95 | 3300031901 | Ga0307406_10273757 | Ga0307406_102737572 | 104 |
| 96 | 3300031903 | Ga0307407_10020691 | Ga0307407_100206913 | 104 |
| 97 | 3300031911 | Ga0307412_10293185 | Ga0307412_102931852 | 104 |
| 98 | 3300031911 | Ga0307412_10827924 | Ga0307412_108279241 | 104 |
| 99 | 3300031911 | Ga0307412_11699244 | Ga0307412_116992442 | 104 |
| 100 | 3300031995 | Ga0307409_100009907 | Ga0307409_1000099072 | 104 |
| 101 | 3300031995 | Ga0307409_100093109 | Ga0307409_1000931094 | 104 |
| 102 | 3300031995 | Ga0307409_100121991 | Ga0307409_1001219912 | 104 |
| 103 | 3300031995 | Ga0307409_100207832 | Ga0307409_1002078322 | 104 |
| 104 | 3300031995 | Ga0307409_100277726 | Ga0307409_1002777263 | 104 |
| 105 | 3300031995 | Ga0307409_100420078 | Ga0307409_1004200783 | 104 |
| 106 | 3300031995 | Ga0307409_100606581 | Ga0307409_1006065812 | 104 |
| 107 | 3300032002 | Ga0307416_100058035 | Ga0307416_1000580356 | 104 |
| 108 | 3300032002 | Ga0307416_100481476 | Ga0307416_1004814762 | 104 |
| 109 | 3300032002 | Ga0307416_101419523 | Ga0307416_1014195232 | 104 |
| 110 | 3300032002 | Ga0307416_102631717 | Ga0307416_1026317172 | 104 |
| 111 | 3300032004 | Ga0307414_10027363 | Ga0307414_100273632 | 104 |
| 112 | 3300032004 | Ga0307414_10035905 | Ga0307414_100359054 | 104 |
| 113 | 3300032005 | Ga0307411_10042880 | Ga0307411_100428802 | 104 |
| 114 | 3300032005 | Ga0307411_10263822 | Ga0307411_102638222 | 104 |
| 115 | 3300032005 | Ga0307411_10569412 | Ga0307411_105694122 | 104 |
| 116 | 3300032126 | Ga0307415_100031545 | Ga0307415_1000315455 | 104 |
| 117 | 3300032126 | Ga0307415_100110740 | Ga0307415_1001107404 | 104 |
| 118 | 3300032126 | Ga0307415_100286370 | Ga0307415_1002863703 | 104 |
| 119 | 3300032126 | Ga0307415_100368481 | Ga0307415_1003684812 | 104 |
| 120 | 3300032126 | Ga0307415_100549018 | Ga0307415_1005490182 | 104 |
| 121 | 3300032126 | Ga0307415_102309097 | Ga0307415_1023090971 | 104 |
| 122 | 3300037312 | Ga0395899_0096555 | Ga0395899_0096555_59_373 | 104 |
| 123 | 3300037312 | Ga0395899_0102221 | Ga0395899_0102221_1455_1769 | 104 |
| 124 | 3300037418 | Ga0395900_0032873 | Ga0395900_0032873_387_701 | 104 |
| 125 | 3300037418 | Ga0395900_0099151 | Ga0395900_0099151_2301_2615 | 104 |
| 126 | 3300037418 | Ga0395900_0942143 | Ga0395900_0942143_402_716 | 104 |
| 127 | 3300037471 | Ga0395905_0282785 | Ga0395905_0282785_636_950 | 104 |
| 128 | 3300037471 | Ga0395905_0794082 | Ga0395905_0794082_407_721 | 104 |
| 129 | 3300037471 | Ga0395905_1159641 | Ga0395905_1159641_91_405 | 104 |
| 130 | 3300037471 | Ga0395905_1795151 | Ga0395905_1795151_52_366 | 104 |
| 131 | 3300038443 | Ga0395901_0340308 | Ga0395901_0340308_981_1295 | 104 |
| 132 | 3300038443 | Ga0395901_0424866 | Ga0395901_0424866_183_497 | 104 |
| 133 | 3300038443 | Ga0395901_0664938 | Ga0395901_0664938_37_351 | 104 |
| 134 | 3300039437 | Ga0436365_1287693 | Ga0436365_1287693_97_411 | 104 |
| 135 | 3300042000 | Ga0439437_010337 | Ga0439437_010337_35_349 | 104 |
| 136 | 3300042015 | Ga0439462_0071465 | Ga0439462_0071465_26_340 | 104 |
| 137 | 3300042118 | Ga0450914_016513 | Ga0450914_016513_178_492 | 104 |
| 138 | 3300042142 | Ga0450905_008215 | Ga0450905_008215_827_1141 | 104 |
| 139 | 3300042144 | Ga0450889_000888 | Ga0450889_000888_991_1305 | 104 |
| 140 | 3300044656 | Ga0466969_0076622 | Ga0466969_0076622_635_949 | 104 |
| 141 | 3300044684 | Ga0466966_0621284 | Ga0466966_0621284_291_605 | 104 |
| 142 | 3300044693 | Ga0466961_0048848 | Ga0466961_0048848_573_887 | 104 |
| 143 | 3300044706 | Ga0466964_0014440 | Ga0466964_0014440_2666_2980 | 104 |
| 144 | 3300045049 | Ga0466959_0262279 | Ga0466959_0262279_157_471 | 104 |
| 145 | 3300045976 | Ga0466967_0501505 | Ga0466967_0501505_247_561 | 104 |
| 146 | 3300045976 | Ga0466967_1202794 | Ga0466967_1202794_159_473 | 104 |
| 147 | 3300045976 | Ga0466967_2178248 | Ga0466967_2178248_14_328 | 104 |
| 148 | 3300046525 | Ga0495663_0054107 | Ga0495663_0054107_351_665 | 104 |
| 149 | 3300046684 | Ga0495669_0024767 | Ga0495669_0024767_327_641 | 104 |
| 150 | 3300046684 | Ga0495669_0212806 | Ga0495669_0212806_230_544 | 104 |
| 151 | 3300047445 | Ga0495677_0036354 | Ga0495677_0036354_1047_1361 | 104 |
| 152 | 3300047445 | Ga0495677_0126712 | Ga0495677_0126712_157_471 | 104 |
| 153 | 3300048915 | Ga0496112_0220703 | Ga0496112_0220703_1326_1640 | 104 |
| 154 | 3300050511 | nmdc:mga08y16_50996_c1 | nmdc:mga08y16_50996_c1_2557_2871 | 104 |
| 155 | 3300005347 | Ga0070668_100000143 | Ga0070668_10000014348 | 105 |
| 156 | 3300005355 | Ga0070671_100000103 | Ga0070671_10000010331 | 105 |
| 157 | 3300005367 | Ga0070667_100384064 | Ga0070667_1003840642 | 105 |
| 158 | 3300005548 | Ga0070665_100944558 | Ga0070665_1009445582 | 105 |
| 159 | 3300005617 | Ga0068859_101127273 | Ga0068859_1011272731 | 105 |
| 160 | 3300005841 | Ga0068863_100000017 | Ga0068863_100000017163 | 105 |
| 161 | 3300005843 | Ga0068860_100096354 | Ga0068860_1000963543 | 105 |
| 162 | 3300006931 | Ga0097620_101127467 | Ga0097620_1011274671 | 105 |
| 163 | 3300009553 | Ga0105249_10078026 | Ga0105249_100780262 | 105 |
| 164 | 3300025925 | Ga0207650_10049351 | Ga0207650_100493515 | 105 |
| 165 | 3300025931 | Ga0207644_10000161 | Ga0207644_1000016123 | 105 |
| 166 | 3300025961 | Ga0207712_10239981 | Ga0207712_102399812 | 105 |
| 167 | 3300025972 | Ga0207668_10000113 | Ga0207668_1000011370 | 105 |
| 168 | 3300025986 | Ga0207658_10443457 | Ga0207658_104434571 | 105 |
| 169 | 3300026088 | Ga0207641_10000036 | Ga0207641_10000036161 | 105 |
| 170 | 3300028379 | Ga0268266_10037677 | Ga0268266_100376772 | 105 |
| 171 | 3300028381 | Ga0268264_10033985 | Ga0268264_100339855 | 105 |
| 172 | 3300031852 | Ga0307410_10479840 | Ga0307410_104798402 | 105 |
| 173 | 3300053116 | Ga0500592_000161 | Ga0500592_000161_4253_4573 | 105 |
| 174 | 3300053134 | Ga0500658_0064022 | Ga0500658_0064022_141_461 | 105 |
| 175 | 3300053151 | Ga0500604_0143431 | Ga0500604_0143431_383_703 | 105 |
| 176 | 3300053158 | Ga0500627_0000092 | Ga0500627_0000092_3617_3937 | 105 |
| 177 | 3300032126 | Ga0307415_101334802 | Ga0307415_1013348022 | 107 |
| 178 | 3300005293 | Ga0065715_10540644 | Ga0065715_105406442 | 108 |
| 179 | 3300005328 | Ga0070676_10289494 | Ga0070676_102894941 | 108 |
| 180 | 3300005335 | Ga0070666_11128694 | Ga0070666_111286941 | 108 |
| 181 | 3300005338 | Ga0068868_100172399 | Ga0068868_1001723993 | 108 |
| 182 | 3300005338 | Ga0068868_100674429 | Ga0068868_1006744292 | 108 |
| 183 | 3300005343 | Ga0070687_100532097 | Ga0070687_1005320972 | 108 |
| 184 | 3300005344 | Ga0070661_100133446 | Ga0070661_1001334463 | 108 |
| 185 | 3300005355 | Ga0070671_100714973 | Ga0070671_1007149732 | 108 |
| 186 | 3300005364 | Ga0070673_100174110 | Ga0070673_1001741101 | 108 |
| 187 | 3300005364 | Ga0070673_101016034 | Ga0070673_1010160342 | 108 |
| 188 | 3300005366 | Ga0070659_101874494 | Ga0070659_1018744942 | 108 |
| 189 | 3300005459 | Ga0068867_100939382 | Ga0068867_1009393821 | 108 |
| 190 | 3300005543 | Ga0070672_100074520 | Ga0070672_1000745203 | 108 |
| 191 | 3300005614 | Ga0068856_102096290 | Ga0068856_1020962902 | 108 |
| 192 | 3300005618 | Ga0068864_100108413 | Ga0068864_1001084133 | 108 |
| 193 | 3300006194 | Ga0075427_10118343 | Ga0075427_101183431 | 108 |
| 194 | 3300006358 | Ga0068871_100362142 | Ga0068871_1003621423 | 108 |
| 195 | 3300006844 | Ga0075428_100067786 | Ga0075428_1000677863 | 108 |
| 196 | 3300009094 | Ga0111539_12853614 | Ga0111539_128536141 | 108 |
| 197 | 3300009147 | Ga0114129_10473673 | Ga0114129_104736734 | 108 |
| 198 | 3300013100 | Ga0157373_10394509 | Ga0157373_103945092 | 108 |
| 199 | 3300013102 | Ga0157371_10274772 | Ga0157371_102747722 | 108 |
| 200 | 3300013296 | Ga0157374_10396418 | Ga0157374_103964182 | 108 |
| 201 | 3300013297 | Ga0157378_10065243 | Ga0157378_100652432 | 108 |
| 202 | 3300013308 | Ga0157375_10625807 | Ga0157375_106258071 | 108 |
| 203 | 3300014326 | Ga0157380_11439019 | Ga0157380_114390192 | 108 |
| 204 | 3300025315 | Ga0207697_10019409 | Ga0207697_100194093 | 108 |
| 205 | 3300025904 | Ga0207647_10046602 | Ga0207647_100466024 | 108 |
| 206 | 3300025919 | Ga0207657_10355395 | Ga0207657_103553951 | 108 |
| 207 | 3300025919 | Ga0207657_10355396 | Ga0207657_103553961 | 108 |
| 208 | 3300025926 | Ga0207659_11176583 | Ga0207659_111765832 | 108 |
| 209 | 3300025931 | Ga0207644_10446459 | Ga0207644_104464593 | 108 |
| 210 | 3300025932 | Ga0207690_10828880 | Ga0207690_108288802 | 108 |
| 211 | 3300025938 | Ga0207704_10246395 | Ga0207704_102463953 | 108 |
| 212 | 3300025940 | Ga0207691_10019116 | Ga0207691_100191169 | 108 |
| 213 | 3300025960 | Ga0207651_10232250 | Ga0207651_102322501 | 108 |
| 214 | 3300025986 | Ga0207658_10500120 | Ga0207658_105001202 | 108 |
| 215 | 3300026023 | Ga0207677_10401621 | Ga0207677_104016212 | 108 |
| 216 | 3300026089 | Ga0207648_11166692 | Ga0207648_111666921 | 108 |
| 217 | 3300026121 | Ga0207683_10033963 | Ga0207683_100339634 | 108 |
| 218 | 3300048906 | Ga0496103_0486956 | Ga0496103_0486956_142_468 | 108 |
| 219 | 3300050507 | nmdc:mga05p37_492913_c1 | nmdc:mga05p37_492913_c1_936_1262 | 108 |
| 220 | 2162886011 | MRS1b_contig_397288 | MRS1b_0409.00001630 | 109 |
| 221 | 2162886012 | MBSR1b_contig_3879354 | MBSR1b_0221.00002510 | 109 |
| 222 | 3300005331 | Ga0070670_100019583 | Ga0070670_1000195832 | 109 |
| 223 | 3300005331 | Ga0070670_100303239 | Ga0070670_1003032392 | 109 |
| 224 | 3300005333 | Ga0070677_10003930 | Ga0070677_100039303 | 109 |
| 225 | 3300005347 | Ga0070668_100029064 | Ga0070668_1000290642 | 109 |
| 226 | 3300005347 | Ga0070668_100038924 | Ga0070668_1000389246 | 109 |
| 227 | 3300005353 | Ga0070669_100034877 | Ga0070669_1000348772 | 109 |
| 228 | 3300005353 | Ga0070669_100544715 | Ga0070669_1005447152 | 109 |
| 229 | 3300005354 | Ga0070675_100003256 | Ga0070675_10000325611 | 109 |
| 230 | 3300005354 | Ga0070675_100540729 | Ga0070675_1005407292 | 109 |
| 231 | 3300005356 | Ga0070674_100296164 | Ga0070674_1002961642 | 109 |
| 232 | 3300005364 | Ga0070673_100598649 | Ga0070673_1005986491 | 109 |
| 233 | 3300005366 | Ga0070659_100069436 | Ga0070659_1000694363 | 109 |
| 234 | 3300005455 | Ga0070663_100684677 | Ga0070663_1006846772 | 109 |
| 235 | 3300005457 | Ga0070662_100003652 | Ga0070662_10000365213 | 109 |
| 236 | 3300005457 | Ga0070662_100501101 | Ga0070662_1005011012 | 109 |
| 237 | 3300005459 | Ga0068867_100691642 | Ga0068867_1006916422 | 109 |
| 238 | 3300005543 | Ga0070672_100890529 | Ga0070672_1008905292 | 109 |
| 239 | 3300005548 | Ga0070665_102129440 | Ga0070665_1021294401 | 109 |
| 240 | 3300005564 | Ga0070664_100189610 | Ga0070664_1001896103 | 109 |
| 241 | 3300005564 | Ga0070664_100442756 | Ga0070664_1004427562 | 109 |
| 242 | 3300005577 | Ga0068857_100135466 | Ga0068857_1001354662 | 109 |
| 243 | 3300005618 | Ga0068864_100119795 | Ga0068864_1001197954 | 109 |
| 244 | 3300005841 | Ga0068863_101870863 | Ga0068863_1018708631 | 109 |
| 245 | 3300005844 | Ga0068862_100662422 | Ga0068862_1006624222 | 109 |
| 246 | 3300006353 | Ga0075370_10585492 | Ga0075370_105854922 | 109 |
| 247 | 3300009148 | Ga0105243_10666986 | Ga0105243_106669862 | 109 |
| 248 | 3300013102 | Ga0157371_10612021 | Ga0157371_106120212 | 109 |
| 249 | 3300014326 | Ga0157380_10026973 | Ga0157380_100269733 | 109 |
| 250 | 3300025893 | Ga0207682_10002276 | Ga0207682_100022767 | 109 |
| 251 | 3300025901 | Ga0207688_10030113 | Ga0207688_100301133 | 109 |
| 252 | 3300025907 | Ga0207645_10096617 | Ga0207645_100966172 | 109 |
| 253 | 3300025921 | Ga0207652_11508207 | Ga0207652_115082072 | 109 |
| 254 | 3300025923 | Ga0207681_10016051 | Ga0207681_100160512 | 109 |
| 255 | 3300025923 | Ga0207681_10745908 | Ga0207681_107459082 | 109 |
| 256 | 3300025923 | Ga0207681_11334889 | Ga0207681_113348892 | 109 |
| 257 | 3300025925 | Ga0207650_10016305 | Ga0207650_100163053 | 109 |
| 258 | 3300025925 | Ga0207650_10122234 | Ga0207650_101222342 | 109 |
| 259 | 3300025926 | Ga0207659_10017358 | Ga0207659_100173586 | 109 |
| 260 | 3300025926 | Ga0207659_10582453 | Ga0207659_105824532 | 109 |
| 261 | 3300025932 | Ga0207690_10142955 | Ga0207690_101429552 | 109 |
| 262 | 3300025933 | Ga0207706_10004099 | Ga0207706_100040993 | 109 |
| 263 | 3300025933 | Ga0207706_10763112 | Ga0207706_107631122 | 109 |
| 264 | 3300025935 | Ga0207709_10319455 | Ga0207709_103194552 | 109 |
| 265 | 3300025937 | Ga0207669_10153578 | Ga0207669_101535782 | 109 |
| 266 | 3300025940 | Ga0207691_10474379 | Ga0207691_104743792 | 109 |
| 267 | 3300025945 | Ga0207679_10068380 | Ga0207679_100683802 | 109 |
| 268 | 3300025945 | Ga0207679_10426729 | Ga0207679_104267292 | 109 |
| 269 | 3300025960 | Ga0207651_10371301 | Ga0207651_103713011 | 109 |
| 270 | 3300025972 | Ga0207668_10008105 | Ga0207668_100081057 | 109 |
| 271 | 3300026088 | Ga0207641_11714924 | Ga0207641_117149242 | 109 |
| 272 | 3300026095 | Ga0207676_10174172 | Ga0207676_101741722 | 109 |
| 273 | 3300026116 | Ga0207674_10062182 | Ga0207674_100621824 | 109 |
| 274 | 3300026121 | Ga0207683_10712933 | Ga0207683_107129332 | 109 |
| 275 | 3300027617 | Ga0210002_1067667 | Ga0210002_10676672 | 109 |
| 276 | 3300027876 | Ga0209974_10089508 | Ga0209974_100895081 | 109 |
| 277 | 3300031548 | Ga0307408_100780584 | Ga0307408_1007805842 | 109 |
| 278 | 3300031731 | Ga0307405_10065577 | Ga0307405_100655772 | 109 |
| 279 | 3300031731 | Ga0307405_11033282 | Ga0307405_110332822 | 109 |
| 280 | 3300031731 | Ga0307405_11196306 | Ga0307405_111963062 | 109 |
| 281 | 3300031824 | Ga0307413_10147756 | Ga0307413_101477562 | 109 |
| 282 | 3300031824 | Ga0307413_10396666 | Ga0307413_103966662 | 109 |
| 283 | 3300031824 | Ga0307413_10483331 | Ga0307413_104833312 | 109 |
| 284 | 3300031852 | Ga0307410_10079307 | Ga0307410_100793072 | 109 |
| 285 | 3300031852 | Ga0307410_10248514 | Ga0307410_102485142 | 109 |
| 286 | 3300031852 | Ga0307410_10302756 | Ga0307410_103027562 | 109 |
| 287 | 3300031852 | Ga0307410_11718190 | Ga0307410_117181902 | 109 |
| 288 | 3300031852 | Ga0307410_11764404 | Ga0307410_117644041 | 109 |
| 289 | 3300031901 | Ga0307406_11229061 | Ga0307406_112290612 | 109 |
| 290 | 3300031903 | Ga0307407_10077944 | Ga0307407_100779442 | 109 |
| 291 | 3300031903 | Ga0307407_10421535 | Ga0307407_104215352 | 109 |
| 292 | 3300031911 | Ga0307412_12245322 | Ga0307412_122453222 | 109 |
| 293 | 3300031995 | Ga0307409_100089885 | Ga0307409_1000898852 | 109 |
| 294 | 3300031995 | Ga0307409_100606711 | Ga0307409_1006067112 | 109 |
| 295 | 3300031995 | Ga0307409_100754334 | Ga0307409_1007543342 | 109 |
| 296 | 3300032002 | Ga0307416_100089983 | Ga0307416_1000899834 | 109 |
| 297 | 3300032002 | Ga0307416_101253629 | Ga0307416_1012536292 | 109 |
| 298 | 3300032002 | Ga0307416_102408901 | Ga0307416_1024089012 | 109 |
| 299 | 3300032004 | Ga0307414_10284374 | Ga0307414_102843742 | 109 |
| 300 | 3300032004 | Ga0307414_11384760 | Ga0307414_113847602 | 109 |
| 301 | 3300032005 | Ga0307411_10146809 | Ga0307411_101468092 | 109 |
| 302 | 3300032005 | Ga0307411_10175215 | Ga0307411_101752152 | 109 |
| 303 | 3300032005 | Ga0307411_10233414 | Ga0307411_102334142 | 109 |
| 304 | 3300032005 | Ga0307411_10258806 | Ga0307411_102588061 | 109 |
| 305 | 3300032005 | Ga0307411_10322939 | Ga0307411_103229392 | 109 |
| 306 | 3300032005 | Ga0307411_10358422 | Ga0307411_103584222 | 109 |
| 307 | 3300032126 | Ga0307415_101509809 | Ga0307415_1015098092 | 109 |
| 308 | 3300041406 | Ga0439439_0108145 | Ga0439439_0108145_57_386 | 109 |
| 309 | 3300041486 | Ga0451807_0286400 | Ga0451807_0286400_48_377 | 109 |
| 310 | 3300041997 | Ga0439431_0205470 | Ga0439431_0205470_190_519 | 109 |
| 311 | 3300042007 | Ga0439449_0020818 | Ga0439449_0020818_799_1128 | 109 |
| 312 | 3300042116 | Ga0450912_004912 | Ga0450912_004912_166_495 | 109 |
| 313 | 3300042118 | Ga0450914_009590 | Ga0450914_009590_333_662 | 109 |
| 314 | 3300042122 | Ga0450920_017592 | Ga0450920_017592_237_566 | 109 |
| 315 | 3300048905 | Ga0496102_0595067 | Ga0496102_0595067_609_938 | 109 |
| 316 | 3300048908 | Ga0496105_1399251 | Ga0496105_1399251_115_444 | 109 |
| 317 | 3300048911 | Ga0496108_0363207 | Ga0496108_0363207_608_937 | 109 |
| 318 | 3300048912 | Ga0496109_0099006 | Ga0496109_0099006_270_599 | 109 |
| 319 | 3300048913 | Ga0496110_0093960 | Ga0496110_0093960_1782_2111 | 109 |
| 320 | 3300049572 | Ga0501036_1215269 | Ga0501036_1215269_232_561 | 109 |
| 321 | 3300049582 | Ga0501048_0960059 | Ga0501048_0960059_70_399 | 109 |
| 322 | 3300049587 | Ga0501071_0768283 | Ga0501071_0768283_118_447 | 109 |
| 323 | 3300050496 | nmdc:mga07m45_743454_c1 | nmdc:mga07m45_743454_c1_103_432 | 109 |
| 324 | 3300059421 | Ga0590071_032265 | Ga0590071_032265_316_645 | 109 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ah6-assembly2.cif.gz_F | remarkable improvement of the heat stability of cuta1 from e.coli by rational protein designing | 0.9749 | 1 | 103 |
| 4y6i-assembly1.cif.gz_B | crystal structure of e.coli cuta1 e61v/c16a/c39a/c79a mutation | 0.9717 | 1 | 102 |
| 1p1l-assembly1.cif.gz_A | structure of the periplasmic divalent cation tolerance protein cuta from archaeoglobus fulgidus | 0.9716 | 3 | 104 |
| 3aa8-assembly1.cif.gz_C | crystal structure analysis of the mutant cuta1 (s11v/e61v) from e. coli | 0.9705 | 3 | 103 |
| 4y65-assembly1.cif.gz_A | crystal structure of e.coli cuta1 c16a/c39a/c79a mutation | 0.9698 | 1 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P69488_1_112_3.30.70.120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9735 | 1 | 104 | 3.30.70.120 |
| af_Q7T3C3_31_149_3.30.70.120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9719 | 2 | 105 | 3.30.70.120 |
| 1p1lA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9716 | 3 | 104 | 3.30.70.120 |
| af_Q8I4T9_34_158_3.30.70.120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9647 | 3 | 105 | 3.30.70.120 |
| 3ahpA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9645 | 3 | 102 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A841FVZ1-F1-model_v4 | deleted | 0.9938 | 3 | 102 |
|
| AF-A0A520YIJ8-F1-model_v4 | Divalent-cation tolerance protein CutA | 0.9878 | 1 | 105 |
GO:0005507
GO:0010038 |
| AF-A0A7C7DPV7-F1-model_v4 | Divalent-cation tolerance protein CutA | 0.9867 | 9 | 102 |
GO:0005507
GO:0010038 |
| AF-A0A351SL13-F1-model_v4 | Divalent-cation tolerance protein CutA | 0.9844 | 2 | 104 |
GO:0005507
GO:0010038 |
| AF-A0A3B1BCF7-F1-model_v4 | Periplasmic divalent cation tolerance protein cutA | 0.9827 | 2 | 105 |
GO:0005507
GO:0010038 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar