F407349

General Info

Members Datasets Scaffolds Average Seq Length
324 167 648 121

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10387165|Ga0105242_103871651
Length 134
Sequence MMLDPWSSRHGCYTDKVMHPNLTSLERVDELDRLIVESQAQPVLLFKHSYTCGISAEALDELISHLNEDYVDVRYAIVTVQTHREVSNAVSTKLGVRHETPQALLVRGGRVVWSASHFRVNAEELNKALRANVR

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
139 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
143 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.31
Rhizosphere 99.07
Stem 0
Stem Tuber 0
Unclassified 18.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10387165 3300009176 Bacteria 1301
2 JGI25406J46586_10004365 3300003203 Bacteria 6597
3 JGI25406J46586_10227683 3300003203 Unclassified 546
4 Ga0065704_10256591 3300005289 Bacteria 976
5 Ga0065712_10541218 3300005290 Bacteria 623
6 Ga0065707_10168693 3300005295 Bacteria 1501
7 Ga0065707_10176060 3300005295 Unclassified 1450
8 Ga0070658_10156753 3300005327 Bacteria 1909
9 Ga0070658_11979843 3300005327 Unclassified 503
10 Ga0070676_10004049 3300005328 Bacteria 7699
11 Ga0070683_101489802 3300005329 Unclassified 650
12 Ga0070690_100002496 3300005330 Bacteria 9895
13 Ga0070670_100000578 3300005331 Bacteria 28992
14 Ga0070670_100064361 3300005331 Bacteria 3146
15 Ga0070670_100244881 3300005331 Bacteria 1561
16 Ga0070670_100718990 3300005331 Bacteria 899
17 Ga0070670_100854876 3300005331 Bacteria 823
18 Ga0070670_100865173 3300005331 Bacteria 818
19 Ga0070677_10129538 3300005333 Bacteria 1150
20 Ga0070677_10822469 3300005333 Unclassified 532
21 Ga0068869_100019379 3300005334 Bacteria 4647
22 Ga0070680_100563248 3300005336 Unclassified 977
23 Ga0070660_100713286 3300005339 Bacteria 841
24 Ga0070660_100992916 3300005339 Archaea 709
25 Ga0070660_101731903 3300005339 Unclassified 532
26 Ga0070689_100049136 3300005340 Bacteria 3256
27 Ga0070689_100242152 3300005340 Bacteria 1486
28 Ga0070687_100012541 3300005343 Bacteria 3746
29 Ga0070687_101200938 3300005343 Unclassified 559
30 Ga0070661_100035556 3300005344 Unclassified 3618
31 Ga0070661_100439240 3300005344 Archaea 1037
32 Ga0070692_10306956 3300005345 Bacteria 971
33 Ga0070668_100144195 3300005347 Bacteria 1921
34 Ga0070669_100023102 3300005353 Bacteria 4451
35 Ga0070669_100071195 3300005353 Unclassified 2572
36 Ga0070669_100073873 3300005353 Bacteria 2527
37 Ga0070669_100526573 3300005353 Bacteria 983
38 Ga0070669_100708711 3300005353 Unclassified 850
39 Ga0070675_100018356 3300005354 Bacteria 5566
40 Ga0070675_100020484 3300005354 Bacteria 5276
41 Ga0070675_100021320 3300005354 Bacteria 5176
42 Ga0070675_100195375 3300005354 Bacteria 1755
43 Ga0070675_100258658 3300005354 Bacteria 1525
44 Ga0070675_100288753 3300005354 Bacteria 1443
45 Ga0070675_100427371 3300005354 Bacteria 1185
46 Ga0070675_101898988 3300005354 Bacteria 549
47 Ga0070671_100369908 3300005355 Bacteria 1224
48 Ga0070671_100623970 3300005355 Bacteria 932
49 Ga0070671_101266664 3300005355 Bacteria 650
50 Ga0070674_100563647 3300005356 Unclassified 957
51 Ga0070674_101034755 3300005356 Bacteria 722
52 Ga0070674_101701489 3300005356 Unclassified 570
53 Ga0070673_100000860 3300005364 Bacteria 17044
54 Ga0070673_100875051 3300005364 Bacteria 832
55 Ga0070673_101042541 3300005364 Unclassified 763
56 Ga0070673_101104260 3300005364 Bacteria 741
57 Ga0070688_100319490 3300005365 Unclassified 1128
58 Ga0070688_100766742 3300005365 Unclassified 752
59 Ga0070688_101548893 3300005365 Bacteria 540
60 Ga0070659_100028365 3300005366 Bacteria 4322
61 Ga0070667_100027828 3300005367 Bacteria 4705
62 Ga0070667_100871372 3300005367 Bacteria 837
63 Ga0070701_10279735 3300005438 Bacteria 1018
64 Ga0070705_100275613 3300005440 Unclassified 1193
65 Ga0070700_100080792 3300005441 Bacteria 2099
66 Ga0070700_100343421 3300005441 Bacteria 1104
67 Ga0070700_100573020 3300005441 Unclassified 880
68 Ga0070700_101482101 3300005441 Bacteria 576
69 Ga0070694_100029058 3300005444 Bacteria 3605
70 Ga0070708_100266589 3300005445 Bacteria 1610
71 Ga0070663_100073491 3300005455 Bacteria 2494
72 Ga0070678_100100894 3300005456 Bacteria 2237
73 Ga0068867_100370661 3300005459 Bacteria 1200
74 Ga0068867_101931853 3300005459 Bacteria 557
75 Ga0070685_10084286 3300005466 Bacteria 1911
76 Ga0070706_100632261 3300005467 Unclassified 994
77 Ga0070698_100356730 3300005471 Bacteria 1394
78 Ga0070699_100028979 3300005518 Bacteria 4773
79 Ga0070699_100089140 3300005518 Bacteria 2695
80 Ga0070684_100408868 3300005535 Bacteria 1252
81 Ga0068853_101416516 3300005539 Bacteria 672
82 Ga0070672_100007870 3300005543 Bacteria 7275
83 Ga0070672_100053616 3300005543 Bacteria 3153
84 Ga0070672_101016413 3300005543 Unclassified 735
85 Ga0070686_100004981 3300005544 Bacteria 7328
86 Ga0070686_100012554 3300005544 Bacteria 4827
87 Ga0070704_100296228 3300005549 Bacteria 1346
88 Ga0070704_100362907 3300005549 Bacteria 1226
89 Ga0070664_100033615 3300005564 Bacteria 4297
90 Ga0070664_100105760 3300005564 Bacteria 2451
91 Ga0070664_100254484 3300005564 Bacteria 1579
92 Ga0070664_100324939 3300005564 Bacteria 1395
93 Ga0070664_101386466 3300005564 Bacteria 664
94 Ga0068857_100629120 3300005577 Unclassified 1016
95 Ga0070702_100039899 3300005615 Bacteria 2623
96 Ga0068852_102811948 3300005616 Unclassified 505
97 Ga0068859_100055689 3300005617 Bacteria 3978
98 Ga0068859_100089826 3300005617 Bacteria 3123
99 Ga0068864_100042456 3300005618 Bacteria 3891
100 Ga0068864_100083086 3300005618 Bacteria 2812
101 Ga0068864_100252740 3300005618 Bacteria 1637
102 Ga0068866_10008552 3300005718 Bacteria 4319
103 Ga0068861_100276353 3300005719 Bacteria 1444
104 Ga0068861_101353893 3300005719 Bacteria 694
105 Ga0068861_101414495 3300005719 Bacteria 680
106 Ga0068870_10247996 3300005840 Bacteria 1103
107 Ga0068863_100610612 3300005841 Bacteria 1080
108 Ga0068863_100970381 3300005841 Bacteria 852
109 Ga0068858_100006546 3300005842 Bacteria 11329
110 Ga0068860_100106204 3300005843 Bacteria 2682
111 Ga0068860_100305579 3300005843 Bacteria 1559
112 Ga0068862_100819153 3300005844 Bacteria 910
113 Ga0068862_101906888 3300005844 Bacteria 604
114 Ga0081539_10000084 3300005985 Bacteria 218801
115 Ga0081539_10076029 3300005985 Bacteria 1781
116 Ga0075432_10360654 3300006058 Unclassified 618
117 Ga0097621_100531408 3300006237 Bacteria 1069
118 Ga0075428_100002201 3300006844 Bacteria 21094
119 Ga0075428_101127618 3300006844 Unclassified 828
120 Ga0075431_100039707 3300006847 Bacteria 4849
121 Ga0075433_10969561 3300006852 Unclassified 741
122 Ga0075429_100008226 3300006880 Bacteria 9068
123 Ga0068865_100026115 3300006881 Bacteria 3848
124 Ga0097620_100055688 3300006931 Bacteria 3978
125 Ga0097620_100089827 3300006931 Bacteria 3123
126 Ga0111539_10000155 3300009094 Bacteria 78151
127 Ga0111539_10006949 3300009094 Bacteria 14527
128 Ga0111539_10650871 3300009094 Bacteria 1227
129 Ga0111539_10832053 3300009094 Bacteria 1074
130 Ga0111539_12505904 3300009094 Bacteria 598
131 Ga0111539_13174244 3300009094 Unclassified 530
132 Ga0114129_10087891 3300009147 Unclassified 4310
133 Ga0105243_10100148 3300009148 Bacteria 2404
134 Ga0105242_10003700 3300009176 Bacteria 11902
135 Ga0105248_10552256 3300009177 Bacteria 1299
136 Ga0105248_12081717 3300009177 Bacteria 645
137 Ga0105238_10005325 3300009551 Bacteria 12714
138 Ga0105249_10364114 3300009553 Bacteria 1468
139 Ga0105249_11332854 3300009553 Bacteria 789
140 Ga0105249_13158857 3300009553 Bacteria 529
141 Ga0105246_10158858 3300011119 Bacteria 1720
142 Ga0157374_10218433 3300013296 Bacteria 1870
143 Ga0157378_10714316 3300013297 Bacteria 1022
144 Ga0163162_10221268 3300013306 Bacteria 2023
145 Ga0163162_11555534 3300013306 Bacteria 754
146 Ga0163162_11682831 3300013306 Unclassified 724
147 Ga0157372_10910094 3300013307 Bacteria 1020
148 Ga0157375_10409074 3300013308 Bacteria 1523
149 Ga0157375_10455716 3300013308 Unclassified 1444
150 Ga0157375_11400422 3300013308 Bacteria 824
151 Ga0157375_12161857 3300013308 Bacteria 663
152 Ga0163163_10015450 3300014325 Bacteria 7059
153 Ga0163163_10041642 3300014325 Bacteria 4493
154 Ga0163163_10075085 3300014325 Unclassified 3374
155 Ga0157380_10191918 3300014326 Bacteria 1804
156 Ga0157380_10344673 3300014326 Bacteria 1391
157 Ga0157380_10517111 3300014326 Unclassified 1163
158 Ga0157380_10577551 3300014326 Bacteria 1108
159 Ga0157377_10032651 3300014745 Bacteria 2836
160 Ga0157377_10388455 3300014745 Bacteria 947
161 Ga0157379_12130155 3300014968 Bacteria 556
162 Ga0157376_10038279 3300014969 Bacteria 3901
163 Ga0157376_10473417 3300014969 Unclassified 1226
164 Ga0157376_11262865 3300014969 Bacteria 768
165 Ga0157376_12033198 3300014969 Unclassified 612
166 Ga0207697_10147678 3300025315 Bacteria 1022
167 Ga0207682_10104633 3300025893 Bacteria 1240
168 Ga0207682_10269038 3300025893 Unclassified 795
169 Ga0207688_10259614 3300025901 Bacteria 1054
170 Ga0207645_10006714 3300025907 Bacteria 8225
171 Ga0207643_10096990 3300025908 Bacteria 1725
172 Ga0207643_10174047 3300025908 Bacteria 1300
173 Ga0207705_10232136 3300025909 Bacteria 1404
174 Ga0207705_10299112 3300025909 Bacteria 1234
175 Ga0207662_10013184 3300025918 Bacteria 4620
176 Ga0207662_10271077 3300025918 Bacteria 1120
177 Ga0207662_10618334 3300025918 Bacteria 755
178 Ga0207649_10284689 3300025920 Unclassified 1203
179 Ga0207681_10038418 3300025923 Bacteria 3172
180 Ga0207681_10162226 3300025923 Unclassified 1686
181 Ga0207681_10361514 3300025923 Unclassified 1164
182 Ga0207681_10487726 3300025923 Bacteria 1007
183 Ga0207681_10602464 3300025923 Bacteria 908
184 Ga0207650_10004680 3300025925 Bacteria 9351
185 Ga0207650_10140927 3300025925 Bacteria 1895
186 Ga0207650_10694083 3300025925 Bacteria 860
187 Ga0207650_11830691 3300025925 Bacteria 513
188 Ga0207659_10012240 3300025926 Bacteria 5448
189 Ga0207659_10015946 3300025926 Bacteria 4882
190 Ga0207659_10024191 3300025926 Bacteria 4066
191 Ga0207659_10051614 3300025926 Bacteria 2926
192 Ga0207659_10167859 3300025926 Bacteria 1729
193 Ga0207659_11736003 3300025926 Bacteria 531
194 Ga0207644_10039959 3300025931 Bacteria 3313
195 Ga0207644_10715757 3300025931 Bacteria 835
196 Ga0207644_10745218 3300025931 Unclassified 818
197 Ga0207686_10006591 3300025934 Bacteria 6255
198 Ga0207709_10126583 3300025935 Bacteria 1734
199 Ga0207670_10004509 3300025936 Bacteria 7504
200 Ga0207670_10354417 3300025936 Bacteria 1163
201 Ga0207669_11208453 3300025937 Unclassified 640
202 Ga0207704_10013031 3300025938 Bacteria 4146
203 Ga0207691_10035560 3300025940 Bacteria 4622
204 Ga0207691_10036740 3300025940 Bacteria 4538
205 Ga0207711_11994189 3300025941 Unclassified 523
206 Ga0207689_10004883 3300025942 Bacteria 12089
207 Ga0207679_10019928 3300025945 Unclassified 4518
208 Ga0207679_10032393 3300025945 Bacteria 3668
209 Ga0207679_10219940 3300025945 Bacteria 1597
210 Ga0207679_11012398 3300025945 Unclassified 761
211 Ga0207651_10045521 3300025960 Bacteria 2944
212 Ga0207651_10058940 3300025960 Bacteria 2656
213 Ga0207651_10061120 3300025960 Bacteria 2618
214 Ga0207651_11533913 3300025960 Bacteria 600
215 Ga0207651_12112133 3300025960 Unclassified 506
216 Ga0207668_10279964 3300025972 Bacteria 1367
217 Ga0207677_10315516 3300026023 Bacteria 1297
218 Ga0207677_10357665 3300026023 Bacteria 1225
219 Ga0207703_10012464 3300026035 Bacteria 6629
220 Ga0207703_10055913 3300026035 Bacteria 3212
221 Ga0207708_10001439 3300026075 Bacteria 17827
222 Ga0207708_10228077 3300026075 Bacteria 1494
223 Ga0207708_10402030 3300026075 Bacteria 1133
224 Ga0207708_11392157 3300026075 Bacteria 615
225 Ga0207641_10016127 3300026088 Bacteria 6119
226 Ga0207641_10237783 3300026088 Bacteria 1696
227 Ga0207641_12031335 3300026088 Unclassified 576
228 Ga0207648_10004496 3300026089 Bacteria 14295
229 Ga0207648_10205836 3300026089 Bacteria 1746
230 Ga0207648_11863438 3300026089 Bacteria 563
231 Ga0207648_12089008 3300026089 Bacteria 527
232 Ga0207676_10188403 3300026095 Bacteria 1813
233 Ga0207674_10084254 3300026116 Bacteria 3177
234 Ga0207675_100069159 3300026118 Bacteria 3300
235 Ga0207675_100263581 3300026118 Bacteria 1671
236 Ga0207675_100498627 3300026118 Bacteria 1212
237 Ga0207683_11337570 3300026121 Unclassified 663
238 Ga0207698_10885329 3300026142 Unclassified 899
239 Ga0209998_10115141 3300027717 Bacteria 674
240 Ga0207428_10002409 3300027907 Bacteria 18665
241 Ga0207428_10176091 3300027907 Bacteria 1618
242 Ga0268265_10073047 3300028380 Bacteria 2678
243 Ga0268265_10746198 3300028380 Unclassified 950
244 Ga0268265_10985042 3300028380 Bacteria 832
245 Ga0268265_12147955 3300028380 Bacteria 565
246 Ga0268264_10114737 3300028381 Bacteria 2365
247 Ga0307408_100642550 3300031548 Bacteria 948
248 Ga0307408_101068381 3300031548 Unclassified 747
249 Ga0307408_101435696 3300031548 Unclassified 651
250 Ga0307405_10011969 3300031731 Bacteria 4570
251 Ga0307405_10097638 3300031731 Bacteria 1962
252 Ga0307405_10336502 3300031731 Bacteria 1159
253 Ga0307413_10031841 3300031824 Bacteria 2981
254 Ga0307413_10995233 3300031824 Bacteria 718
255 Ga0307410_10046443 3300031852 Bacteria 2897
256 Ga0307410_10063408 3300031852 Bacteria 2535
257 Ga0307410_10703142 3300031852 Unclassified 852
258 Ga0307406_10002072 3300031901 Bacteria 10948
259 Ga0307407_10053173 3300031903 Bacteria 2329
260 Ga0307412_10021008 3300031911 Bacteria 3982
261 Ga0307412_10568972 3300031911 Unclassified 955
262 Ga0307409_100027527 3300031995 Bacteria 4030
263 Ga0307409_100095640 3300031995 Bacteria 2448
264 Ga0307409_101352301 3300031995 Bacteria 738
265 Ga0307409_102748552 3300031995 Unclassified 520
266 Ga0307416_100133652 3300032002 Bacteria 2239
267 Ga0307416_100134063 3300032002 Bacteria 2236
268 Ga0307416_100464918 3300032002 Bacteria 1321
269 Ga0307416_100576614 3300032002 Bacteria 1202
270 Ga0307414_10072636 3300032004 Bacteria 2486
271 Ga0307414_10448595 3300032004 Unclassified 1131
272 Ga0307411_10014475 3300032005 Bacteria 4391
273 Ga0307411_10018754 3300032005 Bacteria 3979
274 Ga0307411_10093657 3300032005 Bacteria 2104
275 Ga0307411_10270051 3300032005 Bacteria 1348
276 Ga0307415_100040105 3300032126 Bacteria 3100
277 Ga0439439_0085047 3300041406 Bacteria 859
278 Ga0451807_1909578 3300041486 Bacteria 748
279 Ga0451847_0450439 3300041503 Bacteria 575
280 Ga0451853_0262664 3300041512 Bacteria 1068
281 Ga0439449_0314249 3300042007 Unclassified 592
282 Ga0439457_035328 3300042014 Bacteria 1112
283 Ga0450896_065573 3300042133 Bacteria 596
284 Ga0439446_0161172 3300042156 Bacteria 742
285 Ga0439434_0064183 3300042435 Bacteria 1151
286 Ga0439434_0293321 3300042435 Bacteria 561
287 Ga0439444_0043533 3300042437 Bacteria 890
288 Ga0450918_108483 3300042531 Bacteria 548
289 Ga0451576_1063825 3300045051 Bacteria 847
290 Ga0451576_2397145 3300045051 Unclassified 540
291 Ga0495603_0047943 3300046455 Bacteria 2544
292 Ga0495603_0427869 3300046455 Bacteria 758
293 Ga0495585_0123254 3300046492 Bacteria 1370
294 Ga0495594_0327544 3300046499 Bacteria 872
295 Ga0495643_0015418 3300046522 Bacteria 4517
296 Ga0495621_0211551 3300046539 Unclassified 782
297 Ga0495621_0219837 3300046539 Bacteria 769
298 Ga0495588_0139925 3300046674 Bacteria 1278
299 Ga0495658_0275484 3300046683 Bacteria 1061
300 Ga0495670_0092277 3300046691 Bacteria 1551
301 Ga0495681_0195554 3300047470 Bacteria 823
302 Ga0495614_0430917 3300048089 Bacteria 622
303 Ga0501074_0418307 3300049590 Bacteria 951
304 Ga0501217_227511 3300049661 Bacteria 592
305 Ga0501079_1571358 3300049741 Bacteria 517
306 Ga0501283_135253 3300049779 Bacteria 503
307 nmdc:mga05p37_106677_c1 3300050507 Bacteria 3446
308 nmdc:mga05p37_777428_c1 3300050507 Unclassified 1051
309 nmdc:mga09592_1358452_c1 3300050508 Archaea 582
310 nmdc:mga09592_215879_c1 3300050508 Bacteria 1662
311 nmdc:mga08y16_127935_c1 3300050511 Bacteria 2642
312 nmdc:mga08y16_498_c1 3300050511 Bacteria 36164
313 nmdc:mga08y16_634723_c1 3300050511 Bacteria 1074
314 nmdc:mga08y16_980345_c1 3300050511 Bacteria 826
315 nmdc:mga0n895_1398987_c1 3300050512 Unclassified 668
316 nmdc:mga0a205_258737_c1 3300050515 Unclassified 887
317 nmdc:mga0a205_543845_c1 3300050515 Bacteria 1017
318 Ga0590071_000780 3300059421 Bacteria 8923
319 Ga0590074_016416 3300059423 Bacteria 1260
320 Ga0590075_016054 3300059424 Bacteria 1840
321 Ga0590075_059341 3300059424 Bacteria 985
322 Ga0590075_087528 3300059424 Unclassified 808
323 Ga0590077_000227 3300059426 Bacteria 16234
324 Ga0590077_090081 3300059426 Bacteria 711
325 Ga0105242_10387165
326 JGI25406J46586_10004365
327 JGI25406J46586_10227683
328 Ga0065704_10256591
329 Ga0065712_10541218
330 Ga0065707_10168693
331 Ga0065707_10176060
332 Ga0070658_10156753
333 Ga0070658_11979843
334 Ga0070676_10004049
335 Ga0070683_101489802
336 Ga0070690_100002496
337 Ga0070670_100000578
338 Ga0070670_100064361
339 Ga0070670_100244881
340 Ga0070670_100718990
341 Ga0070670_100854876
342 Ga0070670_100865173
343 Ga0070677_10129538
344 Ga0070677_10822469
345 Ga0068869_100019379
346 Ga0070680_100563248
347 Ga0070660_100713286
348 Ga0070660_100992916
349 Ga0070660_101731903
350 Ga0070689_100049136
351 Ga0070689_100242152
352 Ga0070687_100012541
353 Ga0070687_101200938
354 Ga0070661_100035556
355 Ga0070661_100439240
356 Ga0070692_10306956
357 Ga0070668_100144195
358 Ga0070669_100023102
359 Ga0070669_100071195
360 Ga0070669_100073873
361 Ga0070669_100526573
362 Ga0070669_100708711
363 Ga0070675_100018356
364 Ga0070675_100020484
365 Ga0070675_100021320
366 Ga0070675_100195375
367 Ga0070675_100258658
368 Ga0070675_100288753
369 Ga0070675_100427371
370 Ga0070675_101898988
371 Ga0070671_100369908
372 Ga0070671_100623970
373 Ga0070671_101266664
374 Ga0070674_100563647
375 Ga0070674_101034755
376 Ga0070674_101701489
377 Ga0070673_100000860
378 Ga0070673_100875051
379 Ga0070673_101042541
380 Ga0070673_101104260
381 Ga0070688_100319490
382 Ga0070688_100766742
383 Ga0070688_101548893
384 Ga0070659_100028365
385 Ga0070667_100027828
386 Ga0070667_100871372
387 Ga0070701_10279735
388 Ga0070705_100275613
389 Ga0070700_100080792
390 Ga0070700_100343421
391 Ga0070700_100573020
392 Ga0070700_101482101
393 Ga0070694_100029058
394 Ga0070708_100266589
395 Ga0070663_100073491
396 Ga0070678_100100894
397 Ga0068867_100370661
398 Ga0068867_101931853
399 Ga0070685_10084286
400 Ga0070706_100632261
401 Ga0070698_100356730
402 Ga0070699_100028979
403 Ga0070699_100089140
404 Ga0070684_100408868
405 Ga0068853_101416516
406 Ga0070672_100007870
407 Ga0070672_100053616
408 Ga0070672_101016413
409 Ga0070686_100004981
410 Ga0070686_100012554
411 Ga0070704_100296228
412 Ga0070704_100362907
413 Ga0070664_100033615
414 Ga0070664_100105760
415 Ga0070664_100254484
416 Ga0070664_100324939
417 Ga0070664_101386466
418 Ga0068857_100629120
419 Ga0070702_100039899
420 Ga0068852_102811948
421 Ga0068859_100055689
422 Ga0068859_100089826
423 Ga0068864_100042456
424 Ga0068864_100083086
425 Ga0068864_100252740
426 Ga0068866_10008552
427 Ga0068861_100276353
428 Ga0068861_101353893
429 Ga0068861_101414495
430 Ga0068870_10247996
431 Ga0068863_100610612
432 Ga0068863_100970381
433 Ga0068858_100006546
434 Ga0068860_100106204
435 Ga0068860_100305579
436 Ga0068862_100819153
437 Ga0068862_101906888
438 Ga0081539_10000084
439 Ga0081539_10076029
440 Ga0075432_10360654
441 Ga0097621_100531408
442 Ga0075428_100002201
443 Ga0075428_101127618
444 Ga0075431_100039707
445 Ga0075433_10969561
446 Ga0075429_100008226
447 Ga0068865_100026115
448 Ga0097620_100055688
449 Ga0097620_100089827
450 Ga0111539_10000155
451 Ga0111539_10006949
452 Ga0111539_10650871
453 Ga0111539_10832053
454 Ga0111539_12505904
455 Ga0111539_13174244
456 Ga0114129_10087891
457 Ga0105243_10100148
458 Ga0105242_10003700
459 Ga0105248_10552256
460 Ga0105248_12081717
461 Ga0105238_10005325
462 Ga0105249_10364114
463 Ga0105249_11332854
464 Ga0105249_13158857
465 Ga0105246_10158858
466 Ga0157374_10218433
467 Ga0157378_10714316
468 Ga0163162_10221268
469 Ga0163162_11555534
470 Ga0163162_11682831
471 Ga0157372_10910094
472 Ga0157375_10409074
473 Ga0157375_10455716
474 Ga0157375_11400422
475 Ga0157375_12161857
476 Ga0163163_10015450
477 Ga0163163_10041642
478 Ga0163163_10075085
479 Ga0157380_10191918
480 Ga0157380_10344673
481 Ga0157380_10517111
482 Ga0157380_10577551
483 Ga0157377_10032651
484 Ga0157377_10388455
485 Ga0157379_12130155
486 Ga0157376_10038279
487 Ga0157376_10473417
488 Ga0157376_11262865
489 Ga0157376_12033198
490 Ga0207697_10147678
491 Ga0207682_10104633
492 Ga0207682_10269038
493 Ga0207688_10259614
494 Ga0207645_10006714
495 Ga0207643_10096990
496 Ga0207643_10174047
497 Ga0207705_10232136
498 Ga0207705_10299112
499 Ga0207662_10013184
500 Ga0207662_10271077
501 Ga0207662_10618334
502 Ga0207649_10284689
503 Ga0207681_10038418
504 Ga0207681_10162226
505 Ga0207681_10361514
506 Ga0207681_10487726
507 Ga0207681_10602464
508 Ga0207650_10004680
509 Ga0207650_10140927
510 Ga0207650_10694083
511 Ga0207650_11830691
512 Ga0207659_10012240
513 Ga0207659_10015946
514 Ga0207659_10024191
515 Ga0207659_10051614
516 Ga0207659_10167859
517 Ga0207659_11736003
518 Ga0207644_10039959
519 Ga0207644_10715757
520 Ga0207644_10745218
521 Ga0207686_10006591
522 Ga0207709_10126583
523 Ga0207670_10004509
524 Ga0207670_10354417
525 Ga0207669_11208453
526 Ga0207704_10013031
527 Ga0207691_10035560
528 Ga0207691_10036740
529 Ga0207711_11994189
530 Ga0207689_10004883
531 Ga0207679_10019928
532 Ga0207679_10032393
533 Ga0207679_10219940
534 Ga0207679_11012398
535 Ga0207651_10045521
536 Ga0207651_10058940
537 Ga0207651_10061120
538 Ga0207651_11533913
539 Ga0207651_12112133
540 Ga0207668_10279964
541 Ga0207677_10315516
542 Ga0207677_10357665
543 Ga0207703_10012464
544 Ga0207703_10055913
545 Ga0207708_10001439
546 Ga0207708_10228077
547 Ga0207708_10402030
548 Ga0207708_11392157
549 Ga0207641_10016127
550 Ga0207641_10237783
551 Ga0207641_12031335
552 Ga0207648_10004496
553 Ga0207648_10205836
554 Ga0207648_11863438
555 Ga0207648_12089008
556 Ga0207676_10188403
557 Ga0207674_10084254
558 Ga0207675_100069159
559 Ga0207675_100263581
560 Ga0207675_100498627
561 Ga0207683_11337570
562 Ga0207698_10885329
563 Ga0209998_10115141
564 Ga0207428_10002409
565 Ga0207428_10176091
566 Ga0268265_10073047
567 Ga0268265_10746198
568 Ga0268265_10985042
569 Ga0268265_12147955
570 Ga0268264_10114737
571 Ga0307408_100642550
572 Ga0307408_101068381
573 Ga0307408_101435696
574 Ga0307405_10011969
575 Ga0307405_10097638
576 Ga0307405_10336502
577 Ga0307413_10031841
578 Ga0307413_10995233
579 Ga0307410_10046443
580 Ga0307410_10063408
581 Ga0307410_10703142
582 Ga0307406_10002072
583 Ga0307407_10053173
584 Ga0307412_10021008
585 Ga0307412_10568972
586 Ga0307409_100027527
587 Ga0307409_100095640
588 Ga0307409_101352301
589 Ga0307409_102748552
590 Ga0307416_100133652
591 Ga0307416_100134063
592 Ga0307416_100464918
593 Ga0307416_100576614
594 Ga0307414_10072636
595 Ga0307414_10448595
596 Ga0307411_10014475
597 Ga0307411_10018754
598 Ga0307411_10093657
599 Ga0307411_10270051
600 Ga0307415_100040105
601 Ga0439439_0085047
602 Ga0451807_1909578
603 Ga0451847_0450439
604 Ga0451853_0262664
605 Ga0439449_0314249
606 Ga0439457_035328
607 Ga0450896_065573
608 Ga0439446_0161172
609 Ga0439434_0064183
610 Ga0439434_0293321
611 Ga0439444_0043533
612 Ga0450918_108483
613 Ga0451576_1063825
614 Ga0451576_2397145
615 Ga0495603_0047943
616 Ga0495603_0427869
617 Ga0495585_0123254
618 Ga0495594_0327544
619 Ga0495643_0015418
620 Ga0495621_0211551
621 Ga0495621_0219837
622 Ga0495588_0139925
623 Ga0495658_0275484
624 Ga0495670_0092277
625 Ga0495681_0195554
626 Ga0495614_0430917
627 Ga0501074_0418307
628 Ga0501217_227511
629 Ga0501079_1571358
630 Ga0501283_135253
631 nmdc:mga05p37_106677_c1
632 nmdc:mga05p37_777428_c1
633 nmdc:mga09592_1358452_c1
634 nmdc:mga09592_215879_c1
635 nmdc:mga08y16_127935_c1
636 nmdc:mga08y16_498_c1
637 nmdc:mga08y16_634723_c1
638 nmdc:mga08y16_980345_c1
639 nmdc:mga0n895_1398987_c1
640 nmdc:mga0a205_258737_c1
641 nmdc:mga0a205_543845_c1
642 Ga0590071_000780
643 Ga0590074_016416
644 Ga0590075_016054
645 Ga0590075_059341
646 Ga0590075_087528
647 Ga0590077_000227
648 Ga0590077_090081

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11009

BrxC

Monothiol bacilliredoxin BrxC

23

125

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iv4-assembly1.cif.gz_A a putative oxidoreductase with a thioredoxin fold 0.87 4 116
6iev-assembly1.cif.gz_C crystal structure of a designed protein 0.8267 3 119
4tn8-assembly1.cif.gz_A crystal structure of thermus thermophilus thioredoxin solved by sulfur sad using swiss light source data 0.8098 5 119
3iv4-assembly1.cif.gz_A a putative oxidoreductase with a thioredoxin fold 0.8061 4 116
5j7d-assembly7.cif.gz_G computationally designed thioredoxin df106 0.8018 5 104
ID Description Score Start End Superfamily
af_Q2G066_1_106_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8751 5 116 3.40.30.10
af_Q2G066_1_106_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8447 5 116 3.40.30.10
af_Q6NM39_19_120_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.826 8 118 3.40.30.10
af_Q2FV89_2_105_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8047 6 119 3.40.30.10
af_I1NE04_569_675_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8016 5 119 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A800M488-F1-model_v4 Bacillithiol system redox-active protein YtxJ 0.9131 2 116
AF-A0A348Y1M4-F1-model_v4 deleted 0.9085 4 119
AF-A0A7V9QQS0-F1-model_v4 Bacillithiol system redox-active protein YtxJ 0.9023 3 117
AF-A0A4P5YJ88-F1-model_v4 Bacillithiol system redox-active protein YtxJ 0.8977 5 119
AF-A0A1V5ZR95-F1-model_v4 Bacillithiol system protein YtxJ 0.8974 6 119

Map