F407347

General Info

Members Datasets Scaffolds Average Seq Length
324 198 648 284

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10019310|Ga0105242_100193105
Length 302
Sequence LYNKRKYPFFRLELVKPYFADMFQRLVVAIAFLIPAMTFAQNAIVQEGEFGVGLGASHYFGDLNTRAKLNRPKIAASMFFRKNFGNYIALRLGASYARVGYSDVYNNYNEYMYRRNLSFNSNIWELALQGDFNFFKFLPGEPGYNFTPYITFGIGAFNYDPFAYLGGKKYNLRSLATEGQGSTLYPDRKPYNSMAVCVPFGVGFKYSINEKMNIGFEIVHRFTTTDYLDDVSKTYVDPSVFPALADGSPSPAKLLSDRSYELGEPIGVPGRQRGNSQQKDQFATALIYLTFNLQSYRCPTAN

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
116 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
119 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
120 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
121 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
122 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
123 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
131 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
132 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
133 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
134 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
135 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
136 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
155 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
156 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
157 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
158 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
159 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
160 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
161 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
162 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
163 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
164 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
165 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
166 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
167 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
168 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
169 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
170 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
171 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
172 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
173 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
174 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
175 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
176 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
181 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
182 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
183 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
184 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
185 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 0.31
Rhizosphere 97.53
Stem 0
Stem Tuber 0
Unclassified 6.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10019310 3300009176 Bacteria 5339
2 CNXas_1000537 3300000545 Bacteria 2547
3 JGI24744J21845_10019340 3300002077 Unclassified 1347
4 rootL2_10109577 3300003322 Bacteria 2243
5 Ga0065714_10097666 3300005288 Bacteria 1730
6 Ga0065704_10121871 3300005289 Bacteria 1759
7 Ga0065712_10017165 3300005290 Bacteria 2570
8 Ga0065712_10068549 3300005290 Bacteria 9937
9 Ga0065712_10109877 3300005290 Bacteria 1847
10 Ga0065707_10098533 3300005295 Unclassified 3077
11 Ga0070690_100076624 3300005330 Bacteria 2182
12 Ga0070670_100103955 3300005331 Bacteria 2446
13 Ga0070670_100180216 3300005331 Unclassified 1834
14 Ga0068869_100016181 3300005334 Bacteria 5022
15 Ga0068869_100018989 3300005334 Bacteria 4688
16 Ga0068869_100039720 3300005334 Bacteria 3361
17 Ga0068869_100122489 3300005334 Bacteria 1990
18 Ga0068869_100164626 3300005334 Bacteria 1728
19 Ga0068869_100605932 3300005334 Unclassified 926
20 Ga0070666_10011558 3300005335 Bacteria 5545
21 Ga0068868_100040442 3300005338 Bacteria 3629
22 Ga0070689_100025319 3300005340 Bacteria 4457
23 Ga0070689_100211296 3300005340 Bacteria 1588
24 Ga0070689_100313400 3300005340 Bacteria 1308
25 Ga0070687_100078238 3300005343 Bacteria 1797
26 Ga0070668_100060209 3300005347 Bacteria 2940
27 Ga0070669_100003521 3300005353 Bacteria 11289
28 Ga0070669_100007803 3300005353 Bacteria 7647
29 Ga0070669_100038394 3300005353 Bacteria 3477
30 Ga0070675_100008660 3300005354 Bacteria 7900
31 Ga0070675_100021729 3300005354 Bacteria 5127
32 Ga0070675_100096673 3300005354 Bacteria 2481
33 Ga0070675_100363612 3300005354 Bacteria 1285
34 Ga0070673_100000916 3300005364 Bacteria 16669
35 Ga0070673_100001100 3300005364 Bacteria 15481
36 Ga0070673_100104786 3300005364 Bacteria 2336
37 Ga0070673_100143163 3300005364 Unclassified 2019
38 Ga0070688_100001727 3300005365 Bacteria 10890
39 Ga0070688_100041649 3300005365 Bacteria 2821
40 Ga0070688_100266509 3300005365 Bacteria 1225
41 Ga0070667_100211139 3300005367 Bacteria 1725
42 Ga0070701_10251573 3300005438 Bacteria 1067
43 Ga0070700_100025224 3300005441 Bacteria 3499
44 Ga0070663_100043234 3300005455 Bacteria 3170
45 Ga0070678_100006609 3300005456 Bacteria 6818
46 Ga0070662_100002353 3300005457 Bacteria 11625
47 Ga0068867_100006101 3300005459 Bacteria 8530
48 Ga0068867_100041309 3300005459 Bacteria 3370
49 Ga0070698_100004078 3300005471 Bacteria 16046
50 Ga0070698_100004771 3300005471 Bacteria 14879
51 Ga0070699_100057810 3300005518 Bacteria 3359
52 Ga0068853_100005178 3300005539 Bacteria 10198
53 Ga0070672_100003521 3300005543 Bacteria 10151
54 Ga0070672_100089301 3300005543 Bacteria 2483
55 Ga0070672_100424814 3300005543 Bacteria 1142
56 Ga0070704_100109244 3300005549 Bacteria 2101
57 Ga0070664_100268544 3300005564 Bacteria 1536
58 Ga0068857_100054608 3300005577 Bacteria 3545
59 Ga0068857_100056168 3300005577 Bacteria 3494
60 Ga0068854_100317187 3300005578 Bacteria 1266
61 Ga0068859_100005138 3300005617 Bacteria 13287
62 Ga0068859_100010568 3300005617 Bacteria 9294
63 Ga0068859_100015329 3300005617 Bacteria 7698
64 Ga0068859_100150890 3300005617 Bacteria 2399
65 Ga0068859_100543717 3300005617 Bacteria 1256
66 Ga0068864_100070954 3300005618 Bacteria 3032
67 Ga0068864_100226740 3300005618 Bacteria 1726
68 Ga0068864_100256741 3300005618 Bacteria 1624
69 Ga0068866_10003950 3300005718 Bacteria 6091
70 Ga0068861_100002876 3300005719 Bacteria 11343
71 Ga0068861_100006135 3300005719 Bacteria 8177
72 Ga0068861_100138653 3300005719 Bacteria 1982
73 Ga0068851_10026349 3300005834 Unclassified 2856
74 Ga0068870_10010041 3300005840 Bacteria 4330
75 Ga0068863_100047230 3300005841 Bacteria 4085
76 Ga0068863_100232569 3300005841 Bacteria 1778
77 Ga0068860_100020034 3300005843 Bacteria 6481
78 Ga0068860_100044927 3300005843 Bacteria 4210
79 Ga0068862_100001074 3300005844 Bacteria 26203
80 Ga0068862_100039587 3300005844 Bacteria 4004
81 Ga0068862_100042466 3300005844 Bacteria 3873
82 Ga0068862_100248661 3300005844 Bacteria 1620
83 Ga0068862_100297178 3300005844 Bacteria 1484
84 Ga0068862_100494252 3300005844 Bacteria 1160
85 Ga0075366_10016831 3300006195 Unclassified 4202
86 Ga0075366_10048705 3300006195 Bacteria 2513
87 Ga0097621_100012836 3300006237 Bacteria 6223
88 Ga0097621_100061425 3300006237 Unclassified 3082
89 Ga0068871_100009494 3300006358 Bacteria 7054
90 Ga0068871_100303357 3300006358 Bacteria 1402
91 Ga0075428_100006050 3300006844 Bacteria 13444
92 Ga0075428_100011158 3300006844 Bacteria 9998
93 Ga0075431_100010980 3300006847 Bacteria 9115
94 Ga0075433_10346066 3300006852 Bacteria 1314
95 Ga0075429_100001234 3300006880 Bacteria 20728
96 Ga0075429_100043823 3300006880 Bacteria 3892
97 Ga0068865_100000909 3300006881 Bacteria 16785
98 Ga0068865_100265019 3300006881 Bacteria 1362
99 Ga0075436_100289984 3300006914 Unclassified 1171
100 Ga0097620_100005138 3300006931 Bacteria 13287
101 Ga0097620_100010567 3300006931 Bacteria 9294
102 Ga0097620_100015329 3300006931 Bacteria 7698
103 Ga0097620_100150895 3300006931 Bacteria 2399
104 Ga0097620_100543766 3300006931 Bacteria 1256
105 Ga0111539_10000458 3300009094 Bacteria 51231
106 Ga0111539_10116690 3300009094 Bacteria 3130
107 Ga0111539_10208408 3300009094 Bacteria 2278
108 Ga0105247_10002367 3300009101 Bacteria 12851
109 Ga0114129_10115147 3300009147 Bacteria 3706
110 Ga0114129_10118009 3300009147 Unclassified 3655
111 Ga0105243_10225390 3300009148 Bacteria 1659
112 Ga0105242_10006996 3300009176 Bacteria 8710
113 Ga0105242_10013285 3300009176 Bacteria 6360
114 Ga0105242_10156166 3300009176 Bacteria 1993
115 Ga0105242_10225175 3300009176 Bacteria 1678
116 Ga0105248_10168833 3300009177 Unclassified 2466
117 Ga0105248_10564628 3300009177 Unclassified 1284
118 Ga0105249_10000623 3300009553 Bacteria 32238
119 Ga0105249_10001375 3300009553 Bacteria 21278
120 Ga0105249_10015124 3300009553 Bacteria 6828
121 Ga0105249_10015226 3300009553 Bacteria 6806
122 Ga0105249_10041054 3300009553 Bacteria 4204
123 Ga0105249_10048326 3300009553 Bacteria 3879
124 Ga0105249_10057024 3300009553 Bacteria 3577
125 Ga0105249_10110090 3300009553 Bacteria 2602
126 Ga0105249_10142165 3300009553 Unclassified 2302
127 Ga0105249_10309271 3300009553 Bacteria 1588
128 Ga0105246_10012692 3300011119 Bacteria 5264
129 Ga0157373_10241950 3300013100 Bacteria 1276
130 Ga0157370_10512934 3300013104 Bacteria 1101
131 Ga0157378_10096449 3300013297 Bacteria 2695
132 Ga0157378_10220543 3300013297 Bacteria 1803
133 Ga0163162_10021840 3300013306 Bacteria 6305
134 Ga0163162_10047707 3300013306 Bacteria 4292
135 Ga0163162_10084964 3300013306 Bacteria 3241
136 Ga0157372_10093114 3300013307 Bacteria 3429
137 Ga0157372_10156050 3300013307 Bacteria 2636
138 Ga0157372_10539035 3300013307 Bacteria 1360
139 Ga0157375_10013097 3300013308 Bacteria 7372
140 Ga0157375_10207564 3300013308 Bacteria 2116
141 Ga0163163_10092689 3300014325 Bacteria 3036
142 Ga0157380_10003936 3300014326 Bacteria 10251
143 Ga0157380_10023489 3300014326 Bacteria 4651
144 Ga0157380_10023958 3300014326 Bacteria 4612
145 Ga0157380_10205622 3300014326 Bacteria 1750
146 Ga0157380_10446321 3300014326 Unclassified 1241
147 Ga0157377_10004456 3300014745 Bacteria 6456
148 Ga0157379_10055279 3300014968 Bacteria 3547
149 Ga0157376_10173825 3300014969 Bacteria 1964
150 Ga0157376_10193068 3300014969 Unclassified 1868
151 Ga0207697_10011552 3300025315 Bacteria 3733
152 Ga0207697_10018405 3300025315 Bacteria 2865
153 Ga0207710_10002076 3300025900 Bacteria 9496
154 Ga0207688_10007081 3300025901 Bacteria 6099
155 Ga0207647_10042723 3300025904 Bacteria 2841
156 Ga0207645_10047996 3300025907 Bacteria 2726
157 Ga0207662_10122058 3300025918 Bacteria 1635
158 Ga0207662_10188957 3300025918 Unclassified 1328
159 Ga0207681_10004008 3300025923 Bacteria 9139
160 Ga0207681_10008505 3300025923 Bacteria 6272
161 Ga0207650_10009920 3300025925 Bacteria 6516
162 Ga0207650_10109466 3300025925 Unclassified 2137
163 Ga0207659_10018095 3300025926 Bacteria 4613
164 Ga0207659_10280540 3300025926 Bacteria 1362
165 Ga0207706_10015669 3300025933 Bacteria 6851
166 Ga0207706_10137223 3300025933 Bacteria 2152
167 Ga0207706_10305976 3300025933 Bacteria 1384
168 Ga0207686_10001595 3300025934 Bacteria 12714
169 Ga0207686_10019356 3300025934 Bacteria 3870
170 Ga0207686_10067339 3300025934 Bacteria 2291
171 Ga0207670_10044541 3300025936 Bacteria 2935
172 Ga0207704_10004894 3300025938 Bacteria 6152
173 Ga0207704_10266385 3300025938 Bacteria 1295
174 Ga0207691_10211542 3300025940 Bacteria 1684
175 Ga0207711_10291857 3300025941 Bacteria 1503
176 Ga0207689_10004255 3300025942 Bacteria 13015
177 Ga0207689_10005993 3300025942 Bacteria 10751
178 Ga0207689_10012780 3300025942 Bacteria 7173
179 Ga0207689_10027155 3300025942 Bacteria 4793
180 Ga0207689_10131411 3300025942 Bacteria 2060
181 Ga0207651_10068154 3300025960 Bacteria 2507
182 Ga0207651_10069620 3300025960 Bacteria 2485
183 Ga0207712_10002336 3300025961 Bacteria 12303
184 Ga0207712_10002565 3300025961 Bacteria 11677
185 Ga0207712_10005865 3300025961 Bacteria 7740
186 Ga0207712_10125402 3300025961 Bacteria 1949
187 Ga0207668_10011079 3300025972 Bacteria 5468
188 Ga0207658_10141665 3300025986 Bacteria 1946
189 Ga0207677_10464230 3300026023 Bacteria 1087
190 Ga0207703_10153196 3300026035 Unclassified 2012
191 Ga0207639_10336918 3300026041 Bacteria 1344
192 Ga0207641_10030859 3300026088 Bacteria 4441
193 Ga0207641_10213922 3300026088 Bacteria 1784
194 Ga0207648_10000820 3300026089 Bacteria 35151
195 Ga0207648_10004484 3300026089 Bacteria 14324
196 Ga0207648_10029939 3300026089 Bacteria 4828
197 Ga0207676_10041051 3300026095 Bacteria 3549
198 Ga0207676_10455595 3300026095 Bacteria 1207
199 Ga0207674_10010084 3300026116 Bacteria 10741
200 Ga0207674_10105391 3300026116 Bacteria 2798
201 Ga0207674_10537971 3300026116 Bacteria 1129
202 Ga0207675_100000646 3300026118 Bacteria 34270
203 Ga0207675_100022800 3300026118 Bacteria 5827
204 Ga0207675_100026754 3300026118 Bacteria 5369
205 Ga0207675_100028601 3300026118 Bacteria 5191
206 Ga0207675_100848619 3300026118 Unclassified 928
207 Ga0207683_10007903 3300026121 Bacteria 9099
208 Ga0207698_10045612 3300026142 Unclassified 3304
209 Ga0209999_1009339 3300027543 Bacteria 1772
210 Ga0207428_10033292 3300027907 Bacteria 4235
211 Ga0207428_10101957 3300027907 Bacteria 2217
212 Ga0268265_10003417 3300028380 Bacteria 11428
213 Ga0268265_10730054 3300028380 Bacteria 960
214 Ga0268264_10044523 3300028381 Bacteria 3682
215 Ga0268264_10091618 3300028381 Bacteria 2623
216 Ga0268264_10147875 3300028381 Bacteria 2103
217 Ga0268264_10156286 3300028381 Bacteria 2050
218 Ga0307405_10047082 3300031731 Bacteria 2654
219 Ga0307413_10031542 3300031824 Bacteria 2992
220 Ga0307410_10017934 3300031852 Bacteria 4265
221 Ga0307410_10139352 3300031852 Bacteria 1792
222 Ga0307406_10029854 3300031901 Bacteria 3305
223 Ga0307416_100026779 3300032002 Bacteria 4255
224 Ga0307414_10270865 3300032004 Bacteria 1422
225 Ga0307411_10077363 3300032005 Bacteria 2277
226 Ga0373947_0327455 3300035725 Bacteria 1025
227 Ga0439439_0028109 3300041406 Bacteria 1423
228 Ga0439466_0039945 3300041411 Bacteria 1571
229 Ga0451807_2036695 3300041486 Bacteria 1427
230 Ga0439431_0011224 3300041997 Bacteria 2044
231 Ga0439442_003418 3300042002 Bacteria 3139
232 Ga0439449_0021265 3300042007 Bacteria 2429
233 Ga0439457_009662 3300042014 Bacteria 2240
234 Ga0450923_008307 3300042125 Bacteria 1784
235 Ga0439444_0010766 3300042437 Unclassified 1467
236 Ga0495580_0144657 3300046472 Bacteria 1648
237 Ga0495594_0195972 3300046499 Bacteria 1151
238 Ga0495643_0077530 3300046522 Bacteria 1736
239 Ga0495621_0037567 3300046539 Bacteria 1685
240 Ga0495670_0082734 3300046691 Bacteria 1637
241 Ga0495672_0015170 3300047320 Bacteria 5244
242 Ga0495677_0084752 3300047445 Bacteria 1190
243 Ga0501290_008459 3300049513 Bacteria 1301
244 Ga0501290_015399 3300049513 Bacteria 1012
245 Ga0501291_001265 3300049514 Bacteria 2928
246 Ga0501292_000554 3300049515 Bacteria 4625
247 Ga0501297_002041 3300049520 Bacteria 1924
248 Ga0501298_001476 3300049521 Bacteria 3462
249 Ga0501298_016165 3300049521 Bacteria 1350
250 Ga0501300_014447 3300049523 Bacteria 1152
251 Ga0501031_0096863 3300049568 Bacteria 1925
252 Ga0501032_0002512 3300049569 Bacteria 14333
253 Ga0501032_0014871 3300049569 Bacteria 5507
254 Ga0501034_0021380 3300049571 Bacteria 6596
255 Ga0501036_0001790 3300049572 Bacteria 16682
256 Ga0501036_0003646 3300049572 Bacteria 12314
257 Ga0501037_0003854 3300049573 Bacteria 10888
258 Ga0501038_0029203 3300049574 Bacteria 4889
259 Ga0501039_0010019 3300049575 Bacteria 7227
260 Ga0501040_0174668 3300049576 Bacteria 1522
261 Ga0501043_0017720 3300049579 Bacteria 5584
262 Ga0501046_0002298 3300049580 Bacteria 18017
263 Ga0501047_0016990 3300049581 Bacteria 6957
264 Ga0501067_0002639 3300049583 Bacteria 9930
265 Ga0501068_0003224 3300049584 Bacteria 8739
266 Ga0501070_0033074 3300049586 Bacteria 4325
267 Ga0501073_0001470 3300049589 Bacteria 17454
268 Ga0501074_0000494 3300049590 Bacteria 24088
269 Ga0501077_0018634 3300049593 Bacteria 4390
270 Ga0501201_000606 3300049651 Bacteria 3333
271 Ga0501202_000038 3300049652 Bacteria 13051
272 Ga0501206_000222 3300049653 Bacteria 6647
273 Ga0501207_000097 3300049654 Bacteria 7189
274 Ga0501207_015666 3300049654 Bacteria 1169
275 Ga0501217_000447 3300049661 Bacteria 6702
276 Ga0501222_000887 3300049662 Bacteria 4312
277 Ga0501223_001303 3300049663 Bacteria 5792
278 Ga0501223_005349 3300049663 Bacteria 2700
279 Ga0501224_007497 3300049664 Bacteria 1590
280 Ga0501228_001683 3300049666 Bacteria 1648
281 Ga0501233_007396 3300049668 Bacteria 2087
282 Ga0501233_050781 3300049668 Bacteria 1004
283 Ga0501235_000401 3300049669 Bacteria 8342
284 Ga0501240_000779 3300049673 Bacteria 2824
285 Ga0501240_019617 3300049673 Bacteria 1006
286 Ga0501242_003064 3300049674 Bacteria 1791
287 Ga0501243_001502 3300049675 Bacteria 3350
288 Ga0501249_008066 3300049679 Bacteria 2185
289 Ga0501253_001217 3300049683 Bacteria 2552
290 Ga0501257_003929 3300049686 Bacteria 3224
291 Ga0501259_004014 3300049688 Bacteria 2338
292 Ga0501261_001036 3300049690 Bacteria 3415
293 Ga0501221_009171 3300049704 Bacteria 1732
294 Ga0501225_0000918 3300049705 Bacteria 9191
295 Ga0501225_0009786 3300049705 Bacteria 2724
296 Ga0501234_001734 3300049707 Bacteria 3428
297 Ga0501245_000732 3300049708 Bacteria 4072
298 Ga0501079_0261945 3300049741 Bacteria 1351
299 Ga0501080_0007106 3300049742 Bacteria 10106
300 Ga0501080_0046135 3300049742 Bacteria 4059
301 Ga0501083_0004351 3300049744 Bacteria 9976
302 Ga0501266_010609 3300049763 Bacteria 1175
303 Ga0501273_007147 3300049770 Bacteria 1309
304 Ga0501279_015846 3300049775 Bacteria 1046
305 Ga0501280_020985 3300049776 Bacteria 972
306 Ga0501282_006100 3300049778 Bacteria 1290
307 Ga0501283_003397 3300049779 Bacteria 2102
308 Ga0501035_0002001 3300049822 Bacteria 20361
309 Ga0501035_0453631 3300049822 Bacteria 1060
310 Ga0501044_0007592 3300049823 Bacteria 11921
311 Ga0501044_0015990 3300049823 Bacteria 8073
312 Ga0501045_0163104 3300049824 Bacteria 1659
313 nmdc:mga0k408_38447_c1 3300050493 Unclassified 2746
314 nmdc:mga05p37_32082_c1 3300050507 Bacteria 6422
315 nmdc:mga09592_29097_c1 3300050508 Bacteria 4595
316 nmdc:mga09592_2958_c1 3300050508 Bacteria 13771
317 nmdc:mga0qj67_20774_c1 3300050509 Bacteria 5028
318 nmdc:mga06r32_19990_c1 3300050510 Bacteria 6156
319 nmdc:mga08y16_35797_c1 3300050511 Bacteria 5214
320 nmdc:mga08y16_656376_c1 3300050511 Bacteria 1053
321 Ga0500641_0011439 3300053096 Bacteria 3221
322 Ga0500568_0000080 3300053139 Bacteria 92694
323 Ga0500611_000060 3300053727 Bacteria 47744
324 Ga0501084_0009558 3300054114 Bacteria 8027
325 Ga0105242_10019310
326 CNXas_1000537
327 JGI24744J21845_10019340
328 rootL2_10109577
329 Ga0065714_10097666
330 Ga0065704_10121871
331 Ga0065712_10017165
332 Ga0065712_10068549
333 Ga0065712_10109877
334 Ga0065707_10098533
335 Ga0070690_100076624
336 Ga0070670_100103955
337 Ga0070670_100180216
338 Ga0068869_100016181
339 Ga0068869_100018989
340 Ga0068869_100039720
341 Ga0068869_100122489
342 Ga0068869_100164626
343 Ga0068869_100605932
344 Ga0070666_10011558
345 Ga0068868_100040442
346 Ga0070689_100025319
347 Ga0070689_100211296
348 Ga0070689_100313400
349 Ga0070687_100078238
350 Ga0070668_100060209
351 Ga0070669_100003521
352 Ga0070669_100007803
353 Ga0070669_100038394
354 Ga0070675_100008660
355 Ga0070675_100021729
356 Ga0070675_100096673
357 Ga0070675_100363612
358 Ga0070673_100000916
359 Ga0070673_100001100
360 Ga0070673_100104786
361 Ga0070673_100143163
362 Ga0070688_100001727
363 Ga0070688_100041649
364 Ga0070688_100266509
365 Ga0070667_100211139
366 Ga0070701_10251573
367 Ga0070700_100025224
368 Ga0070663_100043234
369 Ga0070678_100006609
370 Ga0070662_100002353
371 Ga0068867_100006101
372 Ga0068867_100041309
373 Ga0070698_100004078
374 Ga0070698_100004771
375 Ga0070699_100057810
376 Ga0068853_100005178
377 Ga0070672_100003521
378 Ga0070672_100089301
379 Ga0070672_100424814
380 Ga0070704_100109244
381 Ga0070664_100268544
382 Ga0068857_100054608
383 Ga0068857_100056168
384 Ga0068854_100317187
385 Ga0068859_100005138
386 Ga0068859_100010568
387 Ga0068859_100015329
388 Ga0068859_100150890
389 Ga0068859_100543717
390 Ga0068864_100070954
391 Ga0068864_100226740
392 Ga0068864_100256741
393 Ga0068866_10003950
394 Ga0068861_100002876
395 Ga0068861_100006135
396 Ga0068861_100138653
397 Ga0068851_10026349
398 Ga0068870_10010041
399 Ga0068863_100047230
400 Ga0068863_100232569
401 Ga0068860_100020034
402 Ga0068860_100044927
403 Ga0068862_100001074
404 Ga0068862_100039587
405 Ga0068862_100042466
406 Ga0068862_100248661
407 Ga0068862_100297178
408 Ga0068862_100494252
409 Ga0075366_10016831
410 Ga0075366_10048705
411 Ga0097621_100012836
412 Ga0097621_100061425
413 Ga0068871_100009494
414 Ga0068871_100303357
415 Ga0075428_100006050
416 Ga0075428_100011158
417 Ga0075431_100010980
418 Ga0075433_10346066
419 Ga0075429_100001234
420 Ga0075429_100043823
421 Ga0068865_100000909
422 Ga0068865_100265019
423 Ga0075436_100289984
424 Ga0097620_100005138
425 Ga0097620_100010567
426 Ga0097620_100015329
427 Ga0097620_100150895
428 Ga0097620_100543766
429 Ga0111539_10000458
430 Ga0111539_10116690
431 Ga0111539_10208408
432 Ga0105247_10002367
433 Ga0114129_10115147
434 Ga0114129_10118009
435 Ga0105243_10225390
436 Ga0105242_10006996
437 Ga0105242_10013285
438 Ga0105242_10156166
439 Ga0105242_10225175
440 Ga0105248_10168833
441 Ga0105248_10564628
442 Ga0105249_10000623
443 Ga0105249_10001375
444 Ga0105249_10015124
445 Ga0105249_10015226
446 Ga0105249_10041054
447 Ga0105249_10048326
448 Ga0105249_10057024
449 Ga0105249_10110090
450 Ga0105249_10142165
451 Ga0105249_10309271
452 Ga0105246_10012692
453 Ga0157373_10241950
454 Ga0157370_10512934
455 Ga0157378_10096449
456 Ga0157378_10220543
457 Ga0163162_10021840
458 Ga0163162_10047707
459 Ga0163162_10084964
460 Ga0157372_10093114
461 Ga0157372_10156050
462 Ga0157372_10539035
463 Ga0157375_10013097
464 Ga0157375_10207564
465 Ga0163163_10092689
466 Ga0157380_10003936
467 Ga0157380_10023489
468 Ga0157380_10023958
469 Ga0157380_10205622
470 Ga0157380_10446321
471 Ga0157377_10004456
472 Ga0157379_10055279
473 Ga0157376_10173825
474 Ga0157376_10193068
475 Ga0207697_10011552
476 Ga0207697_10018405
477 Ga0207710_10002076
478 Ga0207688_10007081
479 Ga0207647_10042723
480 Ga0207645_10047996
481 Ga0207662_10122058
482 Ga0207662_10188957
483 Ga0207681_10004008
484 Ga0207681_10008505
485 Ga0207650_10009920
486 Ga0207650_10109466
487 Ga0207659_10018095
488 Ga0207659_10280540
489 Ga0207706_10015669
490 Ga0207706_10137223
491 Ga0207706_10305976
492 Ga0207686_10001595
493 Ga0207686_10019356
494 Ga0207686_10067339
495 Ga0207670_10044541
496 Ga0207704_10004894
497 Ga0207704_10266385
498 Ga0207691_10211542
499 Ga0207711_10291857
500 Ga0207689_10004255
501 Ga0207689_10005993
502 Ga0207689_10012780
503 Ga0207689_10027155
504 Ga0207689_10131411
505 Ga0207651_10068154
506 Ga0207651_10069620
507 Ga0207712_10002336
508 Ga0207712_10002565
509 Ga0207712_10005865
510 Ga0207712_10125402
511 Ga0207668_10011079
512 Ga0207658_10141665
513 Ga0207677_10464230
514 Ga0207703_10153196
515 Ga0207639_10336918
516 Ga0207641_10030859
517 Ga0207641_10213922
518 Ga0207648_10000820
519 Ga0207648_10004484
520 Ga0207648_10029939
521 Ga0207676_10041051
522 Ga0207676_10455595
523 Ga0207674_10010084
524 Ga0207674_10105391
525 Ga0207674_10537971
526 Ga0207675_100000646
527 Ga0207675_100022800
528 Ga0207675_100026754
529 Ga0207675_100028601
530 Ga0207675_100848619
531 Ga0207683_10007903
532 Ga0207698_10045612
533 Ga0209999_1009339
534 Ga0207428_10033292
535 Ga0207428_10101957
536 Ga0268265_10003417
537 Ga0268265_10730054
538 Ga0268264_10044523
539 Ga0268264_10091618
540 Ga0268264_10147875
541 Ga0268264_10156286
542 Ga0307405_10047082
543 Ga0307413_10031542
544 Ga0307410_10017934
545 Ga0307410_10139352
546 Ga0307406_10029854
547 Ga0307416_100026779
548 Ga0307414_10270865
549 Ga0307411_10077363
550 Ga0373947_0327455
551 Ga0439439_0028109
552 Ga0439466_0039945
553 Ga0451807_2036695
554 Ga0439431_0011224
555 Ga0439442_003418
556 Ga0439449_0021265
557 Ga0439457_009662
558 Ga0450923_008307
559 Ga0439444_0010766
560 Ga0495580_0144657
561 Ga0495594_0195972
562 Ga0495643_0077530
563 Ga0495621_0037567
564 Ga0495670_0082734
565 Ga0495672_0015170
566 Ga0495677_0084752
567 Ga0501290_008459
568 Ga0501290_015399
569 Ga0501291_001265
570 Ga0501292_000554
571 Ga0501297_002041
572 Ga0501298_001476
573 Ga0501298_016165
574 Ga0501300_014447
575 Ga0501031_0096863
576 Ga0501032_0002512
577 Ga0501032_0014871
578 Ga0501034_0021380
579 Ga0501036_0001790
580 Ga0501036_0003646
581 Ga0501037_0003854
582 Ga0501038_0029203
583 Ga0501039_0010019
584 Ga0501040_0174668
585 Ga0501043_0017720
586 Ga0501046_0002298
587 Ga0501047_0016990
588 Ga0501067_0002639
589 Ga0501068_0003224
590 Ga0501070_0033074
591 Ga0501073_0001470
592 Ga0501074_0000494
593 Ga0501077_0018634
594 Ga0501201_000606
595 Ga0501202_000038
596 Ga0501206_000222
597 Ga0501207_000097
598 Ga0501207_015666
599 Ga0501217_000447
600 Ga0501222_000887
601 Ga0501223_001303
602 Ga0501223_005349
603 Ga0501224_007497
604 Ga0501228_001683
605 Ga0501233_007396
606 Ga0501233_050781
607 Ga0501235_000401
608 Ga0501240_000779
609 Ga0501240_019617
610 Ga0501242_003064
611 Ga0501243_001502
612 Ga0501249_008066
613 Ga0501253_001217
614 Ga0501257_003929
615 Ga0501259_004014
616 Ga0501261_001036
617 Ga0501221_009171
618 Ga0501225_0000918
619 Ga0501225_0009786
620 Ga0501234_001734
621 Ga0501245_000732
622 Ga0501079_0261945
623 Ga0501080_0007106
624 Ga0501080_0046135
625 Ga0501083_0004351
626 Ga0501266_010609
627 Ga0501273_007147
628 Ga0501279_015846
629 Ga0501280_020985
630 Ga0501282_006100
631 Ga0501283_003397
632 Ga0501035_0002001
633 Ga0501035_0453631
634 Ga0501044_0007592
635 Ga0501044_0015990
636 Ga0501045_0163104
637 nmdc:mga0k408_38447_c1
638 nmdc:mga05p37_32082_c1
639 nmdc:mga09592_29097_c1
640 nmdc:mga09592_2958_c1
641 nmdc:mga0qj67_20774_c1
642 nmdc:mga06r32_19990_c1
643 nmdc:mga08y16_35797_c1
644 nmdc:mga08y16_656376_c1
645 Ga0500641_0011439
646 Ga0500568_0000080
647 Ga0500611_000060
648 Ga0501084_0009558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19573

DUF6089

Domain of unknown function (DUF6089)

24

239

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nb3-assembly1.cif.gz_A the host outer membrane proteins ompa and ompc are packed at specific sites in the shigella phage sf6 virion as structural components 0.7889 30 277
3nb3-assembly1.cif.gz_A the host outer membrane proteins ompa and ompc are packed at specific sites in the shigella phage sf6 virion as structural components 0.7561 30 277
4rlc-assembly1.cif.gz_A crystal structure of the n-terminal beta-barrel domain of pseudomonas aeruginosa oprf 0.7204 33 277
1bxw-assembly1.cif.gz_A outer membrane protein a (ompa) transmembrane domain 0.7048 27 277
4rlc-assembly1.cif.gz_A crystal structure of the n-terminal beta-barrel domain of pseudomonas aeruginosa oprf 0.6967 33 277
ID Description Score Start End Superfamily
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.7889 30 277 2.40.160.20
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.7561 30 277 2.40.160.20
4rlcA00 Mainly Beta;Beta Barrel;Porin; 0.7204 33 277 2.40.160.20
4rlcA00 Mainly Beta;Beta Barrel;Porin; 0.6967 33 277 2.40.160.20
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.6784 32 277 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A317J0U1-F1-model_v4 DUF6089 domain-containing protein 0.8832 20 218
AF-A0A0E9N0F1-F1-model_v4 DUF6089 domain-containing protein 0.8816 27 286
AF-A0A0E9N0F1-F1-model_v4 DUF6089 domain-containing protein 0.8687 27 286
AF-A0A838T563-F1-model_v4 DUF6089 domain-containing protein 0.8681 31 286
AF-A0A1I0PI55-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8655 22 282

Map