F407298

General Info

Members Datasets Scaffolds Average Seq Length
324 183 648 145

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10000381|Ga0081538_1000038137
Length 157
Sequence MDNAAPTTPTGAAGLIEDTTLRMERTFQAPAQAVFDAWTSEEVMRRWWHAGHDWETTEAEVDLRVGGEVRVVMRNPHEDVEYGGGGRYTEIDPPNRLAFTWIWDGDDRRQLIELEFDENDGVTTVRFTHSNLWDEEAVRSHEDGWTRAFDNLERTLG

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
100 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
101 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
102 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
103 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
104 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
112 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
113 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
114 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 6.17
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10000381 3300005981 Bacteria 50433
2 CNBas_1006274 3300000531 Bacteria 686
3 JGI25406J46586_10106367 3300003203 Bacteria 833
4 JGI25406J46586_10202877 3300003203 Bacteria 579
5 JGI25407J50210_10000785 3300003373 Bacteria 6714
6 JGI25407J50210_10007115 3300003373 Bacteria 2799
7 JGI25407J50210_10010923 3300003373 Bacteria 2316
8 JGI25407J50210_10034137 3300003373 Bacteria 1312
9 Ga0070690_100398752 3300005330 Bacteria 1010
10 Ga0070666_10077798 3300005335 Bacteria 2264
11 Ga0070682_100043412 3300005337 Bacteria 2780
12 Ga0070682_101457895 3300005337 Unclassified 587
13 Ga0070689_100392073 3300005340 Bacteria 1172
14 Ga0070691_10032182 3300005341 Bacteria 2463
15 Ga0070668_100091637 3300005347 Bacteria 2396
16 Ga0070668_100376215 3300005347 Bacteria 1208
17 Ga0070671_101034906 3300005355 Bacteria 720
18 Ga0070674_100129890 3300005356 Bacteria 1877
19 Ga0070674_100703217 3300005356 Bacteria 864
20 Ga0070659_100891612 3300005366 Bacteria 777
21 Ga0070705_100208960 3300005440 Bacteria 1344
22 Ga0070700_100137257 3300005441 Bacteria 1658
23 Ga0070663_100941908 3300005455 Bacteria 748
24 Ga0070678_100563891 3300005456 Bacteria 1012
25 Ga0070678_101551178 3300005456 Bacteria 621
26 Ga0070678_101840426 3300005456 Bacteria 571
27 Ga0070662_100002010 3300005457 Bacteria 12457
28 Ga0070662_100174411 3300005457 Bacteria 1691
29 Ga0070662_100678150 3300005457 Bacteria 871
30 Ga0070662_101062400 3300005457 Bacteria 694
31 Ga0070699_100222818 3300005518 Bacteria 1681
32 Ga0070684_100214818 3300005535 Bacteria 1754
33 Ga0070684_100752555 3300005535 Bacteria 910
34 Ga0070684_101638774 3300005535 Bacteria 607
35 Ga0070684_101800112 3300005535 Bacteria 578
36 Ga0070672_100808492 3300005543 Bacteria 825
37 Ga0070686_100061753 3300005544 Bacteria 2422
38 Ga0070686_100223935 3300005544 Bacteria 1361
39 Ga0070696_100051232 3300005546 Bacteria 2871
40 Ga0070696_100076942 3300005546 Bacteria 2357
41 Ga0070693_100380825 3300005547 Bacteria 973
42 Ga0068854_100959719 3300005578 Bacteria 755
43 Ga0070702_100003092 3300005615 Bacteria 7365
44 Ga0068852_100295717 3300005616 Bacteria 1566
45 Ga0068866_10045188 3300005718 Bacteria 2207
46 Ga0068866_10516976 3300005718 Bacteria 793
47 Ga0068861_100206752 3300005719 Bacteria 1651
48 Ga0068863_101272248 3300005841 Bacteria 742
49 Ga0068860_100394791 3300005843 Bacteria 1368
50 Ga0081455_10032636 3300005937 Bacteria 4690
51 Ga0081455_10207332 3300005937 Bacteria 1463
52 Ga0081455_10379824 3300005937 Bacteria 987
53 Ga0081455_10500127 3300005937 Bacteria 817
54 Ga0081538_10001318 3300005981 Bacteria 25623
55 Ga0081538_10002051 3300005981 Bacteria 20100
56 Ga0081538_10002429 3300005981 Bacteria 18262
57 Ga0081538_10004302 3300005981 Bacteria 13164
58 Ga0081538_10008226 3300005981 Bacteria 8892
59 Ga0081538_10036097 3300005981 Bacteria 3233
60 Ga0081538_10037377 3300005981 Bacteria 3151
61 Ga0081538_10038386 3300005981 Bacteria 3090
62 Ga0081538_10051730 3300005981 Bacteria 2463
63 Ga0081538_10066374 3300005981 Bacteria 2023
64 Ga0081538_10143613 3300005981 Bacteria 1095
65 Ga0081540_1003590 3300005983 Bacteria 12182
66 Ga0081539_10005710 3300005985 Bacteria 12454
67 Ga0075365_10220082 3300006038 Bacteria 1332
68 Ga0097621_100015857 3300006237 Bacteria 5682
69 Ga0068871_100228515 3300006358 Bacteria 1614
70 Ga0075428_100058029 3300006844 Bacteria 4237
71 Ga0075428_100252880 3300006844 Bacteria 1898
72 Ga0075428_100369326 3300006844 Bacteria 1539
73 Ga0075428_100370854 3300006844 Bacteria 1535
74 Ga0075428_100393831 3300006844 Bacteria 1485
75 Ga0075428_100672388 3300006844 Bacteria 1104
76 Ga0075428_102063077 3300006844 Bacteria 590
77 Ga0075430_100001114 3300006846 Bacteria 21391
78 Ga0075430_100032232 3300006846 Bacteria 4449
79 Ga0075430_100798212 3300006846 Bacteria 778
80 Ga0075431_100067295 3300006847 Bacteria 3697
81 Ga0075431_100123716 3300006847 Bacteria 2668
82 Ga0075431_100265507 3300006847 Bacteria 1741
83 Ga0075431_100390701 3300006847 Bacteria 1394
84 Ga0075431_100668537 3300006847 Bacteria 1018
85 Ga0075431_101257294 3300006847 Bacteria 702
86 Ga0075433_10489603 3300006852 Bacteria 1083
87 Ga0075433_11050538 3300006852 Bacteria 709
88 Ga0075429_100576760 3300006880 Bacteria 986
89 Ga0068865_100038351 3300006881 Bacteria 3243
90 Ga0068865_100651595 3300006881 Bacteria 895
91 Ga0111539_10047933 3300009094 Bacteria 5103
92 Ga0111539_10051190 3300009094 Bacteria 4919
93 Ga0111539_10116267 3300009094 Bacteria 3136
94 Ga0111539_10174984 3300009094 Bacteria 2507
95 Ga0111539_10229763 3300009094 Bacteria 2160
96 Ga0111539_10336087 3300009094 Bacteria 1758
97 Ga0111539_11262092 3300009094 Bacteria 857
98 Ga0111539_11865494 3300009094 Bacteria 697
99 Ga0105245_10000728 3300009098 Bacteria 29647
100 Ga0105245_10117455 3300009098 Bacteria 2481
101 Ga0105245_10785980 3300009098 Bacteria 989
102 Ga0105245_11802196 3300009098 Bacteria 665
103 Ga0105247_10012815 3300009101 Bacteria 5031
104 Ga0114129_10049372 3300009147 Bacteria 5912
105 Ga0114129_10106826 3300009147 Bacteria 3867
106 Ga0114129_10815290 3300009147 Bacteria 1189
107 Ga0114129_10822433 3300009147 Bacteria 1183
108 Ga0114129_12442208 3300009147 Bacteria 625
109 Ga0114129_12494113 3300009147 Bacteria 618
110 Ga0114129_12567112 3300009147 Bacteria 608
111 Ga0105241_10094979 3300009174 Bacteria 2359
112 Ga0105242_10013361 3300009176 Bacteria 6343
113 Ga0105242_10807618 3300009176 Bacteria 929
114 Ga0105242_11344768 3300009176 Bacteria 740
115 Ga0105248_10024000 3300009177 Bacteria 6779
116 Ga0105249_10086578 3300009553 Bacteria 2922
117 Ga0105249_10444475 3300009553 Bacteria 1334
118 Ga0105239_10264894 3300010375 Bacteria 1932
119 Ga0105239_10619353 3300010375 Bacteria 1235
120 Ga0105239_11901193 3300010375 Bacteria 690
121 Ga0157369_11887378 3300013105 Bacteria 606
122 Ga0163162_10013834 3300013306 Bacteria 7883
123 Ga0157372_10368962 3300013307 Bacteria 1672
124 Ga0157372_11714831 3300013307 Bacteria 723
125 Ga0157380_12618539 3300014326 Bacteria 571
126 Ga0157379_10076525 3300014968 Bacteria 2997
127 Ga0157376_10010669 3300014969 Bacteria 6734
128 Ga0163161_10166611 3300017792 Bacteria 1683
129 Ga0207642_10067691 3300025899 Bacteria 1687
130 Ga0207710_10170453 3300025900 Bacteria 1064
131 Ga0207680_10779897 3300025903 Bacteria 685
132 Ga0207654_10604504 3300025911 Bacteria 783
133 Ga0207687_10020070 3300025927 Bacteria 4432
134 Ga0207687_11440317 3300025927 Bacteria 592
135 Ga0207706_10009359 3300025933 Bacteria 8996
136 Ga0207706_10136495 3300025933 Bacteria 2158
137 Ga0207706_10967018 3300025933 Bacteria 717
138 Ga0207686_10234549 3300025934 Bacteria 1332
139 Ga0207686_10759133 3300025934 Bacteria 775
140 Ga0207709_10436598 3300025935 Bacteria 1009
141 Ga0207670_11032420 3300025936 Bacteria 692
142 Ga0207669_10858253 3300025937 Bacteria 756
143 Ga0207691_11640476 3300025940 Bacteria 522
144 Ga0207689_10571446 3300025942 Bacteria 950
145 Ga0207661_10236259 3300025944 Bacteria 1620
146 Ga0207679_10561670 3300025945 Bacteria 1025
147 Ga0207712_10023949 3300025961 Bacteria 4035
148 Ga0207712_10823968 3300025961 Bacteria 817
149 Ga0207668_10054371 3300025972 Bacteria 2779
150 Ga0207668_10438720 3300025972 Bacteria 1112
151 Ga0207703_10861401 3300026035 Bacteria 867
152 Ga0207708_10186011 3300026075 Bacteria 1651
153 Ga0207702_10170814 3300026078 Bacteria 1994
154 Ga0207641_11280071 3300026088 Bacteria 734
155 Ga0207648_11856020 3300026089 Bacteria 564
156 Ga0207674_10936616 3300026116 Bacteria 835
157 Ga0207674_11438175 3300026116 Bacteria 659
158 Ga0207675_100005296 3300026118 Bacteria 12403
159 Ga0207675_100232317 3300026118 Bacteria 1780
160 Ga0207675_100910097 3300026118 Bacteria 896
161 Ga0207683_10000215 3300026121 Bacteria 50395
162 Ga0207683_10816920 3300026121 Bacteria 865
163 Ga0207683_10822945 3300026121 Bacteria 862
164 Ga0207428_10046078 3300027907 Bacteria 3508
165 Ga0207428_10083489 3300027907 Bacteria 2491
166 Ga0207428_10091765 3300027907 Bacteria 2358
167 Ga0268265_11014817 3300028380 Bacteria 820
168 Ga0268264_10197075 3300028381 Bacteria 1840
169 Ga0307408_100194138 3300031548 Bacteria 1638
170 Ga0307405_10410476 3300031731 Bacteria 1063
171 Ga0307405_11907728 3300031731 Bacteria 530
172 Ga0307413_10250257 3300031824 Bacteria 1314
173 Ga0307413_10418266 3300031824 Bacteria 1055
174 Ga0307413_11400651 3300031824 Bacteria 615
175 Ga0307410_10142434 3300031852 Bacteria 1775
176 Ga0307410_10224066 3300031852 Bacteria 1448
177 Ga0307406_10033098 3300031901 Bacteria 3161
178 Ga0307406_10396344 3300031901 Bacteria 1093
179 Ga0307407_10063970 3300031903 Bacteria 2160
180 Ga0307412_10734115 3300031911 Bacteria 851
181 Ga0307409_100023420 3300031995 Bacteria 4279
182 Ga0307409_100753804 3300031995 Bacteria 977
183 Ga0307409_101160751 3300031995 Bacteria 795
184 Ga0307416_100001212 3300032002 Bacteria 13896
185 Ga0307416_100053746 3300032002 Bacteria 3233
186 Ga0307416_100228007 3300032002 Bacteria 1793
187 Ga0307416_100443172 3300032002 Bacteria 1349
188 Ga0307416_100751664 3300032002 Bacteria 1068
189 Ga0307416_101439250 3300032002 Bacteria 795
190 Ga0307414_10359894 3300032004 Bacteria 1252
191 Ga0307411_10465623 3300032005 Bacteria 1061
192 Ga0307411_10855092 3300032005 Bacteria 805
193 Ga0307411_11616677 3300032005 Bacteria 598
194 Ga0307415_100110858 3300032126 Bacteria 2036
195 Ga0307415_100219107 3300032126 Bacteria 1524
196 Ga0373959_0087329 3300034820 Bacteria 727
197 Ga0373929_0051505 3300035085 Bacteria 942
198 Ga0373940_0094041 3300035088 Bacteria 902
199 Ga0373960_0050998 3300035121 Bacteria 1228
200 Ga0373942_0110421 3300035207 Bacteria 850
201 Ga0373962_0011748 3300035242 Bacteria 2198
202 Ga0373931_0196326 3300035691 Bacteria 1203
203 Ga0395900_0180303 3300037418 Bacteria 2147
204 Ga0395898_0429586 3300037466 Bacteria 1259
205 Ga0395898_1181410 3300037466 Bacteria 697
206 Ga0395905_0276947 3300037471 Bacteria 1564
207 Ga0395905_1222992 3300037471 Bacteria 655
208 Ga0395901_0525814 3300038443 Bacteria 1201
209 Ga0451853_2238955 3300041512 Bacteria 872
210 Ga0439450_022434 3300042008 Bacteria 1363
211 Ga0439463_045559 3300042016 Bacteria 1117
212 Ga0439458_0149830 3300042157 Bacteria 625
213 Ga0439464_0030225 3300042439 Bacteria 1516
214 Ga0466963_0066020 3300044694 Bacteria 2426
215 Ga0466971_0134893 3300044719 Bacteria 1148
216 Ga0466957_0122820 3300044842 Bacteria 1657
217 Ga0466960_0047195 3300044901 Bacteria 2065
218 Ga0466960_0224730 3300044901 Bacteria 1034
219 Ga0466967_2475220 3300045976 Bacteria 514
220 Ga0495627_196197 3300046453 Bacteria 557
221 Ga0495590_0308030 3300046457 Bacteria 597
222 Ga0495605_0277596 3300046474 Bacteria 713
223 Ga0495584_0242436 3300046491 Bacteria 917
224 Ga0495584_0398064 3300046491 Bacteria 700
225 Ga0495620_0234653 3300046515 Bacteria 701
226 Ga0495620_0409837 3300046515 Bacteria 513
227 Ga0495637_0276455 3300046520 Bacteria 600
228 Ga0495643_0219459 3300046522 Bacteria 903
229 Ga0495644_0258223 3300046523 Bacteria 677
230 Ga0495609_0188319 3300046538 Bacteria 866
231 Ga0495656_0623803 3300046615 Bacteria 578
232 Ga0495668_0277814 3300046616 Bacteria 918
233 Ga0495646_0392490 3300046680 Unclassified 722
234 Ga0495671_0145436 3300046692 Bacteria 1155
235 Ga0495589_0307721 3300046794 Bacteria 734
236 Ga0495589_0437756 3300046794 Bacteria 599
237 Ga0495676_0004036 3300047321 Bacteria 13363
238 Ga0496100_0003219 3300048903 Bacteria 8479
239 Ga0496100_0021232 3300048903 Bacteria 3908
240 Ga0496101_0031109 3300048904 Bacteria 3749
241 Ga0496101_0154604 3300048904 Bacteria 1756
242 Ga0496102_0048551 3300048905 Bacteria 3859
243 Ga0496102_0050654 3300048905 Bacteria 3782
244 Ga0496103_0120555 3300048906 Bacteria 1670
245 Ga0496104_0033094 3300048907 Bacteria 4812
246 Ga0496105_0081873 3300048908 Bacteria 2666
247 Ga0496106_0003839 3300048909 Bacteria 11198
248 Ga0496106_0054415 3300048909 Bacteria 3023
249 Ga0496107_0030188 3300048910 Bacteria 3863
250 Ga0496107_0064593 3300048910 Bacteria 2653
251 Ga0496109_0271844 3300048912 Bacteria 1597
252 Ga0496109_1318979 3300048912 Bacteria 658
253 Ga0496110_0079155 3300048913 Bacteria 2926
254 Ga0496113_0144817 3300048916 Bacteria 1871
255 Ga0496114_0103425 3300048917 Bacteria 2434
256 Ga0496114_0310976 3300048917 Bacteria 1392
257 Ga0496114_0985733 3300048917 Bacteria 726
258 Ga0501031_0041907 3300049568 Bacteria 2989
259 Ga0501031_0540943 3300049568 Bacteria 750
260 Ga0501033_0155176 3300049570 Bacteria 1650
261 Ga0501034_0024478 3300049571 Bacteria 6142
262 Ga0501036_0038432 3300049572 Bacteria 4051
263 Ga0501036_0337137 3300049572 Bacteria 1259
264 Ga0501036_1423448 3300049572 Bacteria 562
265 Ga0501038_0445699 3300049574 Bacteria 996
266 Ga0501039_0076182 3300049575 Bacteria 2608
267 Ga0501040_0010563 3300049576 Bacteria 6038
268 Ga0501040_0474806 3300049576 Bacteria 901
269 Ga0501041_0111474 3300049577 Bacteria 1697
270 Ga0501042_0212052 3300049578 Bacteria 1397
271 Ga0501043_0332378 3300049579 Bacteria 1157
272 Ga0501046_0166718 3300049580 Bacteria 1655
273 Ga0501048_0089080 3300049582 Bacteria 2177
274 Ga0501048_0106145 3300049582 Bacteria 1982
275 Ga0501067_0380568 3300049583 Bacteria 787
276 Ga0501071_0024927 3300049587 Bacteria 4186
277 Ga0501071_0147379 3300049587 Bacteria 1754
278 Ga0501072_0020713 3300049588 Bacteria 5097
279 Ga0501072_0050925 3300049588 Bacteria 3261
280 Ga0501074_0061778 3300049590 Bacteria 2699
281 Ga0501074_0093996 3300049590 Bacteria 2147
282 Ga0501076_0027220 3300049592 Bacteria 4435
283 Ga0501077_0529382 3300049593 Bacteria 756
284 Ga0501079_0028959 3300049741 Bacteria 4251
285 Ga0501079_0111910 3300049741 Bacteria 2122
286 Ga0501081_0141049 3300049743 Bacteria 1727
287 Ga0501035_1399695 3300049822 Bacteria 536
288 Ga0501044_1115508 3300049823 Bacteria 658
289 Ga0501045_0076126 3300049824 Bacteria 2472
290 nmdc:mga03n38_273526_c1 3300050490 Bacteria 899
291 nmdc:mga0yw44_462195_c1 3300050492 Bacteria 860
292 nmdc:mga05p37_126495_c1 3300050507 Bacteria 3138
293 nmdc:mga05p37_1682722_c1 3300050507 Bacteria 620
294 nmdc:mga05p37_406794_c1 3300050507 Bacteria 1587
295 nmdc:mga05p37_54520_c1 3300050507 Bacteria 4919
296 nmdc:mga09592_151210_c1 3300050508 Bacteria 2003
297 nmdc:mga09592_304498_c1 3300050508 Bacteria 1381
298 nmdc:mga09592_50906_c1 3300050508 Bacteria 3493
299 nmdc:mga09592_594670_c1 3300050508 Bacteria 948
300 nmdc:mga0qj67_257402_c1 3300050509 Bacteria 1416
301 nmdc:mga0qj67_350339_c1 3300050509 Bacteria 1194
302 nmdc:mga0qj67_603_c1 3300050509 Bacteria 24553
303 nmdc:mga06r32_152921_c1 3300050510 Bacteria 2287
304 nmdc:mga06r32_291654_c1 3300050510 Bacteria 1618
305 nmdc:mga06r32_319937_c1 3300050510 Bacteria 1537
306 nmdc:mga06r32_380048_c1 3300050510 Bacteria 1395
307 nmdc:mga06r32_496626_c1 3300050510 Bacteria 1197
308 nmdc:mga06r32_579407_c1 3300050510 Bacteria 1094
309 nmdc:mga08y16_106401_c1 3300050511 Bacteria 2920
310 nmdc:mga08y16_165944_c1 3300050511 Bacteria 2294
311 nmdc:mga08y16_47661_c1 3300050511 Bacteria 4485
312 nmdc:mga0a205_210042_c1 3300050515 Bacteria 1835
313 nmdc:mga0a205_361738_c1 3300050515 Bacteria 1317
314 Ga0495655_0017310 3300053083 Bacteria 1568
315 Ga0495655_0069959 3300053083 Bacteria 979
316 Ga0495595_0254431 3300053084 Unclassified 880
317 Ga0501084_0331893 3300054114 Bacteria 1284
318 Ga0501082_0270332 3300060353 Bacteria 1479
319 Ga0501082_0357781 3300060353 Bacteria 1273
320 Ga0466962_0165688 3300061719 Bacteria 1075
321 Ga0530510_0005715 3300061734 Bacteria 8617
322 Ga0530510_0074580 3300061734 Bacteria 2463
323 Ga0530510_0669086 3300061734 Bacteria 791
324 Ga0530510_0671731 3300061734 Bacteria 789
325 Ga0081538_10000381
326 CNBas_1006274
327 JGI25406J46586_10106367
328 JGI25406J46586_10202877
329 JGI25407J50210_10000785
330 JGI25407J50210_10007115
331 JGI25407J50210_10010923
332 JGI25407J50210_10034137
333 Ga0070690_100398752
334 Ga0070666_10077798
335 Ga0070682_100043412
336 Ga0070682_101457895
337 Ga0070689_100392073
338 Ga0070691_10032182
339 Ga0070668_100091637
340 Ga0070668_100376215
341 Ga0070671_101034906
342 Ga0070674_100129890
343 Ga0070674_100703217
344 Ga0070659_100891612
345 Ga0070705_100208960
346 Ga0070700_100137257
347 Ga0070663_100941908
348 Ga0070678_100563891
349 Ga0070678_101551178
350 Ga0070678_101840426
351 Ga0070662_100002010
352 Ga0070662_100174411
353 Ga0070662_100678150
354 Ga0070662_101062400
355 Ga0070699_100222818
356 Ga0070684_100214818
357 Ga0070684_100752555
358 Ga0070684_101638774
359 Ga0070684_101800112
360 Ga0070672_100808492
361 Ga0070686_100061753
362 Ga0070686_100223935
363 Ga0070696_100051232
364 Ga0070696_100076942
365 Ga0070693_100380825
366 Ga0068854_100959719
367 Ga0070702_100003092
368 Ga0068852_100295717
369 Ga0068866_10045188
370 Ga0068866_10516976
371 Ga0068861_100206752
372 Ga0068863_101272248
373 Ga0068860_100394791
374 Ga0081455_10032636
375 Ga0081455_10207332
376 Ga0081455_10379824
377 Ga0081455_10500127
378 Ga0081538_10001318
379 Ga0081538_10002051
380 Ga0081538_10002429
381 Ga0081538_10004302
382 Ga0081538_10008226
383 Ga0081538_10036097
384 Ga0081538_10037377
385 Ga0081538_10038386
386 Ga0081538_10051730
387 Ga0081538_10066374
388 Ga0081538_10143613
389 Ga0081540_1003590
390 Ga0081539_10005710
391 Ga0075365_10220082
392 Ga0097621_100015857
393 Ga0068871_100228515
394 Ga0075428_100058029
395 Ga0075428_100252880
396 Ga0075428_100369326
397 Ga0075428_100370854
398 Ga0075428_100393831
399 Ga0075428_100672388
400 Ga0075428_102063077
401 Ga0075430_100001114
402 Ga0075430_100032232
403 Ga0075430_100798212
404 Ga0075431_100067295
405 Ga0075431_100123716
406 Ga0075431_100265507
407 Ga0075431_100390701
408 Ga0075431_100668537
409 Ga0075431_101257294
410 Ga0075433_10489603
411 Ga0075433_11050538
412 Ga0075429_100576760
413 Ga0068865_100038351
414 Ga0068865_100651595
415 Ga0111539_10047933
416 Ga0111539_10051190
417 Ga0111539_10116267
418 Ga0111539_10174984
419 Ga0111539_10229763
420 Ga0111539_10336087
421 Ga0111539_11262092
422 Ga0111539_11865494
423 Ga0105245_10000728
424 Ga0105245_10117455
425 Ga0105245_10785980
426 Ga0105245_11802196
427 Ga0105247_10012815
428 Ga0114129_10049372
429 Ga0114129_10106826
430 Ga0114129_10815290
431 Ga0114129_10822433
432 Ga0114129_12442208
433 Ga0114129_12494113
434 Ga0114129_12567112
435 Ga0105241_10094979
436 Ga0105242_10013361
437 Ga0105242_10807618
438 Ga0105242_11344768
439 Ga0105248_10024000
440 Ga0105249_10086578
441 Ga0105249_10444475
442 Ga0105239_10264894
443 Ga0105239_10619353
444 Ga0105239_11901193
445 Ga0157369_11887378
446 Ga0163162_10013834
447 Ga0157372_10368962
448 Ga0157372_11714831
449 Ga0157380_12618539
450 Ga0157379_10076525
451 Ga0157376_10010669
452 Ga0163161_10166611
453 Ga0207642_10067691
454 Ga0207710_10170453
455 Ga0207680_10779897
456 Ga0207654_10604504
457 Ga0207687_10020070
458 Ga0207687_11440317
459 Ga0207706_10009359
460 Ga0207706_10136495
461 Ga0207706_10967018
462 Ga0207686_10234549
463 Ga0207686_10759133
464 Ga0207709_10436598
465 Ga0207670_11032420
466 Ga0207669_10858253
467 Ga0207691_11640476
468 Ga0207689_10571446
469 Ga0207661_10236259
470 Ga0207679_10561670
471 Ga0207712_10023949
472 Ga0207712_10823968
473 Ga0207668_10054371
474 Ga0207668_10438720
475 Ga0207703_10861401
476 Ga0207708_10186011
477 Ga0207702_10170814
478 Ga0207641_11280071
479 Ga0207648_11856020
480 Ga0207674_10936616
481 Ga0207674_11438175
482 Ga0207675_100005296
483 Ga0207675_100232317
484 Ga0207675_100910097
485 Ga0207683_10000215
486 Ga0207683_10816920
487 Ga0207683_10822945
488 Ga0207428_10046078
489 Ga0207428_10083489
490 Ga0207428_10091765
491 Ga0268265_11014817
492 Ga0268264_10197075
493 Ga0307408_100194138
494 Ga0307405_10410476
495 Ga0307405_11907728
496 Ga0307413_10250257
497 Ga0307413_10418266
498 Ga0307413_11400651
499 Ga0307410_10142434
500 Ga0307410_10224066
501 Ga0307406_10033098
502 Ga0307406_10396344
503 Ga0307407_10063970
504 Ga0307412_10734115
505 Ga0307409_100023420
506 Ga0307409_100753804
507 Ga0307409_101160751
508 Ga0307416_100001212
509 Ga0307416_100053746
510 Ga0307416_100228007
511 Ga0307416_100443172
512 Ga0307416_100751664
513 Ga0307416_101439250
514 Ga0307414_10359894
515 Ga0307411_10465623
516 Ga0307411_10855092
517 Ga0307411_11616677
518 Ga0307415_100110858
519 Ga0307415_100219107
520 Ga0373959_0087329
521 Ga0373929_0051505
522 Ga0373940_0094041
523 Ga0373960_0050998
524 Ga0373942_0110421
525 Ga0373962_0011748
526 Ga0373931_0196326
527 Ga0395900_0180303
528 Ga0395898_0429586
529 Ga0395898_1181410
530 Ga0395905_0276947
531 Ga0395905_1222992
532 Ga0395901_0525814
533 Ga0451853_2238955
534 Ga0439450_022434
535 Ga0439463_045559
536 Ga0439458_0149830
537 Ga0439464_0030225
538 Ga0466963_0066020
539 Ga0466971_0134893
540 Ga0466957_0122820
541 Ga0466960_0047195
542 Ga0466960_0224730
543 Ga0466967_2475220
544 Ga0495627_196197
545 Ga0495590_0308030
546 Ga0495605_0277596
547 Ga0495584_0242436
548 Ga0495584_0398064
549 Ga0495620_0234653
550 Ga0495620_0409837
551 Ga0495637_0276455
552 Ga0495643_0219459
553 Ga0495644_0258223
554 Ga0495609_0188319
555 Ga0495656_0623803
556 Ga0495668_0277814
557 Ga0495646_0392490
558 Ga0495671_0145436
559 Ga0495589_0307721
560 Ga0495589_0437756
561 Ga0495676_0004036
562 Ga0496100_0003219
563 Ga0496100_0021232
564 Ga0496101_0031109
565 Ga0496101_0154604
566 Ga0496102_0048551
567 Ga0496102_0050654
568 Ga0496103_0120555
569 Ga0496104_0033094
570 Ga0496105_0081873
571 Ga0496106_0003839
572 Ga0496106_0054415
573 Ga0496107_0030188
574 Ga0496107_0064593
575 Ga0496109_0271844
576 Ga0496109_1318979
577 Ga0496110_0079155
578 Ga0496113_0144817
579 Ga0496114_0103425
580 Ga0496114_0310976
581 Ga0496114_0985733
582 Ga0501031_0041907
583 Ga0501031_0540943
584 Ga0501033_0155176
585 Ga0501034_0024478
586 Ga0501036_0038432
587 Ga0501036_0337137
588 Ga0501036_1423448
589 Ga0501038_0445699
590 Ga0501039_0076182
591 Ga0501040_0010563
592 Ga0501040_0474806
593 Ga0501041_0111474
594 Ga0501042_0212052
595 Ga0501043_0332378
596 Ga0501046_0166718
597 Ga0501048_0089080
598 Ga0501048_0106145
599 Ga0501067_0380568
600 Ga0501071_0024927
601 Ga0501071_0147379
602 Ga0501072_0020713
603 Ga0501072_0050925
604 Ga0501074_0061778
605 Ga0501074_0093996
606 Ga0501076_0027220
607 Ga0501077_0529382
608 Ga0501079_0028959
609 Ga0501079_0111910
610 Ga0501081_0141049
611 Ga0501035_1399695
612 Ga0501044_1115508
613 Ga0501045_0076126
614 nmdc:mga03n38_273526_c1
615 nmdc:mga0yw44_462195_c1
616 nmdc:mga05p37_126495_c1
617 nmdc:mga05p37_1682722_c1
618 nmdc:mga05p37_406794_c1
619 nmdc:mga05p37_54520_c1
620 nmdc:mga09592_151210_c1
621 nmdc:mga09592_304498_c1
622 nmdc:mga09592_50906_c1
623 nmdc:mga09592_594670_c1
624 nmdc:mga0qj67_257402_c1
625 nmdc:mga0qj67_350339_c1
626 nmdc:mga0qj67_603_c1
627 nmdc:mga06r32_152921_c1
628 nmdc:mga06r32_291654_c1
629 nmdc:mga06r32_319937_c1
630 nmdc:mga06r32_380048_c1
631 nmdc:mga06r32_496626_c1
632 nmdc:mga06r32_579407_c1
633 nmdc:mga08y16_106401_c1
634 nmdc:mga08y16_165944_c1
635 nmdc:mga08y16_47661_c1
636 nmdc:mga0a205_210042_c1
637 nmdc:mga0a205_361738_c1
638 Ga0495655_0017310
639 Ga0495655_0069959
640 Ga0495595_0254431
641 Ga0501084_0331893
642 Ga0501082_0270332
643 Ga0501082_0357781
644 Ga0466962_0165688
645 Ga0530510_0005715
646 Ga0530510_0074580
647 Ga0530510_0669086
648 Ga0530510_0671731

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

28

157

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9449 6 140
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9395 5 140
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9307 5 140
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8947 5 140
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8925 6 140
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9447 6 140 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8964 7 139 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8915 6 140 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.888 3 143 3.30.530.20
2lghA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8787 6 144 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1H2KMW6-F1-model_v4 Activator of Hsp90 ATPase homolog 1-like protein 0.985 7 93
AF-A0A538GGM6-F1-model_v4 ATPase 0.9793 3 143
AF-A0A087LJU3-F1-model_v4 deleted 0.9787 6 144
AF-A0A7D8ARQ4-F1-model_v4 deleted 0.9776 5 144
AF-A0A6N9BLW1-F1-model_v4 SRPBCC domain-containing protein 0.9713 3 140

Map